(data stored in ACNUC10083 zone)

EMBL: BC149961

ID   BC149961; SV 1; linear; mRNA; STD; MAM; 3639 BP.
XX
AC   BC149961;
XX
DT   12-JUL-2007 (Rel. 92, Created)
DT   12-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Bos taurus chloride channel 7, mRNA (cDNA clone MGC:152605 IMAGE:8433451),
DE   complete cds.
XX
KW   MGC.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RC   NIH-MGC Project
RP   1-3639
RA   Moore S., Alexander L., Brownstein M., Guan L., Lobo S., Meng Y.,
RA   Tanaguchi M., Wang Z., Yu J., Prange C., Schreiber K., Shenmen C.,
RA   Wagner L., Bala M., Barbazuk S., Barber S., Babakaiff R., Beland J.,
RA   Chun E., Del Rio L., Gibson S., Hanson R., Kirkpatrick R., Liu J.,
RA   Matsuo C., Mayo M., Santos R.R., Stott J., Tsai M., Wong D., Siddiqui A.,
RA   Holt R., Jones S.J., Marra M.A.;
RT   ;
RL   Submitted (10-JUL-2007) to the INSDC.
RL   BC Cancer Agency, Canada's Michael Smith Genome Sciences Centre, Suite 100,
RL   570 West 7th Avenue, Vancouver, British Columbia V5Z 4S6, Canada
XX
DR   MD5; 8802b3f5497b83887f672a728af0f240.
XX
CC   Contact: Robert Kirkpatrick
CC   Canada's Michael Smith Genome Sciences Centre
CC   BC Cancer Agency
CC   Suite 100, 570 West 7th Avenue, Vancouver, British Columbia,
CC   Canada, V5Z 4S6
CC   Tel: 1-604-707-5900 x5406
CC   Fax: 1-604-876-3561
CC   Email: robertk@bcgsc.ca
CC   Tissue Procurement: Y. Meng, M. Taniguchi, S. Lobo, L. Guan and S.
CC   Moore
CC   cDNA Library Preparation: M. Masaaki, Y. Meng, S. Lobo,  L. Guan
CC   and Dr. S. Moore
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Bovine Genome Sequencing Program, Genome
CC   Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Moore S, Alexander L, Brownstein M, Guan L, Lobo S, Meng Y,
CC   Tanaguchi M, Wang Z, Prange C, Schreiber K, Shenmen C, Wagner L,
CC   Ali J, Chun E, Liao N, Beland J, Cruz K, Featherstone R, Kirk H,
CC   Matsuo C, Mayo M, Moore R, Munro S, Roger J, Tam B, Trinh E, Sze W,
CC   Wilton J, Wanger S, Huang P, Chu B, Imanian B, Roscoe R, Holt R,
CC   Jones S, Marra M
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series:  Plate:  Row:  Column: 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3639
FT                   /organism="Bos taurus"
FT                   /lab_host="DH10B"
FT                   /strain="Hereford"
FT                   /mol_type="mRNA"
FT                   /clone_lib="GC_BGC-13"
FT                   /clone="MGC:152605 IMAGE:8433451"
FT                   /tissue_type="Thymus, female, 8.5 months, Hereford"
FT                   /note="Vector: pCMV-SPORT6.0"
FT                   /db_xref="taxon:9913"
FT   gene            1..3639
FT                   /gene="CLCN7"
FT                   /note="synonyms: CLC-7, CLC7"
FT   CDS_pept        44..2473
FT                   /codon_start=1
FT                   /gene="CLCN7"
FT                   /product="chloride channel 7"
FT                   /db_xref="GOA:A6QQR2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002249"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A6QQR2"
FT                   /protein_id="AAI49962.1"
