(data stored in ACNUC23059 zone)

EMBL: BC147052

ID   BC147052; SV 1; linear; mRNA; STD; MUS; 913 BP.
XX
AC   BC147052;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus CDK2 (cyclin-dependent kinase 2)-associated protein 1, mRNA
DE   (cDNA clone MGC:182150 IMAGE:9056044), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-913
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-913
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-JUN-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d817c15eb3a0852108f3a272c9df04cb.
DR   Ensembl-Gn; ENSMUSG00000029394; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078154; mus_musculus.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029786; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030522; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029893; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030563; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028909; mus_musculus_pwkphj.
DR   Ensembl-Tr; ENSMUST00000031341; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000104959; mus_musculus.
DR   Ensembl-Tr; MGP_C3HHeJ_T0074066; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0074898; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0074061; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0075131; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0074064; mus_musculus_pwkphj.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 682 Row: e Column: 2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..913
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_377"
FT                   /clone="MGC:182150 IMAGE:9056044"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: TAAGGCGG"
FT                   /db_xref="taxon:10090"
FT   gene            1..913
FT                   /gene="Cdk2ap1"
FT                   /note="synonyms: ST19, DORC1, doc-1, Apc10, Cdkap1"
FT   CDS_pept        40..384
FT                   /codon_start=1
FT                   /gene="Cdk2ap1"
FT                   /product="CDK2 (cyclin-dependent kinase 2)-associated
FT                   protein 1"
FT                   /db_xref="GOA:O35207"
FT                   /db_xref="InterPro:IPR017266"
FT                   /db_xref="MGI:MGI:1202069"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35207"
FT                   /protein_id="AAI47053.1"
FT                   /translation="MSYKPNLTAHMPAAALNAGSVHSPSTSMATSSQYRQLLSDYGPPS
FT                   LGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVREC
FT                   LAETERNARS"
XX
SQ   Sequence 913 BP; 223 A; 263 C; 224 G; 203 T; 0 other;
     agccggcgac aacaaaaagt gcgcccgccg cccgcgggga tgtcgtacaa gccgaacttg        60
     accgcgcaca tgcccgccgc cgccctcaac gccggaagtg tccactcacc ctctactagc       120
     atggcgacct cctcccaata tcgccagctg ctgagtgact atgggcctcc atcgctaggc       180
     tacacccagg gaactggaaa tagccaggtg cctcagagta aatatgcaga gctgctggcc       240
     atcattgaag agttggggaa agagatcaga ccgacgtatg cagggagcaa gagcgccatg       300
     gagaggctaa aacgaggcat cattcatgcc cggagcctgg ttcgggagtg cttggctgaa       360
     acggaacgga atgccaggtc ctagcccctg gctggtctga aggcccatct cactaccccg       420
     tggagatgag aggctttgtg caaaatggca gtcatttttc taccacagtc attaagctct       480
     gaacccacac tcaaaagatt gggaggacat tttgcagtaa ctgacgatgt gcattttaag       540
     tagttaggaa tgacccagct ctttttttct ttccaaacat ttgaaagatg tttgtgaagc       600
     cacttcacag caagctattg tttgtcccca aataccagtg tcccctctaa cctgcctttg       660
     gatacgcatc accccagctg acttcctttc cctgagctca cctgcctccg aggagttgag       720
     tgcaaaccac agcgcctttg ctcagtagct ggcccgcctg tgtacagtgt agaccctgct       780
     tcatggagct tctctgccta agcgtttgca tgactgagtg cttggaagtc aatctttaaa       840
     atgcacaggt tacacatgca gaagagcgag ccatctaccc aacctcccaa gcaccctgca       900
     gatgtccatc ctg                                                          913
//

If you have problems or comments...

PBIL Back to PBIL home page