(data stored in ACNUC4482 zone)

EMBL: BC140831

ID   BC140831; SV 1; linear; mRNA; STD; HUM; 3380 BP.
XX
AC   BC140831;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens integrin, alpha 10, mRNA (cDNA clone MGC:176508
DE   IMAGE:9021699), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3380
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3380
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-MAY-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 5b5f5903eb74458420b95f79eef77f65.
DR   Ensembl-Gn; ENSG00000143127; homo_sapiens.
DR   Ensembl-Tr; ENST00000369304; homo_sapiens.
DR   Ensembl-Tr; ENST00000539363; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Mike Brownstein, NIMH
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 673 Row: n Column: 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3380
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_311"
FT                   /clone="MGC:176508 IMAGE:9021699"
FT                   /tissue_type="Brain, cerebellum, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: AGTTGTTA"
FT                   /db_xref="taxon:9606"
FT   gene            1..3380
FT                   /gene="ITGA10"
FT                   /note="synonym: PRO827"
FT   CDS_pept        51..3125
FT                   /codon_start=1
FT                   /gene="ITGA10"
FT                   /product="ITGA10 protein"
FT                   /db_xref="GOA:O75578"
FT                   /db_xref="H-InvDB:HIT000501577.4"
FT                   /db_xref="HGNC:HGNC:6135"
FT                   /db_xref="InterPro:IPR000413"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR013649"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="InterPro:IPR032695"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:O75578"
FT                   /protein_id="AAI40832.1"
FT                   /translation="MELPFVTHLFLPLVFLTGCPTYMDVVIVLDGSNSIYPWSEVQTFL
FT                   RRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAAKNLSRREGRETKTAQ
FT                   AIMVACTEGFSQSHGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRYGIAVLG
FT                   HYLRRQRDPSSFLREIRTIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGSHAENE
FT                   SSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEGGHRLFPPRMALEDEFPPAL
FT                   QNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSLQGEQIG
FT                   SYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQGTLQPE
FT                   PPQDARFGFAMGALPDLNQDGFADVAVGAPLEDGHQGALYLYHGTQSGVRPHPAQRIAA
FT                   ASMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIVHLTPSLEVTPQAIS
FT                   VVQRDCRRRGQEAVCLTAALCFQVTSRTPGRWDHQFYMRFTASLDEWTAGARAAFDGSG
FT                   QRLSPRRLRLSVGNVTCEQLHFHVLDTSDYLRPVALTVTFALDNTTKPGPVLNEGSPTS
FT                   IQKLVPFSKDCGPDNECVTDLVLQVNMDIRGSRKAPFVVRGGRRKVLVSTTLENRKENA
FT                   YNTSLSLIFSRNLHLASLTPQRESPIKVECAAPSAHARLCSVGHPVFQTGAKVTFLLEF
FT                   EFSCSSLLSQVFVKLTASSDSLERNGTLQDNTAQTSAYIQYEPHLLFSSESTLHRYEVH
FT                   PYGTLPVGPGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFLSLSQVITNNASC
FT                   IVQNLTEPPGPPVHPEELQHTNRLNGSNTQCQVVRCHLGQLAKGTEVSVGLLRLVHNEF
FT                   FRRAKFKSLTVVSTFELGTEEGSVLQLTEASRWSESLLEVVQTRPILISLWILIGSVLG
FT                   GLLLLALLVFCLWKLGFFAHKKIPEEEKREEKLEQ"
XX
SQ   Sequence 3380 BP; 756 A; 897 C; 939 G; 788 T; 0 other;
     gagggacaga ggccagagga cttctcatac tggacagaaa ccgatcaggc atggaactcc        60
     ccttcgtcac tcacctgttc ttgcccctgg tgttcctgac aggctgccca acatacatgg       120
     atgttgtcat tgtcttggat ggctccaaca gcatctaccc ctggtctgaa gttcagacct       180
     tcctacgaag actggtaggg aaactgttta ttgacccaga acagatacag gtgggactgg       240
     tacagtatgg ggagagccct gtacatgagt ggtccctggg agatttccga acgaaggaag       300
     aagtggtgag agcagcaaag aacctcagtc ggcgggaggg acgagaaaca aagactgccc       360
     aagcaataat ggtggcctgc acagaagggt tcagtcagtc ccatgggggc cgacccgagg       420
     ctgccaggct actggtggtt gtcactgatg gagagtccca tgatggagag gagcttcctg       480
