(data stored in ACNUC4305 zone)

EMBL: BC146052

ID   BC146052; SV 1; linear; mRNA; STD; MAM; 2423 BP.
XX
AC   BC146052;
XX
DT   17-JUN-2007 (Rel. 92, Created)
DT   24-JUL-2007 (Rel. 92, Last updated, Version 2)
XX
DE   Bos taurus hypothetical LOC510352, mRNA (cDNA clone MGC:152639
DE   IMAGE:8436926), complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-2423
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (12-JUN-2007) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; 61db484a83309d04393acd044b1e9fed.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: Y. Meng, M. Taniguchi, S. Lobo, L. Guan and S.
CC   Moore
CC   cDNA Library Preparation: M. Masaaki, Y. Meng, S. Lobo,  L. Guan
CC   and Dr. S. Moore
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Tanaguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Chun E, Liao N, Beland J, Cruz K, Featherstone R, Kirk H,
CC   Matsuo C, Mayo M, Moore R, Munro S, Roger J, Tam B, Trinh E, Sze W,
CC   Wilton J, Wanger S, Huang P, Chu B, Imanian B, Roscoe R, Holt R,
CC   Jones S, Marra M
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2423
FT                   /organism="Bos taurus"
FT                   /lab_host="DH10B"
FT                   /strain="Hereford"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-13"
FT                   /clone="MGC:152639 IMAGE:8436926"
FT                   /tissue_type="Thymus, female, 8.5 months, Hereford"
FT                   /note="Vector: pCMV-SPORT6.0"
FT                   /db_xref="taxon:9913"
FT   gene            1..2423
FT                   /gene="MGC152639"
FT   CDS_pept        111..1661
FT                   /codon_start=1
FT                   /gene="MGC152639"
FT                   /product="MGC152639 protein"
FT                   /db_xref="InterPro:IPR029357"
FT                   /db_xref="UniProtKB/TrEMBL:A6H6Z2"
FT                   /protein_id="AAI46053.1"
FT                   /translation="MDASRRVTATSVLPTFDASCLFKGHLSTKSNALCTDSSSLRLSTL
FT                   QLVKNHMAVHYNKILSAKAAVDCSVPLSMSASIKYADQQRREKLKKELARCGRGLKFTK
FT                   TTVHPKSHSRSLLNALQKPSGEPQDENSLLIEEVNEFPSFTQSPVISSERLSLPKSQNV
FT                   LTNCTEKNSSCSMSSMDYTASGSKKPSSGTSYGRGPRGTFPGSQKFQLVISKAPSGDLL
FT                   DKHSEHFSNRHLPFTPRTLKTEAKSFLSQYRYYTPAKRKKNFTNRRIEAETQTELSSFK
FT                   SDFETVEIKNATDSEMNVTQASGCVSYGTKGRTTPSASPGRELPWGKVRDSALQCSSPR
FT                   AVCQYSLQPPSGRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKH
FT                   HLEEEKMRQLLHVLKVDLGCMSKENSGKLDSVDTLHLCDVEKAENLEQNENKSEQDLII
FT                   QQERQEYQKALNMLLTIPKEENEIVSSNEFFLPIHKSKYSEEVIIQQYLKRQGLSSNQ"
XX
SQ   Sequence 2423 BP; 782 A; 545 C; 507 G; 589 T; 0 other;
     gctccggctg cctctcgccg aacctctgcc gcggggagcc ggcccggccc ctggaagggc        60
     cgaaggggac gccgcaagtc cccgcggtgt ggccgcagga gagcccgagc atggacgcca       120
     gccggagagt cacagcaacc tctgtccttc ccacatttga tgcatcatgc ctatttaaag       180
     gacacttgag caccaaaagt aatgctttgt gcactgactc ctcctctctc agactaagta       240
