(data stored in ACNUC12215 zone)

EMBL: BC137522

ID   BC137522; SV 1; linear; mRNA; STD; HUM; 1593 BP.
XX
AC   BC137522;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Homo sapiens XK, Kell blood group complex subunit-related family, member 3,
DE   mRNA (cDNA clone MGC:169145 IMAGE:9021522), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1593
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1593
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 2c2865c23cba67e99dd29fb4a7d23561.
DR   Ensembl-Gn; ENSG00000172967; homo_sapiens.
DR   Ensembl-Tr; ENST00000331428; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Mike Brownstein, NIMH
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 673 Row: f Column: 16.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1593
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_362"
FT                   /clone="MGC:169145 IMAGE:9021522"
FT                   /tissue_type="Pooled, cerebellum, kidney, placenta, testis,
FT                   lung, colon, liver, heart, thyroid, bladder, uterus, PCR
FT                   rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: GATGAAGG"
FT                   /db_xref="taxon:9606"
FT   gene            1..1593
FT                   /gene="XKR3"
FT                   /note="synonyms: XRG3, XTES"
FT   CDS_pept        71..1450
FT                   /codon_start=1
FT                   /gene="XKR3"
FT                   /product="XK, Kell blood group complex subunit-related
FT                   family, member 3"
FT                   /db_xref="GOA:Q5GH77"
FT                   /db_xref="H-InvDB:HIT000501412.4"
FT                   /db_xref="HGNC:HGNC:28778"
FT                   /db_xref="InterPro:IPR018629"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5GH77"
FT                   /protein_id="AAI37523.1"
FT                   /translation="METVFEEMDEESTGGVSSSKEEIVLGQRLHLSFPFSIIFSTVLYC
FT                   GEVAFGLYMFEIYRKANDTFWMSFTISFIIVGAILDQIILMFFNKDLRRNKAALLFWHI
FT                   LLLGPIVRCLHTIRNYHKWLKNLKQEKEETQVSITKRNTMLEREIAFSIRDNFMQQKAF
FT                   KYMSVIQAFLGSVPQLILQMYISLTIREWPLNRALLMTFSLLSVTYGAIRCNILAIQIS
FT                   NDDTTIKLPPIEFFCVVMWRFLEVISRVVTLAFFIASLKLKSLPVLLIIYFVSLLAPWL
FT                   EFWKSGAHLPGNKENNSNMVGTVLMLFLITLLYAAINFSCWSAVKLQLSDDKIIDGRQR
FT                   WGHRILHYSFQFLENVIMILVFRFFGGKTLLNCCDSLIAVQLIISYLLATGFMLLFYQY
FT                   LYPWQSGKVLPGRTENQPEAPYYYVNIEKTEKNKNKQLRNYCHSCNRVGYFSIRKSMTC
FT                   S"
XX
SQ   Sequence 1593 BP; 477 A; 289 C; 333 G; 494 T; 0 other;
     tcagtgaaac tccctcccac tgtctcttgt attagcatca aggaagcgag aaaaaataag        60
     caccctgaga atggagacag tgtttgaaga gatggatgaa gaaagcacag gaggagtttc       120
     atcttcgaaa gaagaaatag tccttggcca gagactccat ctaagctttc cttttagcat       180
     tatcttctca actgttctct actgtggtga ggttgccttt ggtttataca tgtttgaaat       240
     ttatcgaaaa gctaatgaca cattctggat gtcatttacc atcagcttta ttattgtggg       300
     ggcaattttg gatcaaatta tcctgatgtt tttcaacaaa gacttgagga gaaataaggc       360
     tgcattactt ttttggcaca ttcttctttt aggacctatt gtgaggtgtt tgcacaccat       420
     tagaaattac cacaaatggt tgaaaaatct taaacaggag aaggaagaga ctcaagttag       480
     catcacaaag agaaacacga tgctggaaag ggagattgca ttctcaatcc gggataattt       540
     catgcagcag aaggctttca agtacatgtc agtgattcag gcttttctcg gttctgttcc       600
     acaattaatt ttgcagatgt atatcagtct cactatacga gaatggcctt tgaatagagc       660
     attgctgatg acattttccc tgttatcagt tacttatggg gccattcgct gcaatatact       720
     ggccatccag atcagcaatg atgatactac cattaagcta ccgccgatag aattcttctg       780
     tgtcgtgatg tggcgttttt tggaggttat ctcacgtgta gtgactctgg catttttcat       840
     tgcatctctg aaactgaaga gcctacccgt tttgttaatc atatattttg tatcattgtt       900
     ggcaccgtgg ctggagtttt ggaaaagtgg agctcatctt cctggcaaca aagaaaataa       960
     ttccaatatg gtgggtacag tactgatgct tttcttgatc acactgctat atgctgccat      1020
     caacttctcc tgctggtcag cagtgaaact gcagttgtca gatgacaaaa taattgacgg      1080
     gagacagagg tggggccata gaatcctaca ctacagcttt cagtttttag aaaatgtgat      1140
     aatgatattg gtatttaggt tctttggagg gaaaactttg ctgaattgtt gtgactcatt      1200
     aattgccgtg cagctcatca taagctacct attggccact ggctttatgc tcctcttcta      1260
     tcagtatttg tacccatggc agtcaggcaa agtgttgcca ggacgtactg aaaatcagcc      1320
     agaagcaccg tactattatg taaacatcga gaaaactgaa aagaataaaa ataagcagct      1380
     gaggaattac tgtcactcct gcaatagggt tggatatttt tcaatcagaa aaagtatgac      1440
     atgttcataa aatatacata tatactttca cagaacaatg agtaaagatg ctgaatgtga      1500
     cttgttaaga ggctcttaaa tttaaaaaat atacacagca aaatcttgga agtggtttct      1560
     aataaaattc atttatgttc tcctgtgaac gtg                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page