(data stored in ACNUC7820 zone)

EMBL: BC137561

ID   BC137561; SV 1; linear; mRNA; STD; HUM; 1066 BP.
XX
AC   BC137561;
XX
DT   12-FEB-2009 (Rel. 99, Created)
DT   12-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens olfactory receptor, family 6, subfamily B, member 2, mRNA
DE   (cDNA clone MGC:169184 IMAGE:9021561), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1066
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1066
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 679e3c5c2ed3f4a847fd688c387b4d2e.
DR   Ensembl-Gn; ENSG00000182083; homo_sapiens.
DR   Ensembl-Tr; ENST00000402971; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Mike Brownstein, NIMH
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCB Plate: 13 Row: A Column: 21
CC   single stranded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1066
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_362"
FT                   /clone="MGC:169184 IMAGE:9021561"
FT                   /tissue_type="Pooled, cerebellum, kidney, placenta, testis,
FT                   lung, colon, liver, heart, thyroid, bladder, uterus, PCR
FT                   rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CAATTATA"
FT                   /db_xref="taxon:9606"
FT   gene            1..1066
FT                   /gene="OR6B2"
FT                   /gene_synonym="OR2-1"
FT   CDS_pept        61..999
FT                   /codon_start=1
FT                   /gene="OR6B2"
FT                   /gene_synonym="OR2-1"
FT                   /product="OR6B2 protein"
FT                   /db_xref="GOA:Q6IFH4"
FT                   /db_xref="H-InvDB:HIT000501449.4"
FT                   /db_xref="HGNC:HGNC:15041"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6IFH4"
FT                   /protein_id="AAI37562.1"
FT                   /translation="MSGENVTKVSTFILVGLPTAPGLQYLLFLLFLLTYLFVLVENLAI
FT                   ILIVWSSTSLHRPMYYFLSSMSFLEIWYVSDITPKMLEGFLLQQKRISFVGCMTQLYFF
FT                   SSLVCTECVLLASMAYDRYVAICHPLRYHVLVTPGLCLQLVGFSFVSGFTISMIKVCFI
FT                   SSVTFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFPLLATILSYWHIT
FT                   LAVLRIPSATGCWRAFSTCASHLTVVTVFYTALLFMYVRPQAIDSQSSNKLISAVYTVV
FT                   TPIINPLIYCLRNKEFKDALKKALGLGQTSH"
XX
SQ   Sequence 1066 BP; 191 A; 348 C; 235 G; 292 T; 0 other;
     gcagcccttt cctcttgctc tttgatgttt tgtaggcctg cagctcccaa gcacagaggc        60
     atgagtgggg agaatgtcac caaggtcagc accttcatcc tggtgggcct ccccacggcc       120
     ccagggctgc agtacctgct cttcctcctc ttcctgctca cctacctctt tgtcctggtg       180
     gagaacctgg ccatcatcct catcgtctgg agcagcacct ccctccacag gcccatgtac       240
     tactttctga gctccatgtc tttcctggag atctggtacg tgtctgacat cacccccaag       300
     atgctggagg gcttcctcct ccagcagaaa cgcatctctt tcgtcgggtg catgacgcag       360
     ctctacttct tcagctccct ggtgtgcacc gagtgtgtgc ttctggcctc catggcctac       420
     gaccgctacg tggccatctg ccacccgctg cgctaccacg tccttgtgac cccggggctg       480
     tgcctccagc tggtgggctt ctcctttgtg agtggcttca ccatctccat gatcaaggtc       540
     tgttttatct ccagcgtcac gttctgtggc tccaacgtct tgaaccactt cttctgtgac       600
     atttccccca tcctcaagct ggcctgcacg gacttctcca ctgcagagct ggtggatttc       660
     atcctggcct tcatcatcct ggtgtttccg ctcctggcca ccatactgtc atattggcac       720
     atcaccctgg ctgtcctgcg catcccctcg gccaccggct gctggagagc cttctctacc       780
     tgcgcctctc acctcaccgt ggtcaccgtc ttctatacag ccttgctttt catgtatgtc       840
     cggccccaag ccattgattc ccagagctcc aacaagctca tctctgccgt gtacactgtt       900
     gtcacgccaa taattaaccc tttgatttac tgcctgagga acaaggaatt taaggacgcc       960
     ttgaaaaagg ccttgggctt gggtcaaact tcacactaag acaactaaat gtcctagagt      1020
     aaaatctgta gtgatgaaac aacattgtat gtggcacttt gtgctc                     1066
//

If you have problems or comments...

PBIL Back to PBIL home page