(data stored in ACNUC7421 zone)

EMBL: BC157262

ID   BC157262; SV 1; linear; mRNA; STD; VRT; 1191 BP.
XX
AC   BC157262;
XX
DT   25-DEC-2007 (Rel. 94, Created)
DT   18-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Xenopus tropicalis hypothetical protein LOC100135206, mRNA (cDNA clone
DE   MGC:136147 IMAGE:7823726), complete cds.
XX
KW   MGC.
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-1191
RX   DOI; 10.1002/dvdy.10174.
RX   PUBMED; 12454917.
RA   Klein S.L., Strausberg R.L., Wagner L., Pontius J., Clifton S.W.,
RA   Richardson P.;
RT   "Genetic and genomic tools for Xenopus research: The NIH Xenopus
RT   initiative";
RL   Dev. Dyn. 225(4):384-391(2002).
XX
RN   [2]
RP   1-1191
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [3]
RC   NIH-MGC Project
RP   1-1191
RA   Klein S., Gerhard D.S.;
RT   ;
RL   Submitted (22-DEC-2007) to the INSDC.
RL   National Institutes of Health, Xenopus Gene Collection (XGC), National
RL   Institute of Child Health and Human Development, 6100 Executive Boulevard,
RL   Room 4B01, Rockville, MD 20892-7510, USA
XX
DR   MD5; f415ceacba21165ba919d21876ace6b1.
DR   Ensembl-Gn; ENSXETG00000008065; xenopus_tropicalis.
DR   Ensembl-Tr; ENSXETT00000017670; xenopus_tropicalis.
XX
CC   Contact: XGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Robert M. Grainger
CC   cDNA Library Preparation: Bruce Blumberg Laboratory, University of
CC   California, Irvine
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 333 Row: b Column: 16
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis, Similarity but not identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1191
FT                   /organism="Xenopus tropicalis"
FT                   /lab_host="ElectroMAX DH10B T1 Phage Resistent cells"
FT                   /strain="N6 (Nigerian 6th generation inbred)"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_XGC_tropOva1"
FT                   /clone="MGC:136147 IMAGE:7823726"
FT                   /tissue_type="Ovary, adult female, strain N6 (Nigerian 6th
FT                   generation inbred)"
FT                   /note="Vector: pCS107"
FT                   /db_xref="taxon:8364"
FT   gene            1..1191
FT                   /gene="LOC100135206"
FT   CDS_pept        155..1039
FT                   /codon_start=1
FT                   /gene="LOC100135206"
FT                   /product="LOC100135206 protein"
FT                   /db_xref="GOA:A9ULH7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A9ULH7"
FT                   /protein_id="AAI57263.1"
FT                   /translation="MGSLVRLLVGVQRALPGSVWAVRRLSSGASEVYAARLDGSNEGIA
FT                   EIIMSRPHARNSLGKVFVSEFFDTVDSLRHDSSVRVVVVKSSIPGIFCAGADLKERAQM
FT                   DNAEVSLFVQQLRKLMSEIAALPMPTIAAVDGFALGGGLELALACDLRVAASSAKMGLI
FT                   ETTRGLLPGAGGSQRLPRLLGIGLAKELIFTGRQIDGTEAQHIGLVNDAVPQNEEGDAA
FT                   YLRALELAQEILPQAPVAVRMAKLAMNRGIEVDIASGMAIEAMCYGQVIPTKDRLEGMS
FT                   AFREKRQPHYTGK"
XX
SQ   Sequence 1191 BP; 335 A; 224 C; 323 G; 309 T; 0 other;
     ggaaacggca atccacaaat ctgaatacac ttctcagtat tgtgaaattg taggacaaaa        60
     ttggccgtcg cttttgcttt gccacatatc cttactcaga gttcaaataa aacctatagt       120
     ggtcactagg ggcgcagtcg ggtccaatta aagtatgggg agtctagtta ggctgcttgt       180
     gggtgtgcag cgggctctgc cgggatcagt gtgggctgtg agaaggctga gttcgggggc       240
     aagtgaagta tatgctgccc ggctagatgg aagcaatgag ggaattgcgg agatcatcat       300
     gtccagacct catgccagga attcactggg aaaagtgttt gtcagtgagt tctttgatac       360
     tgtagacagt cttcgccatg actccagcgt ccgtgtagtg gttgtaaaaa gtagcatacc       420
     tggcatattc tgtgctggag ccgatttaaa ggagcgggca cagatggaca atgcagaagt       480
     ctcgctcttt gtgcagcagc taagaaaact gatgagtgag attgctgcgc ttccaatgcc       540
     cactattgct gcagtggatg gatttgctct gggtggtggc ctagagttgg ctcttgcttg       600
     tgatctgagg gtagctgcat cttcagctaa aatgggacta attgagacca caaggggact       660
     acttccagga gcaggaggat cgcagagact gccacgcctg cttggtatcg gtcttgccaa       720
     agagcttata tttactggtc gtcagattga tggtacagag gcacagcata tagggctggt       780
     gaatgatgca gtgcctcaga atgaggaagg agatgctgca tacttgagag ctttggagct       840
     ggctcaggaa atacttcccc aggctccagt ggctgttagg atggccaagt tggctatgaa       900
     taggggcatt gaggttgata ttgcatctgg aatggccatt gaagcaatgt gttatggaca       960
     ggttattccc actaaggatc gattggaagg aatgtcagct tttcgggaga aacgccagcc      1020
     acattacact ggcaaataat gccaggagat tatgaaaacg cttcttccta aaagaaaaac      1080
     aaactgcagg aactttgaat tttatatcca caaatacttt aatatatggc tatgtattat      1140
     tttgaaccaa aagtaaactg ctttattaac aacaaaaaaa aaaaaaaaaa a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page