FT                   /translation="MANVSKKVSWSGRDLDDDEAAPLLRRAPRLGVPAGEAAPLLNGAG
FT                   PAAARASPHSAFFRIGQLSSVELDDELLDPDMDPPHPFPREIPHNEKLLSLKYESLDYD
FT                   NSENQLFLEEERRINHTAFRTVEIKRWVICAMVGILTGLVACFIDIVVEKLAGLKYRLV
FT                   KDNIDRFTEHGGLSFSLLLWAALNAAFVLLGSTIVAFIEPVAAGSGIPQIKCFLNGVKI
FT                   PHVVRLKTLVIKVSGVILSVVGGLAVGKEGPMIHSGSVIAAGISQGRSTSLKRDFKIFE
FT                   YFRRDTEKRDFVSAGAAAGVSAAFGAPVGGVLFSLEEGASFWNQFLTWRIFFASMISTF
FT                   TLNFVLSIYHGNAWDLSSPGLINFGRFDTETMVYVIHEIPIFIAMGVVGGILGAVFNAL
FT                   NYWLTMFRIRYVHRPCLQVVEATLVAAVTATAAFVLIYSSRDCQPLRGSSVSYPLQLFC
FT                   ADGEYNSMAVAFFNTPEKSVVSLFHDPPGSYNPMTLGLFTLVYFFLACWTYGLTVSAGV
FT                   FIPSLLIGAAWGRLFGISLSYITGAAVWADPGKYALMGAAAQLGGIVRMTLSLTVIMME
FT                   ATSSVTYGFPIMLVLMTAKIVGDVFIEGLYDMLIQLQSVPFLHWEAPVTSHSLTAREVM
FT                   STPVTCLRRREKVGVIVDVLSSTASNHNGFPVVEDADGTQPARLQGLILRSQLIVLLKH
FT                   KVFVERSSMGLLRRRLRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVP
FT                   QEASLPRVFKLFRALGLRHLVVVDNCNQVVGLVTRKDLARYRLGKGGLEELSLAQT"
XX
SQ   Sequence 3639 BP; 694 A; 1112 C; 1127 G; 706 T; 0 other;
     aaacacggcc gcggcgccgg cggccggtcc actgcggccg gacatggcca acgtttccaa        60
     gaaggtgtcg tggtccggcc gcgacctgga cgacgacgag gcggcgccgc tgctgcggag       120
     ggcgccgcgg ctcggggtgc cggccggcga ggcggcgccg ctgctgaacg gggctgggcc       180
     cgcggccgcc cgcgcgtcac cacactcggc attctttcgg atcggacagt tgagcagcgt       240
     ggagctggat gatgagcttc tggaccctga catggacccc cctcacccct tccccaggga       300
     gatcccacac aacgagaagc tgctgtccct caagtacgag agcctggact acgacaacag       360
     tgagaaccag ctgttcctgg aggaagagcg gcgtatcaac cacacggctt tccggacggt       420
     ggagatcaag cgctgggtca tctgcgccat ggtgggcatc ctcacgggtc tcgtggcctg       480
     cttcatcgac atcgtggtgg agaagctggc cggcctcaag tacaggctcg tcaaggacaa       540
     catcgacagg ttcaccgagc atggcggact gtccttctcc ctcctgctct gggccgcact       600
     caatgccgcc ttcgtgctcc tcggctccac catcgtcgcc ttcatagagc cggttgctgc       660
     tggcagcggg atcccccaga tcaagtgctt cctcaatggg gtgaagatcc cccacgtggt       720
     caggctcaag accctggtga tcaaagtgtc tggcgtgatc ctgtcagtgg tggggggact       780
     ggccgtgggg aaggaggggc cgatgatcca ctcgggctcg gtgatcgccg cgggcatctc       840
     ccagggcagg tccacgtcgc tgaagcggga cttcaagatc ttcgagtact ttcgcagaga       900
     cacagagaag cgggacttcg tctcggcagg agctgcagct ggagtgtccg cagcctttgg       960
     ggcccctgtg ggtggggtgc tgttcagctt ggaggagggc gcgtccttct ggaaccagtt      1020
     cctgacgtgg agaatcttct ttgcttccat gatctccact ttcaccttga acttcgtcct      1080
     gagtatttac catgggaacg cgtgggacct gtccagccct gggctcatca actttggaag      1140
     atttgatact gagaccatgg tgtacgtgat ccacgagatc cccatcttca tcgccatggg      1200
     tgttgtgggg ggcattctcg gagctgtgtt caacgccttg aattactggc tgacgatgtt      1260
     tcgaatcagg tacgtccacc ggccctgcct ccaggtggtc gaggccacgc tggtcgccgc      1320
     cgtcaccgcc acggccgcct tcgtgctcat ctactcatcc cgggactgtc agcctctgcg      1380
