(data stored in ACNUC15260 zone)

EMBL: BC140981

ID   BC140981; SV 1; linear; mRNA; STD; MUS; 1040 BP.
XX
AC   BC140981;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus olfactory receptor 837, mRNA (cDNA clone MGC:175942
DE   IMAGE:9055593), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1040
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1040
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-MAY-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 0359da38582792fcd77fa913fd78a752.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 681 Row: b Column: 7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1040
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:175942 IMAGE:9055593"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: TACTTGCT"
FT                   /db_xref="taxon:10090"
FT   gene            1..1040
FT                   /gene="Olfr837"
FT                   /note="synonym: MOR152-2"
FT   CDS_pept        68..1006
FT                   /codon_start=1
FT                   /gene="Olfr837"
FT                   /product="olfactory receptor 837"
FT                   /db_xref="GOA:B2RU59"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030671"
FT                   /db_xref="UniProtKB/TrEMBL:B2RU59"
FT                   /protein_id="AAI40982.1"
FT                   /translation="MEVKNKSVVLDIFLHGLTDDIELQPFIFGFFLCMYLITIFGNLLI
FT                   MLAIIFDSHLHKPMYFFLCHLAFNDMYLISITVPKMLVNVQTQDQRITLAGCLSQGCFV
FT                   AVCFIFECFLLGIMAYDRYTAICFPLRYTVLINPFFCVIVVLISLFISIVNGLLHSLMV
FT                   LHLSFCTDLEILHFFCEIAQILKLACSDSLINNILIFVTSSIFAGVPLCGIIFSYVHIV
FT                   STVLKMPSSEGKYKAFSTCGSHLSVVSLFYGTGFGVYITSVVIDSPKEIAIASVMYSIV
FT                   PPMLNPFVYSLKNRDMKEALKKVIGRTVSLP"
XX
SQ   Sequence 1040 BP; 256 A; 210 C; 186 G; 388 T; 0 other;
     cagtgaaact cttcattccc gtatttcaat aacttcttgc tccctttcct taagatttat        60
     acataatatg gaagttaaaa acaagtcggt tgttttggat attttccttc atggactcac       120
     agatgacata gagctgcagc ccttcatctt tggcttcttt ttatgcatgt atttgatcac       180
     catctttgga aatcttctta taatgttagc catcattttt gactcccacc tccacaaacc       240
     catgtacttc tttctctgcc atctggcttt taatgacatg tatttaatca gcattacagt       300
     cccaaagatg ttggtgaatg tacaaacaca ggatcagagg atcactttag ctggctgtct       360
     gagccaggga tgctttgtgg ctgtatgttt catctttgaa tgttttctcc ttggaataat       420
     ggcctatgac cgctacacag ccatttgttt tcctctaaga tacacagtcc tcatcaatcc       480
     cttcttctgt gttattgtgg ttctaatctc tctatttatt agtattgtaa atggtctgct       540
     gcatagtctg atggtgctgc acttgtcctt ctgcacagac ctggaaatcc tccacttctt       600
     ctgtgaaatt gcacaaatcc tcaagcttgc ctgttctgac agcctaatca acaacatctt       660
     gatatttgtt acatcttcta tttttgctgg tgttcctcta tgtggaataa tcttttctta       720
     tgttcacatt gtttctacag tattgaaaat gccatcatca gaaggaaagt ataaagcctt       780
     ctctacttgt gggtctcatt tatcagttgt ttcattgttt tatgggacag gttttggtgt       840
     atacattacc tcagtagtaa ttgattcacc gaaggaaatt gctattgctt cagtgatgta       900
     ttccatagtt cctccaatgt tgaatccctt tgtttatagt ttgaagaaca gggatatgaa       960
     agaagcactg aagaaggtaa ttggtagaac agtttctctt ccatgatgta tgattaatct      1020
     gtggcttggg tttttgagtg                                                  1040
//

If you have problems or comments...

PBIL Back to PBIL home page