(data stored in ACNUC31183 zone)

EMBL: BC140871

ID   BC140871; SV 1; linear; mRNA; STD; HUM; 4714 BP.
XX
AC   BC140871;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Homo sapiens GTPase activating Rap/RanGAP domain-like 4, mRNA (cDNA clone
DE   MGC:176548 IMAGE:9021739), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4714
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-4714
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-MAY-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 4a87fd85451d44b3c92824faddf54686.
DR   Ensembl-Gn; ENSG00000132359; homo_sapiens.
DR   Ensembl-Tr; ENST00000254695; homo_sapiens.
DR   Ensembl-Tr; ENST00000366401; homo_sapiens.
DR   Ensembl-Tr; ENST00000540393; homo_sapiens.
DR   Ensembl-Tr; ENST00000542807; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Mike Brownstein, NIMH
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 673 Row: o Column: 17.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4714
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_363"
FT                   /clone="MGC:176548 IMAGE:9021739"
FT                   /tissue_type="Pooled, cerebellum, kidney, placenta, testis,
FT                   lung, colon, liver, heart, thyroid, bladder, uterus, PCR
FT                   rescued clones"
FT                   /note="Vector: pCR-XL-TOPO; Clone identification sequence
FT                   tag: CTCATCGC"
FT                   /db_xref="taxon:9606"
FT   gene            1..4714
FT                   /gene="GARNL4"
FT                   /note="synonyms: RAP1GA3, Rap1GAP2"
FT   CDS_pept        47..2239
FT                   /codon_start=1
FT                   /gene="GARNL4"
FT                   /product="GARNL4 protein"
FT                   /db_xref="GOA:Q684P5"
FT                   /db_xref="H-InvDB:HIT000501612.4"
FT                   /db_xref="HGNC:HGNC:29176"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q684P5"
FT                   /protein_id="AAI40872.1"
FT                   /translation="MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLS
FT                   PPLTAPPTMKSSEFFEMLEKMQGIKLEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQV
FT                   ILPQFGGYWIEDPENVGTPTSLGSSICEEEEEDNLSPNTFGYKLECKGEARAYRRHFLG
FT                   KDHLNFYCTGSSLGNLILSVKCEEAEGIEYLRVILRSKLKTVHERIPLAGLSKLPSVPQ
FT                   IAKAFCDDAVGLRFNPVLYPKASQMIVSYDEHEVNNTFKFGVIYQKARQTLEEELFGNN
FT                   EESPAFKEFLDLLGDTITLQDFKGFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKLP
FT                   FTDGDAQQLQRKRHIGNDIVAIIFQEENTPFVPDMIASNFLHAYIVVQVETPGTETPSY
FT                   KVSVTAREDVPTFGPPLPSPPVFQKGPEFREFLLTKLTNAENACCKSDKFAKLEDRTRA
FT                   ALLDNLHDELHAHTQAMLGLGPEEDKFENGGHGGFLESFKRAIRVRSHSMETMVGGQKK
FT                   SHSGGIPGSLSGGISHNSMEVTKTTFSPPVVAATVKNQSRSPIKRRSGLFPRLHTGSEG
FT                   QGDSRARCDSTSSTPKTPDGGHSSQEIKSETSSNPSSPEICPNKEKPFMKLKENGRAIS
FT                   RSSSSTSSVSSTAGEGEAMEEGDSGGSQPSTTSPFKQEVFVYSPSPSSESPSLGAAATP
FT                   IIMSRSPTDAKSRNSPRSNLKFRFDKLSHASSGAGH"
XX
SQ   Sequence 4714 BP; 1026 A; 1363 C; 1309 G; 1016 T; 0 other;
     acgtcgttgg gacatcgctg ggaccccggg ctctgcagcc acaaccatgt ttggccggaa        60
