(data stored in ACNUC7820 zone)

EMBL: BC137188

ID   BC137188; SV 1; linear; mRNA; STD; HUM; 1007 BP.
XX
AC   BC137188;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens olfactory receptor, family 14, subfamily I, member 1, mRNA
DE   (cDNA clone MGC:168808 IMAGE:9021185), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1007
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1007
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e3eb1a7b80bfd6f5a7b1d7362659efea.
DR   Ensembl-Gn; ENSG00000189181; homo_sapiens.
DR   Ensembl-Tr; ENST00000342623; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Mike Brownstein, NIMH
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 672 Row: h Column: 15.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1007
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_362"
FT                   /clone="MGC:168808 IMAGE:9021185"
FT                   /tissue_type="Pooled, cerebellum, kidney, placenta, testis,
FT                   lung, colon, liver, heart, thyroid, bladder, uterus, PCR
FT                   rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: TGACTGAC"
FT                   /db_xref="taxon:9606"
FT   gene            1..1007
FT                   /gene="OR14I1"
FT   CDS_pept        25..960
FT                   /codon_start=1
FT                   /gene="OR14I1"
FT                   /product="olfactory receptor, family 14, subfamily I,
FT                   member 1"
FT                   /db_xref="GOA:A6ND48"
FT                   /db_xref="H-InvDB:HIT000501146.4"
FT                   /db_xref="HGNC:HGNC:19575"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6ND48"
FT                   /protein_id="AAI37189.1"
FT                   /translation="MDNLTKVTEFLLMEFSGIWELQVLHAGLFLLIYLAALVGNLLIIA
FT                   VITLNQHLHTPMYFFLKNLSVLDLCYISVTVPKSIRNSLTRRSSISYLGCVAQVYFFSA
FT                   FASAELAFLTVMSYDRYVAICHPLQYRAVMTSGGCYQMAVTTWLSCFSYAAVHTGNMFR
FT                   EHVCRSNVIHQFFRDIPHVLALVSCEVFFVEFLTLALSSCLVLGCFILMMISYFQIFST
FT                   VLRIPSGQSRAKAFSTCSPQLIVIMLFLTTGLFAALGPIAKALSIQDLVIALTYTVLPP
FT                   FLNPIIYSLRNKEIKTAMWRLFVKIYFLQK"
XX
SQ   Sequence 1007 BP; 221 A; 276 C; 202 G; 308 T; 0 other;
     tcagatcaca gatttccctg ccaaatggac aatctcacaa aagtgacaga attcctgctg        60
     atggagtttt ctggtatctg ggagctgcag gtgctgcacg ccgggctgtt tctgctgatt       120
     tatctggcag cgctggtggg gaacctgctc atcattgcgg tcatcactct caatcagcat       180
     cttcacacac ccatgtactt cttcctgaag aacctctctg ttttggatct gtgctacatc       240
     tcagtcactg tgcctaaatc catccgtaac tccctgactc gcagaagctc catctcttat       300
     cttggctgtg tggctcaagt ctattttttc tctgcctttg catctgctga gctggccttc       360
     cttactgtca tgtcttatga ccgctatgtt gccatttgcc accccctcca atacagagcc       420
     gtgatgacat caggagggtg ctatcagatg gcagtcacca cctggctaag ctgcttttcc       480
     tacgcagccg tccacactgg caacatgttt cgggagcacg tttgcagatc caatgtgatc       540
     caccagttct tccgtgacat ccctcatgtg ttggccctgg tttcctgtga ggttttcttt       600
     gtagagtttt tgaccctggc cctgagctca tgcttggttc tgggatgctt tattctcatg       660
     atgatctcct atttccaaat cttctcaacg gtgctcagaa tcccttcagg acagagtcga       720
     gcaaaagcct tctccacctg ctccccccag ctcattgtca tcatgctctt tcttaccaca       780
     gggctctttg ctgccttagg accaattgca aaagctctgt ccattcagga tttagtgatt       840
     gctctgacat acacagtttt gcctcccttc ctcaatccca tcatatatag tcttaggaat       900
     aaggagatta aaacagccat gtggagactc tttgtgaaga tatattttct gcaaaagtag       960
     aacatcctgg tctttactat agaagatctg caacaaaacc ccaaaaa                    1007
//

If you have problems or comments...

PBIL Back to PBIL home page