(data stored in ACNUC27125 zone)

EMBL: BC138612

ID   BC138612; SV 1; linear; mRNA; STD; MUS; 1745 BP.
XX
AC   BC138612;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus protein phosphatase 3, catalytic subunit, alpha isoform, mRNA
DE   (cDNA clone MGC:170237 IMAGE:8861632), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1745
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1745
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 13a67df103361692692b8b2a7a1e1e30.
DR   Ensembl-Gn; ENSMUSG00000028161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056758; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 667 Row: l Column: 14.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1745
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:170237 IMAGE:8861632"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CCAGCTTG"
FT                   /db_xref="taxon:10090"
FT   gene            1..1745
FT                   /gene="Ppp3ca"
FT                   /note="synonyms: CnA, CN"
FT   CDS_pept        52..1617
FT                   /codon_start=1
FT                   /gene="Ppp3ca"
FT                   /product="protein phosphatase 3, catalytic subunit, alpha
FT                   isoform"
FT                   /db_xref="GOA:B2RRX2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="MGI:MGI:107164"
FT                   /db_xref="UniProtKB/TrEMBL:B2RRX2"
FT                   /protein_id="AAI38613.1"
FT                   /translation="MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDI
FT                   LKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEV
FT                   GGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFK
FT                   QECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPP
FT                   AYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAH
FT                   EAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHP
FT                   YWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNK
FT                   IRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAI
FT                   KGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNS
FT                   SNIQ"
XX
SQ   Sequence 1745 BP; 466 A; 421 C; 438 G; 420 T; 0 other;
     gtcggacggg acgagcagcg cgtcgctgtc cccccctccc ggtggctgga gatgtccgag        60
     cccaaggcga ttgatcccaa gttgtcgacg accgacaggg tggtgaaagc cgttccattt       120
     ccaccaagtc accggctgac agcaaaggaa gtgtttgata atgatgggaa acctcgtgtg       180
     gatatcttaa aagcacatct catgaaggag ggcaggctgg aagaaagtgt tgcattgaga       240
     ataataacag agggtgcttc gattctccga caggaaaaaa acttgctgga tatcgacgca       300
     ccagtcacag tttgtgggga catccatgga caattctttg acttgatgaa gctctttgaa       360
     gtgggaggat ctcctgccaa cactcgctac ctcttcttag gggactatgt tgacagaggg       420
     tacttcagta tcgaatgtgt gctgtatttg tgggccttga aaattcttta ccccaaaaca       480
     ctgtttttac ttcgcggaaa ccatgaatgt aggcacctca cagagtattt cacgtttaaa       540
     caagaatgta aaataaagta ttcagaacgc gtttatgacg cctgtatgga tgccttcgac       600
     tgccttcccc tggctgcgct aatgaaccag cagttcctgt gtgtacacgg tggtttgtct       660
     ccagagatta acactctaga tgacatcaga aaattagacc gattcaaaga accacctgct       720
     tatgggccca tgtgtgacat cctatggtca gaccccctgg aggactttgg aaatgagaag       780
     actcaggaac atttcactca caacacagtc agaggctgtt cgtacttcta cagttaccca       840
     gctgtgtgtg acttcctgca gcacaataat ttgttgtcca tactccgcgc ccacgaagcc       900
     caggatgcag ggtaccgcat gtacaggaaa agccaaacaa caggcttccc gtctctaatt       960
     acaatcttct cggcaccaaa ttacttagat gtgtacaata acaaagctgc agtgttgaag      1020
     tacgagaaca atgtgatgaa catcaggcag ttcaactgct ccccgcatcc gtactggctc      1080
     ccaaatttca tggatgtttt cacctggtcg ctgccatttg ttggggagaa agtgactgag      1140
     atgctggtca atgttctcaa catctgctcc gacgatgaac tggggtcaga agaagatgga      1200
     tttgacggag ccacggccgc agcccggaag gaagtcatca gaaacaagat ccgagcaata      1260
     ggcaaaatgg ccagagtgtt ctcagttctc agagaagaga gtgagagtgt cctgacactg      1320
     aagggcctga ccccaactgg catgctcccc agcggagtgc tctctggcgg gaaacagact      1380
     ctgcaaagcg ctactgttga ggctattgag gctgatgaag ccatcaaagg attttcacca      1440
     caacataaga tcactagctt cgaggaggcc aagggcttag accgaattaa cgagaggatg      1500
     ccacctcgca gagacgccat gccctctgac gccaacctta actccatcaa caaggctctc      1560
     gcctcagaga ctaacggcac ggacagcaat ggcagtaata gcagcaatat ccagtgacca      1620
     cttcctgttc actttttttt tttttttgag ctgcagggca tgatgggatt gctgcatctc      1680
     agcagttgga tgttcttgcc tctgaaggta gcttgtttgc tctgggggcc aggaattgga      1740
     ttcag                                                                  1745
//

If you have problems or comments...

PBIL Back to PBIL home page