(data stored in ACNUC21562 zone)

EMBL: BC145571

ID   BC145571; SV 1; linear; mRNA; STD; MUS; 1016 BP.
XX
AC   BC145571;
XX
DT   04-JAN-2009 (Rel. 98, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 2)
XX
DE   Mus musculus cDNA clone MGC:179145 IMAGE:9054137, complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1016
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1016
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-JUN-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d9c8f47db0b929b4f1f80a8a6086968d.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 21 Row: I Column: 3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1016
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_389"
FT                   /clone="MGC:179145 IMAGE:9054137"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: GCTTGTTA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        11..952
FT                   /codon_start=1
FT                   /product="Unknown (protein for MGC:179145)"
FT                   /db_xref="GOA:B7ZP12"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026233"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:3033100"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZP12"
FT                   /protein_id="AAI45572.1"
FT                   /translation="MTPTTTNPMDKTIPGSIDIETLIPNLMIIIFGLVGLTGNAILFWL
FT                   LGFRLHRNAFLVYILNLALADFLFLLCHIINSTMLLLKVHLPNSILNHCFDIIMMVLYI
FT                   TGLSMLSAISTERCLSVLCPIWYRCRRPEHTSTVLCAVIWVLPLLICILNGYFCRFFGP
FT                   KYVIDSVCLATNFFIRTYPMFLFIVLCLSTLALLARLFCGAGKTKFTRLFVTIMLTVLV
FT                   FFLCGLPLGFFWFLVPWINRDSSVLDYILFQTSIVLTSVNSCANPIIYFFVGSFRHRLK
FT                   HKTLKMVLQSALQDTPETPENMVEMSRSKAEP"
XX
SQ   Sequence 1016 BP; 221 A; 275 C; 215 G; 305 T; 0 other;
     agcctcgaca atgacaccca caacaacaaa tccaatggac aaaaccatcc ctggaagtat        60
     tgacatcgag accctgatcc caaacttgat gatcatcatc tttggactgg tcgggctgac       120
     aggaaatgcc attttgttct ggctcctggg cttccgcttg cacaggaatg ccttcttagt       180
     ctacatccta aacttggccc tggctgactt cctcttcctt ctctgtcaca tcataaattc       240
     cacaatgctt cttctcaagg ttcacctacc caacagtatt ttgaaccatt gctttgacat       300
     catcatgatg gttctctaca tcacaggcct gagcatgctc agtgccatca gcactgagcg       360
     ctgcctgtct gtcctgtgcc ccatctggta tcggtgccgc cgcccagaac acacatcaac       420
     tgtcctgtgt gctgtgatct gggtcctgcc cctgttgatc tgcattctga atggatattt       480
     ctgtcgtttc tttggtccca aatatgtaat tgactctgtg tgtctggcaa caaacttctt       540
     tatcagaaca tacccgatgt ttttgtttat agtcctctgt ctgtccaccc tggctctgct       600
     ggccaggttg ttctgtggtg ctgggaagac gaaatttacc agattattcg tgaccatcat       660
     gctgaccgtt ttggtttttt ttctctgtgg gttgcccctg ggcttcttct ggtttctggt       720
     gccctggatt aaccgtgatt ccagtgtact agattatata ctttttcaga catcaattgt       780
     cctaacttct gttaacagct gtgccaaccc catcatttac ttcttcgtgg gctccttcag       840
     gcatcggttg aagcacaaga ccctcaaaat ggttctccag agtgcactgc aggacactcc       900
     cgagacacct gaaaacatgg tggagatgtc aagaagcaaa gcagagccgt gatgaagagc       960
     ctctacctgg acctcagagg tggctttgga ttgagcactg ccctgctgca cttgac          1016
//

If you have problems or comments...

PBIL Back to PBIL home page