     cagcactaaa ggcctgtgag gctggaagag tgacacgcta tgggattgca gtccttggtc       540
     actacctccg gcggcagcga gatcccagct ctttcctgag agaaattaga actattgcca       600
     gtgatccaga tgagcgattc ttcttcaatg tcacagatga ggctgctctg actgacattg       660
     tggatgcact aggagatcgg atttttggcc ttgaagggtc ccatgcagaa aacgaaagct       720
     cctttgggct ggaaatgtct cagattggtt tctccactca tcggctaaag gatgggattc       780
     tttttgggat ggtgggggcc tatgactggg gaggctctgt gctatggctt gaaggaggcc       840
     accgcctttt ccccccacga atggcactgg aagacgagtt cccccctgca ttgcagaacc       900
     atgcagccta cctgggttac tctgtttctt ccatgctttt gcggggtgga cgccgcctgt       960
     ttctctctgg ggctcctcga tttagacatc gaggaaaagt catcgccttc cagcttaaga      1020
     aagatggggc tgtgagggtt gcccagagcc tccaggggga gcagattggt tcatactttg      1080
     gcagtgagct ctgcccattg gatacagata gggatggaac aactgatgtc ttacttgtgg      1140
     ctgcccccat gttcctggga ccccagaaca aggaaacagg acgtgtttat gtgtatctgg      1200
     taggccagca gtccttgctg accctccaag gaacacttca gccagaaccc ccccaggatg      1260
     ctcggtttgg ctttgccatg ggagctcttc ctgatctgaa ccaagatggt tttgctgatg      1320
     tggctgtggg ggcgcctctg gaagatgggc accagggagc actgtacctg taccatggaa      1380
     cccagagtgg agtcaggccc catcctgccc agaggattgc tgctgcctcc atgccacatg      1440
     ccctcagcta ctttggccga agtgtggatg gtcggctaga tctggatgga gatgatctgg      1500
     tcgatgtggc tgtgggtgcc cagggggcag ccatcctgct cagctcccgg cccattgtcc      1560
     atctgacccc atcactggag gtgaccccac aggccatcag tgtggttcag agggactgta      1620
     ggcggcgagg ccaagaggca gtctgtctga ctgcagccct ttgcttccaa gtgacctccc      1680
     gtactcctgg tcgctgggat caccaattct acatgaggtt caccgcatca ctggatgaat      1740
     ggactgctgg ggcacgtgca gcatttgatg gctctggcca gaggttgtcc cctcggaggc      1800
     tccggctcag tgtggggaat gtcacttgtg agcagctaca cttccatgtg ctggatacat      1860
     cagattacct ccggccagtg gccttgactg tgacctttgc cttggacaat actacaaagc      1920
     cagggcctgt gctgaatgag ggctcaccca cctctataca aaagctggtc cccttctcaa      1980
     aggattgtgg ccctgacaat gaatgtgtca cagacctggt gcttcaagtg aatatggaca      2040
     tcagaggctc caggaaggcc ccatttgtgg ttcgaggtgg ccggcggaaa gtgctggtat      2100
     ctacaactct ggagaacaga aaggaaaatg cttacaatac gagcctgagt ctcatcttct      2160
     ctagaaacct ccacctggcc agtctcactc ctcagagaga gagcccaata aaggtggaat      2220
     gtgccgcccc ttctgctcat gcccggctct gcagtgtggg gcatcctgtc ttccagactg      2280
     gagccaaggt gacctttctg ctagagtttg agtttagctg ctcctctctc ctgagccagg      2340
     tcttcgtgaa gctgactgcc agcagtgaca gcctggagag aaatgggacc cttcaagata      2400
     acacagccca gacctcagcc tacatccaat atgagcccca cctcctgttc tctagtgagt      2460
     ctaccctgca ccgctatgag gttcacccat atgggaccct cccagtgggt cctggcccag      2520
     aattcaaaac cactctcagg gttcagaacc taggctgcta tgtggtcagt ggcctcatca      2580
     tctcagccct ccttccagct gtggcccatg ggggcaatta cttcctatca ctgtctcaag      2640
     tcatcactaa caatgcaagc tgcatagtgc agaacctgac tgaaccccca ggcccacctg      2700
     tgcatccaga ggagcttcaa cacacaaaca gactgaatgg gagcaatact cagtgtcagg      2760
     tggtgaggtg ccaccttggg cagctggcaa aggggactga ggtctctgtt ggactattga      2820
     ggctggttca caatgaattt ttccgaagag ccaagttcaa gtccctgacg gtggtcagca      2880
     cctttgagct gggaaccgaa gagggcagtg tcctacagct gactgaagcc tcccgttgga      2940
     gtgagagcct cttggaggtg gttcagaccc ggcctatcct catctccctg tggatcctca      3000
     taggcagtgt cctgggaggg ttgctcctgc ttgctctcct tgtcttctgc ctgtggaagc      3060
     ttggcttctt tgcccataag aaaatccctg aggaagaaaa aagagaagag aagttggagc      3120
     aatgaatgta gaataagggt ctagaaagtc ctccctggca gcttcttcaa gagacttgca      3180
     taaaagcaga ggtttggggg ctcagatggg acaagaagcc gcctctggac tatctcccca      3240
     gaccagcagc ctgacttgac ttttgagtcc tagggatgct gctggctaga gatgaggctt      3300
     tacctcagac aagaagagct ggcaccaaaa ctagccatgc tcccaccctc tgcttccctc      3360
     ctcctcgtga tcctggttcc                                                  3380
//

If you have problems or comments...

PBIL Back to PBIL home page