(data stored in ACNUC15260 zone)

EMBL: BC140910

ID   BC140910; SV 1; linear; mRNA; STD; HUM; 1061 BP.
XX
AC   BC140910;
XX
DT   12-FEB-2009 (Rel. 99, Created)
DT   12-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens olfactory receptor, family 1, subfamily L, member 8, mRNA
DE   (cDNA clone MGC:176587 IMAGE:9056722), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1061
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1061
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-MAY-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ccb9bd0414133b262084aec169c98b92.
DR   Ensembl-Gn; ENSG00000171496; homo_sapiens.
DR   Ensembl-Tr; ENST00000304865; homo_sapiens.
DR   Ensembl-Tr; ENST00000641027; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Mike Brownstein, NIMH
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 684 Row: a Column: 8
CC   single stranded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1061
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_362"
FT                   /clone="MGC:176587 IMAGE:9056722"
FT                   /tissue_type="Pooled, cerebellum, kidney, placenta, testis,
FT                   lung, colon, liver, heart, thyroid, bladder, uterus, PCR
FT                   rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CCCCCCCA"
FT                   /db_xref="taxon:9606"
FT   gene            1..1061
FT                   /gene="OR1L8"
FT                   /gene_synonym="OR9-24"
FT   CDS_pept        83..1012
FT                   /codon_start=1
FT                   /gene="OR1L8"
FT                   /gene_synonym="OR9-24"
FT                   /product="olfactory receptor, family 1, subfamily L, member
FT                   8"
FT                   /db_xref="GOA:Q8NGR8"
FT                   /db_xref="H-InvDB:HIT000501648.4"
FT                   /db_xref="HGNC:HGNC:15110"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NGR8"
FT                   /protein_id="AAI40911.1"
FT                   /translation="MERINHTSSVSEFILLGLSSRPEDQKTLFVLFLIVYLVTITGNLL
FT                   IILAIRFNPHLQTPMYFFLSFLSLTDICFTTSVVPKMLMNFLSEKKTISYAGCLTQMYF
FT                   LYALGNSDSCLLAVMAFDRYVAVCDPFHYVTTMSHHHCVLLVAFSCSFPHLHSLLHTLL
FT                   LNRLTFCDSNVIHHFLCDLSPVLKLSCSSIFVNEIVQMTEAPIVLVTPFLCIAFSYIRI
FT                   LTTVLKIPSTSGKRKAFSTCGFYLTVVTLFYGSIFCVYLQPPSTYAVKDHVATIVYTVL
FT                   SSMLNPFIYSLRNKDLKQGLRKLMSKRS"
XX
SQ   Sequence 1061 BP; 242 A; 304 C; 194 G; 321 T; 0 other;
     ttgctaggtt ctcatgattg gtgttatgaa atcagagcat gttaaatgac aaaacttctt        60
     gtttataact gagcccaagt caatggaaag aatcaaccac accagcagtg tctccgagtt       120
     tatcctcctg ggactctcct cccggcctga ggaccaaaag acactctttg ttctcttcct       180
     catcgtgtac ctggtcacca taacagggaa cctgctcatc atcctggcca ttcgcttcaa       240
     cccccatctt cagaccccta tgtatttctt cttgagtttt ctgtctctca ctgatatttg       300
     ctttacaaca agcgttgtcc ccaagatgct gatgaacttc ctgtcagaaa agaagaccat       360
     ctcctatgct gggtgtctga cacagatgta ttttctctat gccttgggca acagtgacag       420
     ctgccttctg gcagtcatgg cctttgaccg ctatgtggcc gtctgtgacc ctttccacta       480
     tgtcaccacc atgagccacc accactgtgt cctgctggtg gccttctcct gctcatttcc       540
     tcacctccac tcactcctgc acacacttct gctgaatcgt ctcaccttct gtgactccaa       600
     tgttatccac cactttctct gtgacctcag ccctgtgctg aaattgtcct gctcgtccat       660
     atttgtcaat gaaattgtgc agatgacaga agcacctatt gttttggtga ctccttttct       720
     ctgcattgct ttctcttata tacgaatcct cactacagtt ctcaagattc cctctacttc       780
     tgggaaacgc aaagccttct ccacctgtgg tttttacctc accgtggtga cgctctttta       840
     tggaagcatc ttctgtgtct atttacagcc cccatccacc tacgctgtca aggaccacgt       900
     ggcaacaatt gtttacacag ttttgtcatc catgctcaat ccttttatct acagcctgag       960
     aaacaaagac ctgaaacagg gcctgaggaa gcttatgagc aagagatcct aggaagcacc      1020
     ctcttgaaaa actcgtaagt ggaatctgct caacttggac g                          1061
//

If you have problems or comments...

PBIL Back to PBIL home page