(data stored in ACNUC8465 zone)

EMBL: BC142195

ID   BC142195; SV 1; linear; mRNA; STD; MAM; 3848 BP.
XX
AC   BC142195;
XX
DT   10-JUN-2007 (Rel. 92, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Bos taurus mitogen-activated protein kinase kinase 4, mRNA (cDNA clone
DE   MGC:140244 IMAGE:8176182), complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-3848
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (07-JUN-2007) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; 94685d222b90a80ea662aa8f1d899129.
DR   Ensembl-Gn; ENSBTAG00000012103; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000044085; bos_taurus.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: Y. Meng, M. Taniguchi, S. Lobo, L. Guan and S.
CC   Moore
CC   cDNA Library Preparation: M. Masaaki, Y. Meng, S. Lobo,  L. Guan
CC   and Dr. S. Moore
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Tanaguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Chun E, Liao N, Beland J, Cruz K, Featherstone R, Kirk H,
CC   Matsuo C, Mayo M, Moore R, Munro S, Roger J, Tam B, Trinh E, Sze W,
CC   Wilton J, Wanger S, Huang P, Chu B, Imanian B, Roscoe R, Holt R,
CC   Jones S, Marra M
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 265 Row: h Column: 4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3848
FT                   /organism="Bos taurus"
FT                   /lab_host="DH10B"
FT                   /strain="Hereford"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-12"
FT                   /clone="MGC:140244 IMAGE:8176182"
FT                   /tissue_type="Heart ventrical, 8.5 month female Hereford"
FT                   /note="Vector: pCMV-SPORT6.0"
FT                   /db_xref="taxon:9913"
FT   gene            1..3848
FT                   /gene="MAP2K4"
FT   CDS_pept        62..1300
FT                   /codon_start=1
FT                   /gene="MAP2K4"
FT                   /product="MAP2K4 protein"
FT                   /db_xref="GOA:A5PJP8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A5PJP8"
FT                   /protein_id="AAI42196.1"
FT                   /translation="MAAPSPSGGGGGGGGSGGGSGTPGPAGSPAPGHPAVSSMQGFQIN
FT                   FCEKAQSKRKALKLNFANPPFKSTARFTLNPNPAGVQNPHIERLRTHSIESSGKLKISP
FT                   EQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLD
FT                   VVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKIT
FT                   LATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRP
FT                   YMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQ
FT                   LSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILD
FT                   QMPATPSSPMYVD"
XX
SQ   Sequence 3848 BP; 979 A; 982 C; 947 G; 940 T; 0 other;
     gagaggccga gcttgctgca ttgcagccgc cgcggcgccg ctcggctcct cactcccaac        60
     aatggcggct ccgagcccca gcggcggcgg cggcggcggc ggcggctccg ggggcggcag       120
     cggcaccccg ggccccgcgg ggtccccggc gcccggccac ccggccgtca gcagcatgca       180
     gggctttcag ataaacttct gtgaaaaggc acaaagtaaa cgcaaagcac tgaagttgaa       240
     ttttgcaaat ccacctttca aatctacagc aaggtttact ctgaatccca atcctgcagg       300
     agttcaaaac ccacacatag agagactgag aacacacagc attgagtcgt caggaaaact       360
     gaagatctcc cctgagcagc actgggattt cactgcagag gatttgaaag accttggaga       420
     gattggacga ggagcttacg gttctgtcaa caaaatggtc cacaaaccca gtgggcaaat       480
     aatggcagtt aaaagaatcc ggtcgacagt ggatgaaaaa gagcagaagc agctcctcat       540
     ggatttggat gtagtgatgc ggagcagtga ctgcccatac attgttcagt tctatggcgc       600
     gctcttccga gagggtgact gttggatctg catggaactc atgtctacct cgtttgataa       660
     gttttacaaa tatgtatata gtgtattaga tgatgttatt ccagaagaaa ttttaggcaa       720
     aatcacttta gcaactgtga aagcactaaa ccacttaaaa gaaaacttga aaatcattca       780
     cagagatatc aaaccttcca atattcttct ggatagaagt ggaaatatta aactctgtga       840
     ctttggcatc agtggacagc tcgtggactc gatcgctaag acaagagatg ctggctgcag       900
     gccctacatg gcacctgaaa gaatagaccc aagtgcgtca cgccaaggct acgacgtccg       960
