(data stored in ACNUC7820 zone)

EMBL: BC141327

ID   BC141327; SV 1; linear; mRNA; STD; MUS; 1033 BP.
XX
AC   BC141327;
XX
DT   12-FEB-2009 (Rel. 99, Created)
DT   12-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Mus musculus olfactory receptor 107, mRNA (cDNA clone MGC:176288
DE   IMAGE:9055939), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1033
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1033
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-MAY-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 1b280d0bb59fd8a2589dc5da66f9e42d.
DR   Ensembl-Gn; ENSMUSG00000063188; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023711; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023669; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023640; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023675; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023437; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024113; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022923; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023414; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023540; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023513; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023618; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023536; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024159; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022670; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022987; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000077008; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215947; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215974; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216844; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0047690; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0047670; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0047631; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0047636; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0047368; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048119; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0047431; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0047302; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0047402; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0047370; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0047505; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0047378; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048215; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047013; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0046689; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 681 Row: p Column: 17
CC   single stranded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1033
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:176288 IMAGE:9055939"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: TGTCAACC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1033
FT                   /gene="Olfr107"
FT                   /gene_synonym="MOR156-3"
FT   CDS_pept        74..1003
FT                   /codon_start=1
FT                   /gene="Olfr107"
FT                   /gene_synonym="MOR156-3"
FT                   /product="olfactory receptor 107"
FT                   /db_xref="GOA:Q7TRK4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2177490"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRK4"
FT                   /protein_id="AAI41328.1"
FT                   /translation="MNCSKTPGFILLGLSSDPEKWQPLFNIFLCLYLLGLLGNLLLLLA
FT                   IGTDVHLHTPMYFFLSQLSLVDLCFITTTAPKMLEALWTGDGSISFSGCLTQFYFFAVF
FT                   ADMDNLLLAVMAIDRYAAICHPLFYPFLMTPCRCEVLASGSWGIAHCVSLFYTLLLSQF
FT                   YYHTNQGIPHFFCDSRPLLLLSCSDTHLSEGLMMALSGVLGMSSVLCLVSSYGCIFYAV
FT                   ARVPSAQGKRKALATCSSHLSVVLLFYSTVFATYLKPPSTSHSSAEVVAAVMYTLVTPT
FT                   LNPFIYSLRNKDVKSSLRKILNMDKFQG"
XX
SQ   Sequence 1033 BP; 225 A; 259 C; 206 G; 343 T; 0 other;
     ttggtgccaa ttcttgcctg cagtgaaaga attgtcttca tatcaatttc ttcttgaaaa        60
     aaaaagaccc ataatgaact gtagtaagac tcctggcttt atcctgttgg gactttccag       120
     tgacccagag aaatggcagc ccctctttaa tattttcctc tgtctctact tgctgggcct       180
     tttagggaac ctgctacttc tgttagctat tggcactgat gtccacctcc acacccccat       240
     gtatttcttc ctcagtcagc tctcactagt ggatctttgc ttcatcacca caacagcccc       300
     taaaatgctg gaggctctgt ggactggaga tggatcaatc tcattctctg gatgcctgac       360
     tcagttttac ttctttgctg tttttgctga catggataac ctgcttctgg cagtcatggc       420
     tattgaccgc tatgctgcta tctgccaccc cctgttctac ccatttctaa tgactccttg       480
     tagatgcgaa gttcttgcca gtgggtcatg gggaatagct cattgtgtgt ctctgttcta       540
     taccttatta ctctctcagt tttattatca taccaatcaa gggatacctc attttttctg       600
     tgattctagg cctctcttac tgctttcttg ctcagacact cacctcagtg agggcctgat       660
     gatggctttg tctggagttt tgggaatgag ctcagttctc tgtcttgtaa gttcttatgg       720
     ttgtattttt tatgctgtgg ctagggttcc atcagcacag gggaaaagga aagccctggc       780
     cacatgcagt tcccacctct ctgtagtcct cctattctat agcacagtct ttgctaccta       840
     cctgaagccc ccatctactt ctcactcctc tgcagaggtg gtagctgctg ttatgtatac       900
     cttggttact cccactctga accccttcat ttatagtctt agaaataagg atgttaagag       960
     ttcattgaga aagatcctga acatggacaa gtttcagggc taaggatcgt cattcaggaa      1020
     ggatcacccc aca                                                         1033
//

If you have problems or comments...

PBIL Back to PBIL home page