(data stored in ACNUC7820 zone)

EMBL: BC148321

ID   BC148321; SV 1; linear; mRNA; STD; MUS; 938 BP.
XX
AC   BC148321;
XX
DT   18-JUL-2007 (Rel. 92, Created)
DT   18-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Mus musculus olfactory receptor 107, mRNA (cDNA clone MGC:173140
DE   IMAGE:40054936), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-938
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-938
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-JUL-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7f3ec94c96597f33a1611dadaa8ef979.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Baylor Human Genome Sequencing Center
CC   cDNA Library Preparation: Baylor Human Genome Sequencing Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCG Plate: 24 Row: a Column: 12.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..938
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_284"
FT                   /clone="MGC:173140 IMAGE:40054936"
FT                   /tissue_type="PCR rescued clones"
FT                   /note="Vector: pCR-Blunt II-TOPO; Clone identification
FT                   sequence tag: NA"
FT                   /db_xref="taxon:10090"
FT   gene            1..938
FT                   /gene="Olfr107"
FT                   /note="synonym: MOR156-3"
FT   CDS_pept        1..930
FT                   /codon_start=1
FT                   /gene="Olfr107"
FT                   /product="olfactory receptor 107"
FT                   /db_xref="GOA:A7E206"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2177490"
FT                   /db_xref="UniProtKB/TrEMBL:A7E206"
FT                   /protein_id="AAI48322.1"
FT                   /translation="MNCSKAPGFILLGLSSDPEKWQPLFNIFLCLYLLGLLGNLLLLLA
FT                   IGTDVHLHTPMYFFLSQLSLVDLCFITTTAPKMLEALWTGDGSISFSGCLTQFYFFAVF
FT                   ADMDNLLLAVMAIDRYAAICHPLFYPFLMTPCRCEVLASGSWGIAHCVSLFYTLLLSQF
FT                   YYHTNQGIPHFFCDSRPLLLLSCSDTHLSEGLMMALSGVLGMSSVLCLVSSYGCIFYAV
FT                   ARVPSAQGKRKALATCSSHLSVVLLFYSTVFATYLKPPSTSHSSAEVVAAVMYTLVTPT
FT                   LNPFIYSLRNKDVKSSLRKILNMDKFQG"
XX
SQ   Sequence 938 BP; 193 A; 236 C; 192 G; 317 T; 0 other;
     atgaactgta gtaaggctcc tggctttatc ctgttgggac tttccagtga cccagagaaa        60
     tggcagcccc tctttaatat tttcctctgt ctctacttgc tgggcctttt agggaacctg       120
     ctacttctgt tagctattgg cactgatgtc cacctccaca cccccatgta tttcttcctc       180
     agtcagctct cactagtgga tctttgcttc atcaccacaa cagcccctaa aatgctggag       240
     gctctgtgga ctggagatgg atcaatctca ttctctggat gcctgactca gttttacttc       300
     tttgctgttt ttgctgacat ggataacctg cttctggcag tcatggctat tgaccgctat       360
     gctgctatct gccaccccct gttctaccca tttctaatga ctccttgtag atgcgaagtt       420
     cttgccagtg ggtcatgggg aatagctcat tgtgtgtctc tgttctatac cttattactc       480
     tctcagtttt attatcatac caatcaaggg atacctcatt ttttctgtga ttctaggcct       540
     ctcttactgc tttcttgctc agacactcac ctcagtgagg gcctgatgat ggctttgtct       600
     ggagttttgg gaatgagctc agttctctgt cttgtaagtt cttatggttg tattttttat       660
     gctgtggcta gggttccatc agcacagggg aaaaggaaag ccctggccac atgcagttcc       720
     cacctctctg tagtcctcct attctatagc acagtctttg ctacctacct gaagccccca       780
     tctacttctc actcctctgc agaggtggta gctgctgtta tgtatacctt ggttactccc       840
     actctgaacc ccttcattta tagtcttaga aataaggatg ttaagagttc attgagaaag       900
     atcctgaaca tggacaagtt tcagggctaa atgagttg                               938
//

If you have problems or comments...

PBIL Back to PBIL home page