(data stored in ACNUC15465 zone)

EMBL: BC144193

ID   BC144193; SV 1; linear; mRNA; STD; HUM; 435 BP.
XX
AC   BC144193;
XX
DT   04-JAN-2009 (Rel. 98, Created)
DT   19-MAR-2009 (Rel. 100, Last updated, Version 3)
XX
DE   Homo sapiens G antigen 7, mRNA (cDNA clone MGC:177730 IMAGE:9052713),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-435
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-435
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-JUN-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b50700ed4d4ab299a7364806c3ce0216.
DR   Ensembl-Gn; ENSG00000215269; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236362; homo_sapiens.
DR   Ensembl-Tr; ENST00000440137; homo_sapiens.
DR   Ensembl-Tr; ENST00000445148; homo_sapiens.
DR   Ensembl-Tr; ENST00000639028; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Mike Brownstein, NIMH
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCB Plate: 17 Row: B Column: 5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..435
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_362"
FT                   /clone="MGC:177730 IMAGE:9052713"
FT                   /tissue_type="Pooled, cerebellum, kidney, placenta, testis,
FT                   lung, colon, liver, heart, thyroid, bladder, uterus, PCR
FT                   rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CTTTGCCG"
FT                   /db_xref="taxon:9606"
FT   gene            1..435
FT                   /gene="GAGE7"
FT                   /gene_synonym="GAGE-7"
FT   CDS_pept        49..402
FT                   /codon_start=1
FT                   /gene="GAGE7"
FT                   /gene_synonym="GAGE-7"
FT                   /product="G antigen 7"
FT                   /db_xref="GOA:O76087"
FT                   /db_xref="H-InvDB:HIT000502622_02.4"
FT                   /db_xref="HGNC:HGNC:4104"
FT                   /db_xref="InterPro:IPR008625"
FT                   /db_xref="InterPro:IPR031320"
FT                   /db_xref="UniProtKB/Swiss-Prot:O76087"
FT                   /protein_id="AAI44194.1"
FT                   /translation="MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGE
FT                   PATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEE
FT                   VKTPEEGEKQSQC"
XX
SQ   Sequence 435 BP; 123 A; 97 C; 133 G; 82 T; 0 other;
     ctgccgtccg gactcttttt cctctactga gattcatctg tgtgaaatat gagttggcga        60
     ggaagatcga cctattattg gcctagacca aggcgctatg tacagcctcc tgaaatgatt       120
     gggcctatgc ggcccgagca gttcagtgat gaagtggaac cagcaacacc tgaagaaggg       180
     gaaccagcaa ctcaacgtca ggatcctgca gctgctcagg agggagagga tgagggagca       240
     tctgcaggtc aagggccgaa gcctgaagct catagccagg aacagggtca cccacagact       300
     gggtgtgagt gtgaagatgg tcctgatggg caggagatgg acccgccaaa tccagaggag       360
     gtgaaaacgc ctgaagaagg tgaaaagcaa tcacagtgtt aaaagaaggc acgttgaaat       420
     gatgcaggct gctcc                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page