     gcgcagtgtc tcctttgggg gcttcggatg gatcgacaag accatgctgg caagtctgaa       120
     ggtcaagaag caggagctgg ccaacagctc ggatgcgacc ctcccagacc ggccgctctc       180
     ccctcctctc acggcacctc ccaccatgaa gtcgtcggag ttctttgaga tgctggagaa       240
     aatgcagggg atcaagcttg aagagcagaa gccgggaccc cagaagaaca aggacgacta       300
     tatcccatac cccagcatcg acgaggttgt ggagaaggga ggcccgtacc ctcaggtcat       360
     cctgccacag tttgggggct attggatcga ggacccggag aacgtgggca ccccaacatc       420
     gctggggagc agcatctgtg aggaggagga agaggacaac ctcagcccca acacatttgg       480
     ctacaagctc gagtgcaagg gtgaagccag ggcctaccgg aggcacttcc tggggaagga       540
     tcatctaaac ttttactgta ccggcagcag cctggggaac ttgatcctgt ccgtcaagtg       600
     cgaggaagca gaggggatcg agtacctccg ggtcatcctc aggtccaaac tgaagacggt       660
     acatgagcgg atccccttgg ctggactgag caagcttccc agtgtccctc agattgcaaa       720
     ggctttctgt gatgatgcag tgggactgag attcaatcct gtcctgtacc ccaaggcctc       780
     ccaaatgatt gtgtcctatg atgagcatga agtcaacaac acattcaaat tcggagtcat       840
     ttatcaaaaa gccaggcaga ccctggagga ggagctattt gggaacaatg aggagagccc       900
     agcttttaag gagttcttgg acctgctggg ggacacgatc acactgcagg atttcaaagg       960
     tttccgagga ggcctggacg tgacccacgg acagacaggg gtggaatcag tgtacacaac      1020
     attccgggac agggagatca tgtttcacgt ttccacaaag ctgccattta ccgacggaga      1080
     cgcccagcag ctccagagaa agagacacat tggaaatgac atcgtggcca tcatcttcca      1140
     agaggaaaac acgccgtttg tcccagacat gatagcctcc aatttcttac atgcctacat      1200
     cgtcgtgcag gtcgagaccc caggcacaga gaccccatcc tacaaggtct ctgtcactgc      1260
     gcgggaagat gtgcccacct ttggtccacc tctgcccagt ccccccgttt tccagaaggg      1320
     cccggaattc agggagtttc tgctcaccaa gctcaccaat gccgagaacg cctgctgcaa      1380
     gtcggacaag tttgcaaagc tggaggaccg gaccagggct gccctcctgg acaaccttca      1440
     cgatgagctc cacgcccaca cacaggccat gctgggactg ggcccagagg aggacaagtt      1500
     tgagaatgga ggccacgggg ggttcctgga gtcttttaag agggccatcc gcgtacgcag      1560
     ccactccatg gagaccatgg tgggcggcca gaagaagtcg cacagtgggg gcatccctgg      1620
     cagcctcagc gggggcatct cccacaacag catggaggtc accaagacca ccttctcgcc      1680
     tccagtggtg gcggcaacgg tgaagaacca gtcacggagt cccatcaagc gacgctcggg      1740
     gctcttcccc cgcctgcaca cgggctcaga aggccagggc gacagccggg cacgatgtga      1800
     cagcacatcc agcacaccca agaccccaga tggtggacac tcctctcagg agataaagtc      1860
     tgagacctca tccaatccca gctctccgga aatctgcccc aacaaggaga agcccttcat      1920
     gaagttgaag gaaaacggcc gtgccatctc ccgctcctcc tccagcacca gcagcgtcag      1980
     cagcactgca ggggagggcg aggccatgga ggagggcgac agtgggggca gccagccgtc      2040
     cacgacctca cccttcaagc aggaggtgtt tgtctacagc ccgtccccga gcagcgagag      2100
     ccccagcctg ggggcagctg ccaccccgat catcatgagc cggagtccca cagatgccaa      2160
     aagcagaaac tccccgagat cgaacctgaa attccgcttt gacaagctca gccatgccag      2220
     ctctggtgcg ggtcactaat gtgaaagtgg agtccttcgc ctgtccaagg gaatcccctc      2280
     ttctgtcctg gaaaaggctc ctgtaccagc agtttgggag tgccgtccac gaccctgaca      2340
     gtcccagccc tgccgcccca tggccacgtg cccacagatg tgctgttggt ccaggtgtcc      2400
