(data stored in ACNUC18858 zone)

EMBL: BC139073

ID   BC139073; SV 1; linear; mRNA; STD; MUS; 1646 BP.
XX
AC   BC139073;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus glucosaminyl (N-acetyl) transferase family member 7, mRNA
DE   (cDNA clone MGC:170700 IMAGE:8862095), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1646
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1646
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 33e8b9970157912d79a4e55c21ec21d1.
DR   Ensembl-Gn; ENSMUSG00000074569; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026946; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0026913; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026884; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026922; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026664; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027369; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026122; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026641; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026779; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026745; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026880; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026764; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027426; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025859; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026195; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000099060; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059534; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0059567; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0059511; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059497; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059193; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059967; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059475; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0059166; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0059269; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0059247; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0059379; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059234; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060153; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059050; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058471; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 668 Row: o Column: 21.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1646
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_381"
FT                   /clone="MGC:170700 IMAGE:8862095"
FT                   /tissue_type="Testicle, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: ACTGATGC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1646
FT                   /gene="Gcnt7"
FT                   /note="synonym: RP23-228E2.6"
FT   CDS_pept        128..1429
FT                   /codon_start=1
FT                   /gene="Gcnt7"
FT                   /product="glucosaminyl (N-acetyl) transferase family member
FT                   7"
FT                   /db_xref="GOA:Q3V3K7"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="MGI:MGI:3606143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3V3K7"
FT                   /protein_id="AAI39074.1"
FT                   /translation="MSQLRTTKAGLVACGMICAFIFLYLRNPGPEEAEAEAEAEPTNPA
FT                   VVECGFYPDELCSALFDGKKAAPQIAQFCKPPQNSEVPARLRTPGNCSRLARGLHFITR
FT                   PLSAEEGNFSLAYVIHAPRELVMFVRLLRAIYAPQNVYCIHSDENAPKKFKSAMQTFVD
FT                   CFGNIFLSSKTQKVAHDNLRRLQAEIDCMRDLVHSPFQWHYVMNLCGQEFPIKTNKEII
FT                   YDIRTRWKGKNITPGVTPPANSKPKTGQGPPKPSPDENSYTAPNTIFKQSPPHNLTISS
FT                   GSAHYALTRKFVEFVLTDPRAKDMLQWSKDIQSPEKHYWVTLNRLKDAPGATPDAGWEG
FT                   HIRATKWRTEAGDGRKGCTDHDAQDTCVYGLGDLPGLIRLPAFFATLEPSSDPLVGVCL
FT                   ERRHRLRALQQAEVPPEPHWQFPQQSHFNSQPHH"
XX
SQ   Sequence 1646 BP; 443 A; 461 C; 413 G; 329 T; 0 other;
     ccgtcagagg agaggtggct aggccagcac ctgcccaggt tcctgccagg aacgggacct        60
     gcacctggag aactaaaagg aaaacctttc aagctatggt ggcgacaaca cactgagagc       120
     tcaaagcatg agccagctcc ggaccacaaa ggctgggctg gtggcatgtg gcatgatttg       180
     cgccttcatc tttctttact tgagaaaccc aggtcctgag gaggctgagg ctgaggctga       240
     ggctgagccc accaacccag ctgtggtgga atgtggcttc tatccagatg aactgtgctc       300
     ggctttattt gacgggaaaa aggcagcccc ccaaatcgct caattctgca aacctcctca       360
     gaactctgaa gttcctgctc gcttgcgcac acctggaaac tgctccaggc tggctcgggg       420
     gctgcacttc ataaccagac ccctgtctgc agaagagggg aacttctcct tggcctatgt       480
     tatacatgct ccgagggagc tggtcatgtt tgtgcggctt ctcagagcga tttatgcacc       540
     tcagaatgtc tactgtatcc acagtgatga aaatgcccca aagaagttta agagtgccat       600
     gcaaaccttc gtggactgtt ttggaaacat ctttctttca tcaaagacac agaaggtggc       660
     tcatgacaac ctcaggaggc tgcaggcaga gattgactgc atgagggacc tggtccactc       720
     cccatttcaa tggcactatg tcatgaatct ctgtggacag gaattcccta tcaaaaccaa       780
     caaagaaatc atctatgaca tcagaaccag gtggaagggt aaaaacatca cgcctggggt       840
     gaccccaccc gcaaactcca aacccaagac aggccaaggc cctccaaagc ccagtcccga       900
     tgaaaacagc tacacagctc caaatacaat tttcaaacaa agcccacccc acaatctaac       960
     aatttcctct ggaagtgctc actatgcact tacgaggaag tttgtagagt tcgtcctaac      1020
     tgatccccgt gcaaaagaca tgctgcagtg gtccaaagac atccaaagcc cggagaagca      1080
     ctactgggtg accctgaacc gactgaaaga cgctccaggt gccacaccag atgctggatg      1140
     ggaaggacac attcgggcca cgaagtggag aacagaggca ggagatggtc gcaaggggtg      1200
     cacagaccac gatgcccaag acacttgtgt gtatggcctg ggagacctgc ctgggctcat      1260
     ccggctgcca gctttctttg ccacgctgga gccctcctca gacccgctgg tgggagtatg      1320
     cctagagagg cggcaccgac tcagagccct acagcaggcc gaggtccctc cagagccaca      1380
     ctggcagttt ccccagcaaa gccacttcaa cagtcaacct caccattaag gcacttgtca      1440
     gcattgcttt ttaaattctt ggatgtgaat gatttaaaaa atgatgcaga gacatgtgcc      1500
     accagacttc accactacac aggcagggag agaactatga ggaaaacacc cgaggctgtg      1560
     gctaggagcc caagccaaca gctggaggcc cagcgcatta tcagctgccg aatctctcca      1620
     cctgctcaat ccagctcacg tgggac                                           1646
//

If you have problems or comments...

PBIL Back to PBIL home page