(data stored in ACNUC7820 zone)

EMBL: BC139246

ID   BC139246; SV 1; linear; mRNA; STD; MUS; 1050 BP.
XX
AC   BC139246;
XX
DT   12-FEB-2009 (Rel. 99, Created)
DT   12-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Mus musculus olfactory receptor 525, mRNA (cDNA clone MGC:170873
DE   IMAGE:8862268), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1050
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1050
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (29-MAR-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 2e5efe47d5f47269044ecd1961fe7f55.
DR   Ensembl-Gn; ENSMUSG00000061489; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033173; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033155; mus_musculus_aj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033156; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032870; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033667; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032200; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032843; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032995; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032948; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033089; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032980; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033687; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031906; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032311; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000078103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214594; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087398; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087484; mus_musculus_aj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087439; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087002; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0087943; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087529; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0086946; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087140; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0086986; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087171; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087022; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088241; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0086932; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086040; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 669 Row: g Column: 2
CC   single stranded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1050
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:170873 IMAGE:8862268"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CTGCTCCC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1050
FT                   /gene="Olfr525"
FT                   /gene_synonym="MOR251-2"
FT   CDS_pept        100..1029
FT                   /codon_start=1
FT                   /gene="Olfr525"
FT                   /gene_synonym="MOR251-2"
FT                   /product="olfactory receptor 525"
FT                   /db_xref="GOA:Q8VGL5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030359"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGL5"
FT                   /protein_id="AAI39247.1"
FT                   /translation="MEINNYTTVVEFVLQGLSEDPGLQALFLAFFLLLYILALAGNTLI
FT                   IIAISLNSSLHTPMYFFLANLALLDIVCTSTVLPKLLEGLVGKSSHISYKGCMTQLFFL
FT                   TWFLGAELLLLTAMAYDRYVAICRPLHYSMLMSWPICVLLAGSVWVISAASTSVHTGLM
FT                   ARLNFCGPNQIRHFLCEVPTLLLLSCSPTTLNNIMIVIADVYFGVVNFLLTMISYSFII
FT                   TSILRIRSTEGKKRAFSTCSAHLVVVVLYYSTVIYTYLQPGSGSSLENGKVVALLYTAV
FT                   SPTLNPAIYSLRNKDVKVALKKLFPCFQ"
XX
SQ   Sequence 1050 BP; 223 A; 311 C; 223 G; 293 T; 0 other;
     cggctgtctg aacccagtgt gaaatgatgg ctgcctcaca cctggtgtct ccttgaccat        60
     cccatctgtg tcacagtaac tcccaggact cactctcaaa tggaaataaa caattacaca       120
     actgtggtgg agtttgtcct gcagggactc tctgaggacc ctgggctcca ggctctcttc       180
     ttggcctttt tcttgcttct ttacatcctg gctcttgcag gaaacaccct catcatcata       240
     gccatcagcc tcaactcaag ccttcacacc cccatgtact tcttccttgc aaacctggcc       300
     ctgttggaca tcgtctgtac atccactgtt cttcccaagc tgctggaggg tttggtgggt       360
     aagagcagcc acatttctta taagggatgc atgacccaac tctttttcct gacctggttt       420
     ctaggggctg agctgctgct gctcactgcc atggcctatg accgctatgt ggccatctgt       480
     cgcccactgc actacagcat gctgatgagc tggcccatct gtgtcctgct cgccggcagt       540
     gtgtgggtca tcagtgcagc cagcacatct gtgcacactg gcttgatggc acgactcaat       600
     ttctgtggcc ccaaccaaat tcgtcacttt ttatgtgaag tcccaacact gctgcttctg       660
     tcttgcagcc caaccaccct caacaacatc atgattgtca ttgcagatgt ttattttggt       720
     gtggtcaact ttctgttgac tatgatatcc tatagcttca tcatcaccag catcctgcgc       780
     atccgctcca cagagggcaa gaagcgagcc ttctctacct gctctgccca cctggtggtg       840
     gttgtcctgt actactccac cgtcatctac acctatttgc agcctggctc cggatcctcc       900
     ttggagaatg gcaaagtagt tgctttattg tacacagcag tcagccctac cctgaacccc       960
     gccatttatt ctctaaggaa caaggatgtc aaagttgccc tcaaaaagtt atttccctgt      1020
     ttccaatgag gaggcagaag gcaacaaatg                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page