(data stored in ACNUC7421 zone)

EMBL: BC150862

ID   BC150862; SV 1; linear; mRNA; STD; MUS; 2970 BP.
XX
AC   BC150862;
XX
DT   12-FEB-2009 (Rel. 99, Created)
DT   12-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Mus musculus DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-linked, mRNA
DE   (cDNA clone MGC:183773 IMAGE:9087773), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2970
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2970
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (13-JUL-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 64f4bc50cc3d20628eea5b80ec1d699c.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 16 Row: L Column: 20
CC   single stranded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2970
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:183773 IMAGE:9087773"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: ACCAGCCT"
FT                   /db_xref="taxon:10090"
FT   gene            1..2970
FT                   /gene="Ddx3x"
FT   CDS_pept        46..2031
FT                   /codon_start=1
FT                   /gene="Ddx3x"
FT                   /product="Ddx3x protein"
FT                   /db_xref="GOA:B9EKE9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:103064"
FT                   /db_xref="UniProtKB/TrEMBL:B9EKE9"
FT                   /protein_id="AAI50863.1"
FT                   /translation="MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRN
FT                   REATKGFYDKDSSGWSSSKDKDAYSSFGSRGDSRGKSSFFGDRGSGSRGRFDDRGRGDY
FT                   DGIGGRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKY
FT                   DDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMA
FT                   CAQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQ
FT                   IYEEARKFSYRSRVRPCVVYGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDF
FT                   CKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDE
FT                   YIFLAVGRVGSTSENITQKVVWVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLE
FT                   DFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFD
FT                   LPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAF
FT                   EHHYKGSSRGRSKSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGGSRGFGG
FT                   GGYGGFYNSDGYGGNYNSQGVDWWGN"
XX
SQ   Sequence 2970 BP; 881 A; 547 C; 745 G; 797 T; 0 other;
     tttgctcagc agcggaagac tccgatttct cggtactctt cagggatgag tcatgtggca        60
     gtggaaaatg cgctcgggct ggaccagcag tttgctggcc tagacctgaa ctcttcagat       120
     aatcagagtg gaggaagtac agcaagcaaa gggcgttata tcccacctca tttaaggaac       180
     agagaagcta ctaaaggatt ctatgacaaa gacagttcag ggtggagttc tagtaaagat       240
     aaggatgcat acagcagttt tggatcacgg ggtgattcaa gagggaagtc tagcttcttt       300
     ggagatcgtg gaagtggatc aaggggaagg tttgatgatc gtggacgggg agactatgat       360
     ggcattggtg gccgtggaga tagaagtggc tttggcaaat ttgaaagagg tggaaatagt       420
     cgctggtgtg acaaatcaga tgaagatgac tggtcaaagc cactcccacc aagtgaacga       480
     ttggaacagg aactcttttc tggaggcaat actgggatta actttgagaa atatgatgac       540
     attccagtcg aagcaacagg caacaactgt cctccacaca ttgaaagttt cagtgatgtc       600
     gagatgggag aaattattat gggaaacatt gagcttactc gttatactcg cccaactcca       660
     gtgcagaagc atgctattcc tattatcaaa gagaaaagag acttgatggc ttgtgctcaa       720
     acaggctctg gaaaaactgc agcatttctc ttgcccatct tgagtcagat ctatgctgat       780
     ggtccaggag aagctctgag ggctatgaag gaaaatggaa gatatggccg tcgtaaacag       840
     tatccaatct ctttggtact ggcaccaacg agagaattgg cagtgcagat ctatgaggaa       900
     gccagaaaat tctcataccg atctagagtc cgtccttgcg tggtttatgg tggtgctgaa       960
     attggccagc agattcgaga cttagaacgt ggatgccact tgttagtagc cactccagga      1020
     cgtctagtgg atatgatgga gagagggaag atcgggttag acttctgcaa atacctggtg      1080
     ttagatgaag ctgaccggat gttagatatg gggtttgaac ctcagatacg aagaatagtt      1140
     gaacaagaca ctatgcctcc aaaaggtgtc cgccacacta tgatgtttag tgctactttt      1200
     cctaaggaaa tacagatgct ggcccgtgat ttcttagatg agtacatatt tctggctgta      1260
     ggaagagttg ggtctacttc agagaacatc acacaaaaag tggtttgggt ggaggagata      1320
     gacaaaaggt catttctgct tgaccttcta aatgcaacag gcaaggattc cctgactcta      1380
     gtgtttgtgg agaccaaaaa gggggcagat tcgctggagg atttcttata ccatgaagga      1440
     tatgcttgta ccagtatcca tggagaccgt tctcagagag atagggaaga ggcccttcac      1500
     cagttccgct caggaaaaag cccaattcta gtggctacag cagtagcagc aagaggactg      1560
     gatatttcaa atgtgaagca tgttattaat tttgacctgc ctagtgatat cgaagaatat      1620
     gtgcatcgca taggccgtac aggccgtgtg ggaaaccttg gtcttgccac ctcattcttt      1680
     aatgaaagga atataaatat cacaaaggat ttactggatc ttcttgttga agcaaaacaa      1740
     gaagtgcctt cttggttaga gaacatggct tttgaacacc actacaaggg tagcagtcgt      1800
     ggacgttcta agagtcgatt tagtggaggg tttggtgcca gagactaccg acagagtagc      1860
     ggtgccagca gttccagctt cagcagcagc cgtgcaagca gcagtcgaag tggtggaggt      1920
     ggccatggcg gcagtcgagg atttggtgga ggtggctacg gaggctttta caacagtgat      1980
     ggatatggag ggaattataa ctcccagggg gttgactggt ggggtaactg agcctgctct      2040
     gtagtaggtc accctgccaa acaagctaat atggaaacca catgtaactt agccagacta      2100
     taccttgtgt agcttcaaga actcgcagta cattaccagc tgtgattctc cactgaaatt      2160
     ttttttttaa gggagctcaa ggtcacaagt aaagatgaaa ggaacaatca gcagccctgt      2220
     ctgaaggtgg tttgaagact tcattgctgt agtttggatt aacgcccctc ccgcctaccc      2280
     ctatcccaaa ctgcatttat aattttgtga ctgaggatca tttgtttgtt aatgtactgt      2340
     gcctttaact ttagacaact ttttattttg atgtcctgtt ggctcagtaa tgctcaagat      2400
     tccaattgtt tttgacaaaa taaatttact gaacttgggc taaaatcaaa ccttggcaca      2460
     caggtgtgat acaacttaac aggaatcatc gattcatcca taaataatat aaggaaaaac      2520
     tcaagtggta gcctgtctta aggcttttga tacttgcaga ttggggaaaa acaaacaaca      2580
     aacgtcttga agcatattaa tggaattagt ttctaatgtg gcaaactgta ttaagttaaa      2640
     agttctgatt tgctcactct atcctggata ggtatttaga acctgataat agtctttaaa      2700
     caagccattc cagtcatgat gaggtgatgt atggatacat gcatacattc aaagcactgt      2760
     tctcaaagtt aatgcaagta aatacagcaa ttcctctttc aatgtttagg cagatcgtta      2820
     actatgagct agccaaatgt gggcatgtta ttacagggaa agtttaaagg tctgataact      2880
     tgaaataggt ttaggagaat tcatctactt agacttttta aatgcctgcc ataaaaaatt      2940
     gaaatggtag aatggctgac cacagcaatg                                       2970
//

If you have problems or comments...

PBIL Back to PBIL home page