(data stored in ACNUC27125 zone)

EMBL: BC141079

ID   BC141079; SV 1; linear; mRNA; STD; MUS; 1642 BP.
XX
AC   BC141079;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus protein phosphatase 3, catalytic subunit, gamma isoform, mRNA
DE   (cDNA clone MGC:176040 IMAGE:9055691), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1642
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1642
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-MAY-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ce226c31bd828cef8be415fccb149918.
DR   Ensembl-Gn; ENSMUSG00000022092; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021534; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021493; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021469; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021499; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021276; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021938; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020793; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021243; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021366; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021345; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021437; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021374; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021962; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020537; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020846; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000078434; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0040026; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0039993; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0039947; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0039992; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0039733; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0040468; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0039740; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0039649; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0039794; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0039761; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0039872; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0039755; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0040505; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0039348; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0039124; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 681 Row: f Column: 9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1642
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_377"
FT                   /clone="MGC:176040 IMAGE:9055691"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: ATTCCCAT"
FT                   /db_xref="taxon:10090"
FT   gene            1..1642
FT                   /gene="Ppp3cc"
FT   CDS_pept        64..1605
FT                   /codon_start=1
FT                   /gene="Ppp3cc"
FT                   /product="protein phosphatase 3, catalytic subunit, gamma
FT                   isoform"
FT                   /db_xref="GOA:P48455"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="MGI:MGI:107162"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48455"
FT                   /protein_id="AAI41080.1"
FT                   /translation="MSVRRPQFSTTERVIKAVPFPPTRRLTLKEVFENGKPKMDLLKNH
FT                   LVKEGRVEEEVALKIINDGAAILKQEKTMIEVEAPITVCGDVHGQFFDLMKLFEVGGSP
FT                   SNTRYLFLGDYVDRGYFSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECR
FT                   IKYSEMVYDACMHTFDCLPLAALLNQQFLCVHGGMSPEITCLEDIRKLDRFSEPPAFGP
FT                   VCDLLWSDPLEDYGSEKTLEHYTHNTVRGCSYFFSYPAVCEFLQNNSLLSIIRAHEAQD
FT                   AGYRMYRKNQATGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLP
FT                   NFMDVFTWSLPFVGEKVTEMLVNILNICSDEEMNVTDEEGATTGRKEVIKNKIRAIGKM
FT                   ARVFTVLREESENVLTLKGLTPTGTLPLGVLSGGKQTIETAKQEAAEEREAIRGFTIAH
FT                   RIRSFEEARGLDRINERMPPRKEASYHHDAGRMHSHSHPPHPQASRRTDHGKKAL"
XX
SQ   Sequence 1642 BP; 453 A; 382 C; 415 G; 392 T; 0 other;
     cagcccgcct aggaggaagg cggcggcttg cgtccagcgg gccgccggag ccgggaggag        60
     accatgtccg tgaggcgccc tcagttctcc acgaccgagc gcgtcatcaa agctgtcccc       120
     tttcctccaa cccgacggct aactttgaag gaagtttttg agaatgggaa acctaaaatg       180
     gatcttttga aaaaccattt agtaaaagaa ggtcgggtgg aagaggaggt ggccttaaag       240
     atcatcaatg atggggctgc catcctgaag caggagaaga ccatgataga ggtggaggct       300
     ccgatcacag tgtgtggtga tgttcatgga caattctttg acctgatgaa gttgtttgaa       360
     gttgggggat cacctagtaa tactcgctac ctcttcctgg gtgactatgt ggacagaggc       420
     tatttcagta tagagtgtgt gctgtatcta tggagcttaa agattaacca tcctaaaaca       480
     ttgtttctgc ttcgaggaaa tcatgaatgc aggcatctta cagagtactt caccttcaaa       540
     caggaatgtc ggatcaagta ttcagagatg gtgtacgatg cgtgcatgca cactttcgac       600
     tgtcttcctc ttgctgccct cttaaaccag cagtttctct gtgtacatgg aggaatgtct       660
     cctgaaatta cttgtttaga ggacattagg aaattagata ggttttctga gcctcctgct       720
     tttgggccag tgtgtgacct gctgtggtct gatcccttag aggactacgg cagcgagaag       780
     accctggagc actataccca caacactgtc cgaggctgct cctacttctt cagttaccct       840
     gcagtttgtg aatttttaca gaacaacagt ttattatcaa taatcagagc ccatgaagcc       900
     caggatgcgg ggtaccgaat gtataggaag aaccaagcaa ctggctttcc gtcacttatt       960
     acgattttct ctgcccctaa ttacctagat gtctataaca ataaagctgc agtgttgaag      1020
     tatgaaaaca atgtcatgaa catcaggcag ttcaactgtt ccccacaccc ctactggctc      1080
     ccaaacttca tggatgtttt cacgtggtct ttgccttttg ttggagagaa agtgacagag      1140
     atgctggtca atattctcaa catatgctcg gatgaagaaa tgaacgtaac cgatgaagaa      1200
     ggagctacta caggtcgaaa agaagtcatc aagaataaaa tccgagccat tgggaaaatg      1260
     gcccgggtct ttacggttct tcgggaagag agtgagaatg tgctgaccct caagggcctc      1320
     actcccacag gcacactccc actgggggtc ctctctggag gaaagcagac cattgagact      1380
     gccaaacaag aagccgcaga ggagcgggaa gccatcagag gttttacaat tgcacacagg      1440
     atccgaagtt ttgaagaagc ccgaggtcta gaccgaatta atgagagaat gccaccccga      1500
     aaagaggctt catatcatca tgatgcaggg aggatgcact cacactcgca tccgccacac      1560
     ccacaggcgt caagaaggac cgaccatgga aagaaagccc tgtaatgact cagggccctg      1620
     tgcagcacag atgggtccca ac                                               1642
//

If you have problems or comments...

PBIL Back to PBIL home page