(data stored in ACNUC23059 zone)

EMBL: BC147053

ID   BC147053; SV 1; linear; mRNA; STD; MUS; 938 BP.
XX
AC   BC147053;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus CDK2 (cyclin-dependent kinase 2)-associated protein 1, mRNA
DE   (cDNA clone MGC:182154 IMAGE:9056048), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-938
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-938
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-JUN-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 2f30f704b2ed4ccca6a070e9bbb397e2.
DR   Ensembl-Gn; ENSMUSG00000029394; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078154; mus_musculus.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029786; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030522; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029893; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030563; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028909; mus_musculus_pwkphj.
DR   Ensembl-Tr; ENSMUST00000031341; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000104959; mus_musculus.
DR   Ensembl-Tr; MGP_C3HHeJ_T0074066; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0074898; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0074061; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0075131; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0074064; mus_musculus_pwkphj.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 682 Row: e Column: 6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..938
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:182154 IMAGE:9056048"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: TACTACAC"
FT                   /db_xref="taxon:10090"
FT   gene            1..938
FT                   /gene="Cdk2ap1"
FT                   /note="synonyms: ST19, DORC1, doc-1, Apc10, Cdkap1"
FT   CDS_pept        65..409
FT                   /codon_start=1
FT                   /gene="Cdk2ap1"
FT                   /product="Cdk2ap1 protein"
FT                   /db_xref="GOA:O35207"
FT                   /db_xref="InterPro:IPR017266"
FT                   /db_xref="MGI:MGI:1202069"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35207"
FT                   /protein_id="AAI47054.1"
FT                   /translation="MSYKPNLTAHMPAAALNAGSVHSPSTSMATSSQYRQLLSDYGPPS
FT                   LGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVREC
FT                   LAETERNARS"
XX
SQ   Sequence 938 BP; 227 A; 274 C; 232 G; 205 T; 0 other;
     agccggcgac aacaaaaagt gcgcgggctc cccgcagccg tccgagcgcc cgccgcccgc        60
     ggggatgtcg tacaagccga acttgaccgc gcacatgccc gccgccgccc tcaacgccgg       120
     aagtgtccac tcaccctcta ctagcatggc gacctcctcc caatatcgcc agctgctgag       180
     tgactatggg cctccatcgc taggctacac ccagggaact ggaaatagcc aggtgcctca       240
     gagtaaatat gcagagctgc tggccatcat tgaagagttg gggaaagaga tcagaccgac       300
     gtatgcaggg agcaagagcg ccatggagag gctaaaacga ggcatcattc atgcccggag       360
     cctggttcgg gagtgcttgg ctgaaacgga acggaatgcc aggtcctagc ccctggctgg       420
     tctgaaggcc catctcacta ccccgtggag atgagaggct ttgtgcaaaa tggcagtcat       480
     ttttctacca cagtcattaa gctctgaacc cacactcaaa agattgggag gacattttgc       540
     agtaactgac gatgtgcatt ttaagtagtt aggaatgacc cagctctttt tttctttcca       600
     aacatttgaa agatgtttgt gaagccactt cacagcaagc tattgtttgt ccccaaatac       660
     cagtgtcccc tctaacctgc ctttggatac gcatcacccc agctgacttc ctttccctga       720
     gctcacctgc ctccgaggag ttgagtgcaa accacagcgc ctttgctcag tagctggccc       780
     gcctgtgtac agtgtagacc ctgcttcatg gagcttctct gcctaagcgt ttgcatgact       840
     gagtgcttgg aagtcaatct ttaaaatgca caggttacac atgcagaaga aagagccatc       900
     tacccaacct cccaagcacc ctgcagatgt ccatcctg                               938
//

If you have problems or comments...

PBIL Back to PBIL home page