     cagtctggcc acagccctgc ctccgccctc acctacatgc cctcccagcc cctcccatct      2460
     ctggacgagg cctccttcct caggttcctc ctgctcctga cctcccagtg tgatgtccgg      2520
     gtcctttatc atcctattca tcctggagag gaaaagtgtc gggcaaaggg ggatctgggg      2580
     ggagctcagc agtgactggg gagctggtct gcctcagaga cagagtaggg ggtgggagca      2640
     gagcctcggt gagggtcttg gccacagggc agtgccttcc tgaacgtggc aggctttact      2700
     accaggaacg cactcggtgg tggaggcccc atgttcccag gagccaagat tcgtagcatc      2760
     cttgaggcca tcctgataaa attcggcgct attgcccccg tagctctgga gctctaaacc      2820
     gtctatctgc ttctgtgctg aacgcctttc ccatctgctg acgtaggccc agggctgccc      2880
     tgcccctgct gccagtgtac tgtgagcggg gctccagcca gttcaagctc agagccagag      2940
     ctggacgggc cagaactgcg ctgcacactt cctggactga ggcggggact ttgggtccca      3000
     cccggtttct cctgattatg gctgctgtgg ggtgagggga gggaggggca gccccgaggc      3060
     agtctcttcc ctttgagaag atattctccc ccttccgagt ctgcagcgcc gtgggcttct      3120
     ctgccgatgg gcccgggttg gggttaaggt gggcatcctc caggtacaac gagcctgaag      3180
     agcccctttc agtgcagacg gggctgcaga gtgacactgg ctgggcacct gccccacgac      3240
     caatgacaag gatttccagc tgaatgcttt attcccatag ggatctggac ctgtgcccaa      3300
     gatataaata ctacactttt tttttttttt tttaactgac attgtgaaat tctccctata      3360
     gcttttgcca ttcaagcaac attgtgatct ttcttccccg ccacgtgtgt gggaatgatt      3420
     gagtcctgtt tgcaagctgg agaggagctc tccctttgct agtactttct ctaaagtact      3480
     agtctagtaa aatttattct tgttagaagg tcaacaaaat atctgtttag cttttatgaa      3540
     gagtcaccgt agcagccccc acggctggaa agaggcctgt acgttctgga cgcgttttgt      3600
     tggctgggct tctggaggca ctggcaaggt caaactgcat ttctttaaga acagttgcag      3660
     gatctggctc gcctctgtgg gaagccggca ttacaggtgc ttggtggatg ggccgtgtca      3720
     cattgccatc tggggtcctt tggggtttcc aggttgtcac catgctgtcc catttgggaa      3780
     tcccatacct gcctgtcccc actgcgctgg ctgacccttg ctgcctgctg cctcttggga      3840
     gggctttgtc cctgcctctg agctggtggg caggatggct gggtggcccc cagagaagca      3900
     cagacctgag atggggtctc catgcccggt ttgctgttgg aatgatctga acaggacccc      3960
     aaatgcctct tccctctggt catgcctcac tatctctagg agctccatcc tgtggcttcc      4020
     agagtgtgca cttccagccc acccgggcag tgctgagagg gaggaggaga acaaggatgg      4080
     cccagcctcc cctccctccc ctagaccacg gggcaggcag ctcgggttcc tggagggctg      4140
     tttcccccac gctgtcccta catctgctct gatctaaaat gtctttcctt ttatgctgcg      4200
     cccagtcttg gggctcaaag atttgcccaa acctcattgg ccctcgtgac taggctcatc      4260
     tagatggtgc tcacgctggt gtttgaggca tttccactgt gatctccacg aggggatgtt      4320
     ttccgggaca catctctggc tctgggaact gcctgactca ctgaagaaac tacttttcag      4380
     gcactgtagg gtcacccata tgcctccagc tcagttgacg cttaaaaaca ggtgcagaaa      4440
     agctcgcgat ggaaggtctt aatgagagtg tctgtctatg ccaatcatgt aaaatgacgt      4500
     ttcttgaaaa agattcagtg gttcagcttt gtcagcatca tctcaacaca agcctgctgg      4560
     ctctttttag catctcatcc aaccatgtca tcgtccagat gagaaatctt agcccaggtg      4620
     aggggaataa cttgcttgag gtcacacagc tggctgttgg caaagctggg attagaaccc      4680
     tcaacccagg gtcccttcct ctgcagcgcc taca                                  4714
//

If you have problems or comments...

PBIL Back to PBIL home page