     ggggagctcc gtgtcctacc ccctccagct cttctgtgct gatggggagt acaactcgat      1440
     ggccgtggcc ttcttcaaca ccccggagaa gagcgtggtc agccttttcc acgacccccc      1500
     aggctcctac aaccccatga cgctcggcct gtttaccctg gtctacttct tcctggcctg      1560
     ctggacctac gggctcacgg tgtcagccgg cgtcttcatt ccgtccctcc tcattggggc      1620
     tgcctggggc cggctgttcg gcatctccct gtcctacatc acgggggctg cggtctgggc      1680
     ggaccctggc aagtacgccc taatgggagc cgctgcgcag ctgggtggga tcgtgaggat      1740
     gacgctgagc ctgacggtca tcatgatgga ggccaccagc agtgtgacct acggcttccc      1800
     catcatgctg gtgctcatga ccgccaagat cgtgggggac gtcttcatcg agggcctgta      1860
     tgacatgctc atccagctgc agagcgtgcc cttcttgcac tgggaggccc ctgtcacctc      1920
     gcactcactc accgccaggg aggtgatgag cacgccggtc acctgcctgc ggaggaggga      1980
     gaaggtgggc gtcatcgtgg acgtgctgag cagcacggcg tccaatcaca acggcttccc      2040
     cgtggtggag gatgctgacg gcacgcagcc agctcggctc cagggcttga tcctgcgctc      2100
     tcagctcatc gtcctactca agcacaaggt gttcgtggag cgctccagca tgggcctgct      2160
     gcgacgccgg ctgcggctga aggacttccg tgacgcctac ccacgcttcc ccccaatcca      2220
     gtccatccac gtgtcacagg atgagcggga gtgcaccatg gacctgtctg agttcatgaa      2280
     cccctcgccc tacacggtgc cccaggaggc gtccctccca cgggtgttca agctgttccg      2340
     ggccctgggc ctccggcacc tggtggtggt ggacaattgc aatcaggtgg tcgggttggt      2400
     gaccaggaag gacctcgcca ggtaccggct tggaaagggg ggcctggagg agctctctct      2460
     ggcccagacg tgaggctctg gcgcctgcac ctcccccagg gccctgcccc actccctggc      2520
     agcagatcca gtgaccgcaa gacgttgggg atggcctggc cagtgtgtgg cgcacatgga      2580
     cgctctgtgt tctcagtgtt ccctccccca atctcacccc tggggtccca cacccagcct      2640
     cctgttcctg attctttagg aatctgtgca actgctgttt tcttcccaag agcccgtgag      2700
     cacgcatgtc tgcgtgtgtg cgaggggaca gctggcgagc aggggcccgt gggtctgagt      2760
     gctgcagccc cacgacgggc tggttcctag gcctgcgccc tgagcaccac cagcggctgc      2820
     agcagacacc cctggccctg gccctcgggc ctcggctcgg ttggtggccg tcaggttttg      2880
     ggtctggaca gagacccgaa ctggaggcac agaggcgaag gcttggggag caggaccacc      2940
     ctggagcgca gaccccagag ccggactcct agactcacct ctgcagccct ggcttcaccc      3000
     ccctcagtgc agtggggtct gcgccggggt ctgggcccag ggggagacct gagaccctcg      3060
     ttcaggcccg gacccccgag tcaaaccacg cctctgtcac cacgcccttg tggacaccgc      3120
     tgggaaggcg gatcttcttg gcacatggcg ccccaatggc cctgagtgat actctatagc      3180
     agctctgctt ccaggattgg gggcaggggc tttctgggat gagtcagcga gcccagagca      3240
     gggacgcacc cttcccaggc cgggcaggcc cagagctggg atgctgtgtc cctgaggccc      3300
     caccggactt ttcttctgca gggactggcg tccctgaccc actctggtgg cagccatgga      3360
     tggctctgtg gtgggttggc aggcgttcca gctgtgtttc agccccttta aagggggtgg      3420
     ggcctcagaa ggtggctctc ttgctggtgg ggaagccctc cgtggggggc acgggggtct      3480
     gattgtgggg atctgaatgg aagaaataaa ggaatggtac tgataaaaaa aaaaaaaaaa      3540
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      3600
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaa                             3639
//

If you have problems or comments...

PBIL Back to PBIL home page