(data stored in ACNUC21429 zone)

EMBL: BC150726

ID   BC150726; SV 1; linear; mRNA; STD; MUS; 2061 BP.
XX
AC   BC150726;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Mus musculus ubiquilin 3, mRNA (cDNA clone MGC:183637 IMAGE:9087637),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2061
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2061
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-JUL-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; fc9e9e17a362576d0c54a584b2df7752.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 685 Row: i Column: 11.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2061
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_389"
FT                   /clone="MGC:183637 IMAGE:9087637"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO; Clone identification sequence
FT                   tag: CCCAAGCT"
FT                   /db_xref="taxon:10090"
FT   gene            1..2061
FT                   /gene="Ubqln3"
FT   CDS_pept        38..2011
FT                   /codon_start=1
FT                   /gene="Ubqln3"
FT                   /product="Ubqln3 protein"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:3045291"
FT                   /db_xref="UniProtKB/TrEMBL:B2RWV8"
FT                   /protein_id="AAI50727.1"
FT                   /translation="MAKSGEALPQGSLAPAQDSQLIRVTVKTPKDKEDFSVVDTCTIRQ
FT                   LKEKISHRFKAHPNQLVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRTIGTECPA
FT                   PPVSIPGPNPGEIPQSSSVYSVDGSPSFSLGVLTGLSGLGLTSGSFSDQPGSLMWQHIS
FT                   VPELVAQLVDDPFIQGLLSNTGLVRQLVLDNPHMQHLIQQNPEIGHILNNPEIMRQTME
FT                   FLRNPSMMQEMMRSQDRALSNLESIPGGYNVLRTMYTDIMDPMLNAVQEQFGGNPFVTA
FT                   TTASTTTTSSQPSRTENCDPLPNPWTSTYGVSGGRQGRGGRQSGDQGASENRNRLPSFL
FT                   GNIGLFDYLQQLHETSQSLGSYLQGTVPTSNSSQESPLSGNRVPPTLPSSPKPGSGQSL
FT                   PKESVAIKGKSSCPAFLRHSTENSTGQGGSLHDAGKGSTGPSTSLPNLTSQIGDSANRS
FT                   SFVSTPSSLMSATPGVPESPWLPPTGYSRSLRSAGTNQVPRIQNEIHQQLPLLLHLQTA
FT                   MANPRVMQALLQIEQGLQILATEAPRLLLWFMPCLTGLSGVTGGTEAREGVMSEDPRPT
FT                   PTPQISLAQGSTELGIHSSPFLQVLQALASTNPQQLQLEAHFRVQLEQLRAMGFLNLEA
FT                   NLQALIATGGDVDAAVEKLRKS"
XX
SQ   Sequence 2061 BP; 515 A; 582 C; 475 G; 489 T; 0 other;
     ctgtgtcccc acagacctgg gtctcctgct gcccatcatg gccaaaagtg gagaggctct        60
     accacagggc agcctagcgc cagcccagga ttcccagctc atccgggtga cagtgaagac       120
     acccaaggac aaggaggatt tctcagttgt agacacatgc accatccggc agctaaagga       180
     aaaaatatca caccgcttta aggcacatcc aaatcagctg gtcctgatct ttgctggaaa       240
     aatcctcaag gaccctgact cattggcaca gtgtggagtg cgagatggcc tcacagtcca       300
     cctggtcatc aagatgcagc gtcggaccat aggcacggag tgcccagcac caccagtctc       360
     tattccaggc ccaaatcctg gagaaatccc tcagtcaagt tctgtttact ctgtggatgg       420
     gtctccttct ttcagcttag gggtcctcac aggcctcagt gggttaggtc tgacctcagg       480
     aagcttctct gaccagccag gctcgctaat gtggcagcac atctcagtgc ctgaacttgt       540
     ggctcagctc gttgatgacc ccttcatcca gggtctgctg tccaacacgg gcctagtgcg       600
     ccagttggtt cttgacaatc ctcacatgca gcacctgatc cagcagaacc ctgagattgg       660
     tcatattctt aacaaccctg agatcatgcg gcagacaatg gagtttcttc gtaacccttc       720
     catgatgcag gagatgatgc gtagccagga tcgtgcactc agtaacctgg agagcatccc       780
     tggtggctac aatgtgctcc gtactatgta cacagatatt atggatccca tgcttaatgc       840
     agtacaggaa caatttggtg gcaatccttt tgtcactgct actactgcta gtaccaccac       900
     caccagcagc caaccatcaa ggacagagaa ttgtgaccct ctgcccaacc cctggacttc       960
     cacatatggg gtctcaggtg gaagacaagg aagaggtggc agacagtctg gggaccaggg      1020
     tgcatctgag aatagaaata ggcttccaag ctttctgggt aacataggac tctttgatta      1080
     tcttcaacag ttacatgaga cttctcagtc cctgggatct tatctgcagg gtactgtgcc      1140
     aacttcaaat tcaagccagg aatcaccact ttcaggaaac agagttcctc caactttacc      1200
     atcatcccct aaacctgggt caggccaatc tctgcccaaa gagtcagtag caatcaaggg      1260
     aaagtcatca tgcccagctt ttttgagaca ctcaactgag aacagtaccg gacaaggtgg      1320
     aagcctacat gatgcaggga agggctctac tggccccagt actagcttgc ccaatcttac      1380
     ctctcagata ggagattctg ccaacagatc ctcgtttgtt tctacaccat cttcccttat      1440
     gtcagctact cctggagtcc cagaatctcc ctggcttcct ccaacaggtt actcaagatc      1500
     tctgagatca gcgggcacaa atcaagtccc tcgaatccag aatgagatac atcaacagct      1560
     accactactg ttgcaccttc agacagccat ggcaaatccc cgtgtcatgc aagccttgct      1620
     gcagattgag cagggtctac agattctggc tactgaagca ccccgcctcc tactctggtt      1680
     catgccctgc ctaacagggt tgagtggagt aacaggaggc acagaagcta gagaaggtgt      1740
     tatgtctgag gatccccgac caaccccaac tcctcagatt tctctagcac aaggttctac      1800
     agagctaggt atccactcct cccccttcct ccaggtgttg caagccttag ctagtaccaa      1860
     tccccagcag ctacaactgg aggctcactt ccgggtacaa ctggagcaac tgcgggctat      1920
     gggctttctg aatcttgaag ccaatctcca ggccctcatt gctacagggg gtgatgtaga      1980
     tgctgctgtg gagaaattga ggaagtctta ggagctctag ttatttggac catatctttt      2040
     cctttctgcc tttcccccat g                                                2061
//

If you have problems or comments...

PBIL Back to PBIL home page