     ctctgatgtc tggagtctgg ggatcacatt gtacgaattg gccactggcc gctttcctta      1020
     tccaaagtgg aatagtgtat ttgatcaact aacacaagtc gtgaaagggg atccgccaca      1080
     gctgagtaac tctgaggaaa gggagttctc cccaagtttc atcaactttg tcaacttgtg      1140
     ccttacgaag gatgaatcca aaaggccaaa gtataaagaa ctcctgaaac acccctttat      1200
     tttgatgtac gaggagcgcg ccgtcgaggt cgcatgctac gtgtgtaaaa tcctggatca      1260
     aatgccagcc accccgagct cccccatgta tgtcgattga tgtcgctgct acgtcagact      1320
     ctagacaaag ggctgagagg aagcaagacg tacagaacct tcacccctac cacagtgttt      1380
     ttattgctcg ccagacacca tgcacaccac gactggtgtt tgtttccatc ccgtctgtat      1440
     actcccgcca ccccgaacgc gcatccccgt gcgacccgag cacccgcgca gcgtcagtgc      1500
     cggtcagaga cctcgcctgc tctcccgtga acgtggatgt cagtacgatc agcttgctga      1560
     ctgtgataag accacattgt aaactcattt ctagacttga agcctggaga cgcagctgct      1620
     ggaagggtgt ttcatcaggc ttccgaatgc tggatggatg cggtggtggc cacgctgtgt      1680
     ctgaatgcag gctctgggct ggagcgcgag gcaggcatgg ccggcgagac accttgcctt      1740
     ccggagctgg gagacggagg aggggtagac tttcttcacc aagtgcaata ggttgactga      1800
     ttggaccttc tgttgtttga cagtcactgt ccacgcttgg ggatccatgt gctcagccaa      1860
     attccctgtt tgaaatatca cgttaaatta gagcacgttt atctttacca aaaaccatgc      1920
     tgcgttcaga gaggagaacg tgaaaatgcc gagacgggac agaacgtgtt cttttctccc      1980
     ccgcccaccc ccagtcctct gccctccatc ggggagactc aggagtctgc cacgcgtcag      2040
     agaaggtgct gattctcaga attcggtgtg ctgccaattg gatgttccac ctgccacaaa      2100
     ccacccgggc tgagaaggga agaatacgga gggcaaagtt tacagatgtt tttaatccta      2160
     gaatcctgtc tggaacaact cgtagcagct atgtatttcc cctggtccca agcctgatgc      2220
     tccggccacc ataactcact gacggggaga agtagctggt agcagtgtgc cttgactgat      2280
     cagataaaga tgtcttttag gcagcgaaag accagatctc agctgtgtga catgcctggt      2340
     ccaggtctgc agcttctgcg tctctttccc cacctgtgtg gtctgttgcc cctacgtgac      2400
     tcttgcttga tccagtatct cacctttttc cctataacag aaacctttat gattaccagg      2460
     aatgttcctt accaagaatt tgtatagccc ccagtgtatc ccatgatctc aagtttaaaa      2520
     ggctgagaag gtggggccca gctgatgtgg caggtgatgg aagaacatct cttctagaga      2580
     taacacttga ccagaggagg atttctttta catgagttcc tcacctacaa gactctagca      2640
     ggtcaccaca tttcttacga ttggaattct acaaaaaaca accctaaaac caaaaaaccc      2700
     ccaaagagcc ccagaatagt tctagggggc cgttgaaatt tgcatcttct gctgtccttc      2760
     ctcccttccc cacgagccgg gtctccatgg tctccctccg gcccccctgc cgccctgcgt      2820
     aggtgtgatg gtcaagtctg tccagcagcg ccgtgagcag ctcacgccca ctggagcgta      2880
     aagcggccga ggtctgagac gcggcagatg ccgtgacgga accaaacagc ggtgggtgtc      2940
     gctgtgtctc ctcccaggtg acagtcacgg acacttctca acaacaaagg gaggatggtg      3000
     ctgtttacag ttacatcctg tcaatttctg aattcaccag tggtttctcg ctttggtcca      3060
     ctcgcctgat cttcctgttt tctctgccgt ggcatcgaaa ccccagattt cccagcctcg      3120
     gaggggaagc cctgcagcgc ctgcccctga ccatgccaag ccatcgcccc ccatccccac      3180
     ggctcccggg gactcaggag gactccggat ctccgtggtc acccttctgt ctggctccgc      3240
     gtggggtcac tttgccatat gcagatggag aggaacacag tgctgaccgt ccaggagctg      3300
     atctgactgt tctctcatgt ggatgaccac ataaaaaagg caattttagt gtattaatca      3360
     tagattatta taaactataa actcaagggc aaggagttta ttacagtgta tctttatgaa      3420
     aacaaaaggg tgtgcagtgt tcacacactg taacaatagt gtaagaactg tacattgtga      3480
     gctctggtta tttctctcct gtaccacaga agcatattgt ataaaaactg tcggaaagct      3540
     gatgtgaagg gctattgcct tatttgtctg taaaaagtgc agctcagtca catgactgct      3600
     tcctggagct tgggaatagt ttatcctgta ttcttgtttg aattctccct ctatttaaga      3660
     tgtatccatg gaatcgaagt gtcgatgtaa tagttctctc ctcttgcctg caggtcagtt      3720
     gtaataaatc taggatgtga tgatgacttt gtaattcgat tttctgaagt cagaccctga      3780
     gaggggaaaa tcaagtaaat tccattaaat tatctgtgca tttcgcattg ggaaaaaaaa      3840
     aaaaaaaa                                                               3848
//

If you have problems or comments...

PBIL Back to PBIL home page