     ccctccaact ggtcaagaat cacatggctg ttcactataa taaaatcctt tcagccaaag       300
     ctgcagtaga ctgctcagtt ccactaagca tgagtgccag catcaaatat gcagaccaac       360
     agcgaagaga gaaactcaaa aaggaattag caaggtgtgg gagggggctg aaatttacta       420
     agactacagt gcatcctaaa agtcattcca ggtcattact taacgctcta caaaagcctt       480
     caggagaacc acaggatgaa aacagtttat taatcgaaga agtgaatgaa tttccatctt       540
     ttacacagtc accagtaatt tcttctgaga gactaagtct acctaagtct cagaacgtcc       600
     tcacgaattg tactgagaag aactccagct gctccatgtc cagcatggat tacactgcct       660
     ctgggtccaa gaaaccatcc tctggaacct cctacggcag agggcccagg ggcacattcc       720
     ccggttccca gaagtttcag ttagttattt caaaagcacc cagtggggac cttttggaca       780
     aacattctga acacttttct aacagacatt tgccattcac cccacgcact ttaaaaacag       840
     aagccaaatc tttcctgtca cagtatcgat attatacacc tgccaaaaga aaaaagaatt       900
     ttacaaatcg gcggatagaa gctgaaactc agactgaatt aagcagcttt aaatctgatt       960
     ttgagacagt tgagatcaag aacgccacag attcagaaat gaacgtaacg caggcatctg      1020
     gttgtgtgtc atatggtacc aaaggaagaa caaccccttc agcttcacca gggcgtgagt      1080
     taccgtgggg caaggttaga gacagtgccc tccagtgctc ctcgccaagg gcagtatgtc      1140
     aatattcact gcagcctcct tcagggagaa aaatatattc tgatgaagaa gaactgttgt      1200
     atctgagttt cattgaagat gtaacagatg aaattttgaa actaggttta ttttcaaaca      1260
     ggtttctgga acgactgttt gagagacata taaaacaaaa taaacatcat ttggaggagg      1320
     aaaaaatgcg ccagctgcta catgtcttaa aggtggactt aggctgcatg tccaaggaaa      1380
     actcaggaaa gctagacagc gtggatacat tgcatttatg tgatgttgaa aaggctgaga      1440
     atttagaaca aaatgaaaat aaaagtgaac aagatttaat cattcaacag gaacgtcagg      1500
     aataccaaaa agctttgaat atgttattga ctataccaaa ggaagagaat gagatagtct      1560
     cttcaaatga atttttcctc cccatccata aatcaaagta ttcagaagag gttatcattc      1620
     aacagtatct aaagcgtcaa ggcctttcta gtaatcagtg agcttggatg gcctattgac      1680
     tgaaacgcca tcccttcttg tgcagatgaa cattctacca ggcccagtct gatccttaac      1740
     tgaactcaga tatgtctcgg aagactcatc tctcctgagg tcttttcaac cactcacagt      1800
     aatggaaata tgtgagtaac ttagataacg gtttcatgcc tgggcaccat ggaggataaa      1860
     aagatgaatc agaatgtggg tgataaccca aacgttctag aaattcagca attccctcca      1920
     agtatctcat tctgtaattc aggcttttag cattcttttg cccacacaag cgtttcccaa      1980
     aaggtggtgc gtatcactgg aggtattaga actggtttct ggtggtaggt ggatgacagt      2040
     ctcaagtacg ggaaactgtt cagaacccag gctcggggac accctgcagt acggtcgggc      2100
     tgggtgccca gtgtcaggcc ccagatcatc ctgcacattc tttccttggc cctgccaacc      2160
     cccggctctc accgtggagt tgtcatctta cccccaacag caaaagatgc aaagtacaca      2220
     ttaggcaact gtggaaaatc taaactgcca agatctgtca aaagtccaaa atagggattt      2280
     acttggcttt cggacttcta aatatactgt tttatccaag aaattagcca ttttctaaat      2340
     tgtgtagaga ataaatttca atattacaag tcaaaaaaaa aaaaaaaaaa aaaaaaaaaa      2400
     aaaaaaaaaa aaaaaaaaaa aaa                                              2423
//

If you have problems or comments...

PBIL Back to PBIL home page