(data stored in ACNUC15260 zone)

EMBL: BC147455

ID   BC147455; SV 1; linear; mRNA; STD; MUS; 1082 BP.
XX
AC   BC147455;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus olfactory receptor 310, mRNA (cDNA clone MGC:182203
DE   IMAGE:9056097), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1082
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1082
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-JUN-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 1e66427667459f129dd7a8b5dae76edb.
DR   Ensembl-Gn; ENSMUSG00000057540; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032470; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032444; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032381; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032457; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032170; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032954; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031497; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032136; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032289; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032247; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032378; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032280; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032975; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031216; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031614; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000081918; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217724; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084866; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0084933; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0084885; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084906; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084478; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085410; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084991; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0084414; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0084604; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0084464; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0084634; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084506; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085692; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084417; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083528; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 682 Row: g Column: 7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1082
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:182203 IMAGE:9056097"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: AGTTGAGA"
FT                   /db_xref="taxon:10090"
FT   gene            1..1082
FT                   /gene="Olfr310"
FT                   /note="synonym: MOR227-6P"
FT   CDS_pept        25..1023
FT                   /codon_start=1
FT                   /gene="Olfr310"
FT                   /product="olfactory receptor 310"
FT                   /db_xref="GOA:B2RVZ1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030144"
FT                   /db_xref="UniProtKB/TrEMBL:B2RVZ1"
FT                   /protein_id="AAI47456.1"
FT                   /translation="MANSTLVTEFFLEVFAEIWELRILITVLFLLVYLCSLLGNLTIII
FT                   VTTVDQTLNTPMYFFLRNLSILDMGYISITVPSTCINSLTNHRNMSVAGCAAQIFSFLF
FT                   CACVEILVFSIMAQDRYVAICKPLLYPVIMNHQFCVQMTLASLLSSLVIASVHTFKTFQ
FT                   LSFCHSNVVPQFFCDLPALLRLSCSDTFSNKLLILLTVIGVSGSCFVFIAISYIHILST
FT                   VLKIPVKGERGKAFSTCVPHIIVVSVFVSSAAFVYLRPPVITFEVVQEMVISVFYTMVP
FT                   PFLNPIVYSLRNKQIKEAVRKVILRVFPIFEYKRNIYFSWYFRGKKTDKVR"
XX
SQ   Sequence 1082 BP; 279 A; 250 C; 195 G; 358 T; 0 other;
     tcagaaaacc tgcactttga gacaatggcc aattccaccc tagtgactga gttcttcctg        60
     gaggtttttg ctgagatttg ggagctcagg atcttaatca ctgtgctgtt cctgctggtg       120
     tatctgtgca gcctgttagg gaaccttacc atcatcattg ttactacagt tgaccagacc       180
     ctgaacacac ccatgtactt cttcctcagg aatctgtcca ttttagacat gggctacatt       240
     tctatcactg tccccagtac ctgtatcaac tctctcacta accacaggaa tatgtctgtg       300
     gctgggtgtg cagcacaaat cttttcgttc ttattttgtg catgtgtaga gattctagtt       360
     ttttccatca tggcccaaga ccgctatgtg gccatctgca agcctctgct ctatcctgtg       420
     atcatgaacc accagttctg tgttcagatg acactggctt ccctactcag ctcccttgtc       480
     attgcaagtg tgcacacttt caaaactttc cagctgtcct tctgtcactc taatgtggtc       540
     cctcagttct tctgtgatct tcctgctttg ctgagacttt cttgctctga cacctttagc       600
     aacaaactcc taatacttct gactgtcatt ggagtcagtg gtagttgctt tgtcttcatt       660
     gccatatcat atattcacat attatcaact gtattgaaga ttcccgtcaa aggagagaga       720
     gggaaagcct tttctacctg tgttcctcac attattgtgg tgtctgtctt tgttagttct       780
     gctgcctttg tgtatctacg acctccagta ataacctttg aagtagttca ggaaatggtt       840
     atttctgtat tttataccat ggttccacca ttcttaaacc caattgtcta tagtcttaga       900
     aacaaacaga taaaggaggc agtgaggaaa gttatattgc gagtttttcc catatttgaa       960
     tataaaagga acatctattt ctcatggtat tttagaggaa aaaaaactga taaagtaaga      1020
     taaaattata tacaaataca caagcacaca taagtactca cacacacaaa agacttattc      1080
     cc                                                                     1082
//

If you have problems or comments...

PBIL Back to PBIL home page