(data stored in ACNUC18858 zone)

EMBL: BC146070

ID   BC146070; SV 1; linear; mRNA; STD; MAM; 2205 BP.
XX
AC   BC146070;
XX
DT   14-JUL-2007 (Rel. 92, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Bos taurus glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I
DE   blood group), mRNA (cDNA clone MGC:159883 IMAGE:8283023), complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-2205
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (12-JUN-2007) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; d2647306652399b69a845148a3956935.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: Lee Alexander, USDA, ARS, NPA
CC   cDNA Library Preparation: Express Genomics
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Tanaguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Chun E, Liao N, Beland J, Cruz K, Featherstone R, Kirk H,
CC   Matsuo C, Mayo M, Moore R, Munro S, Roger J, Tam B, Trinh E, Sze W,
CC   Wilton J, Wanger S, Huang P, Chu B, Imanian B, Roscoe R, Holt R,
CC   Jones S, Marra M
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 302 Row: c Column: 14.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2205
FT                   /organism="Bos taurus"
FT                   /lab_host="DH10B"
FT                   /strain="L1 Hereford"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-28"
FT                   /clone="MGC:159883 IMAGE:8283023"
FT                   /tissue_type="Cerebral cortex , female calf 8.5 months, L1
FT                   Hereford"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:9913"
FT   gene            1..2205
FT                   /gene="GCNT2"
FT   CDS_pept        662..1627
FT                   /codon_start=1
FT                   /gene="GCNT2"
FT                   /product="GCNT2 protein"
FT                   /db_xref="GOA:A6QL46"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/TrEMBL:A6QL46"
FT                   /protein_id="AAI46071.1"
FT                   /translation="MPSPMRSLFIISVSCVIVFIVFCVFNFGGEQGFQRLNNSDTWVLT
FT                   QVCTSLIKDKTPLLWRNKLMMYEKSSCEAYLTQSHYITAPLSKEEAEFRLAYIMVIHHN
FT                   FDTFARLFRAIYMPQNVYCVHVDEKATVEFKDSVEQLLSCFPNAFLASKMEPVVYGGIS
FT                   RLQADLNCMKDLAASEVPWKYALNTCGQDFPLKTNREIVQYLKGFKGKNITPGVLPPAH
FT                   AVGRTKYVHREHLGKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFTNFVLHDPRA
FT                   LDLLQWSKDTFSPDEHFWVTLNRIPGMWDSLLHVKATFCT"
XX
SQ   Sequence 2205 BP; 557 A; 535 C; 548 G; 565 T; 0 other;
     caccctgacg cggcatattt gagaatggag gctaccgggt acacccagga ttgtgctggg        60
     agggtcgagg gaccctcccg gtcacgggaa acaagctggg gtgagtgtcg cagcctgtgg       120
     ggtgactagc aggaaatggc atgcgaagcg catcatttcg actttttttt tttttaatgc       180
     atccccccat ttcgactttt gacgcttact cattctccga atgaccgccg caagggggag       240
     ggggtcgggg agagaaaaac cttgtgaaat ggaagaaaag agacgtgaga aactaaagcc       300
     tcaggcggcg tgggaggggt ggggggaaag aatgaccgga gttgtagtga aaccggcagc       360
     tacggcgagc cgggaagccg ctggaaaggg aagaggctgg gcttaaagaa cctgctgcgg       420
     gttgtagaca aaggcggctt gggaggcaga ggccggggcg ggatccgtcg ctactatcac       480
     cctggggaga gcgccagcgg ctggactccc gcgtggaaac ccgggaaatt caccagccct       540
     cccttcaggg caggaatgcc cggagtatgc accaagctaa gaacccagag ggaaaaagta       600
     agtttgggag aggacttaac cgatcttgac ggtctttgaa ccctcaactc ctcttggagg       660
     catgccttca ccgatgcgtt ccctcttcat catttctgtc tcttgtgtca tcgttttcat       720
     cgtgttttgt gtgttcaact ttgggggaga gcaaggcttc cagaggctaa ataactcaga       780
     cacttgggtg ctgactcagg tttgcacatc ccttatcaaa gacaaaacac cgttactttg       840
     gagaaacaaa ctcatgatgt atgagaagtc ttcctgcgag gcgtacctga cccaaagcca       900
     ctacatcacg gcacccttat caaaggaaga agccgagttt cgtttggcat atatcatggt       960
     catccatcac aacttcgaca cctttgcgag gctcttcagg gctatttaca tgcctcagaa      1020
     tgtctactgt gttcatgtgg atgagaaagc gacagttgaa tttaaagact cagtggagca      1080
     gttactgagc tgcttcccaa atgcttttct ggcttccaag atggagcccg tggtctatgg      1140
     tgggatttcc aggctccagg ctgacctgaa ctgcatgaaa gatcttgcag cctcggaggt      1200
     tccctggaaa tacgccctca acacctgtgg gcaagatttc cccctgaaaa ccaacaggga      1260
     gatcgttcag tatctgaagg gatttaaagg gaaaaacatc acccccgggg tgctgccccc      1320
     agctcacgca gttgggcgga ctaagtatgt ccaccgggag cacctgggca aagagctttc      1380
     ctatgtgata agaaccacag ccttgaagcc gcctcctccc cacaatctca ccatctactt      1440
     tggctctgcc tatgtggccc tgtccagaga gtttaccaac tttgttctcc acgacccacg      1500
     ggcccttgac ttgctccagt ggtccaaaga caccttcagt ccggatgaac atttctgggt      1560
     gacgctcaat aggattccag gtatgtggga ttccctactt cacgtgaagg cgacattctg      1620
     tacttgaaag ggctttttga gagcctgcac ctttttgatt aggagataaa agctgaagta      1680
     tgtggttttc acctgaattc tttctaaacc ctgaaagaat tgatgttctt taggtgacaa      1740
     ttcagtagtc taaccaagcc aaacattggt ggtattgatc tgcagttggt cttgttctct      1800
     tgcatttagc atcttattaa atctttaccg aagtcaggat gaattgcacc ccatccccgc      1860
     tggtgatttt cttctcccca gatttgtcag acttgctgta accccagggc cattggcttg      1920
     gccactcccc tgcccattcg tagattcccc cttatcagcc agatgtcatc aactctgaga      1980
     agctgaactg atcatccctc tttttccttc agagattttt atcatcttct ggaattatta      2040
     aatctacttt tttgaatgcg tttgtttttg gccttcttcg cattagctcc atgaagcagg      2100
     tcattttcta ttttgttacc tgctgtatcc tctatgcaaa gaacacacgg taaatgctca      2160
     ataaaaaaat gaatgaatga aaaaaaaaaa aaaaaaaaaa aaaaa                      2205
//

If you have problems or comments...

PBIL Back to PBIL home page