(data stored in ACNUC5448 zone)

EMBL: BC157950

ID   BC157950; SV 1; linear; mRNA; STD; MUS; 5228 BP.
XX
AC   BC157950;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Mus musculus kalirin, RhoGEF kinase, mRNA (cDNA clone MGC:189938
DE   IMAGE:9088125), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5228
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-5228
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (24-DEC-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e432cde81a281651b86d677138e69dd4.
DR   Ensembl-Gn; ENSMUSG00000061751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076810; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089655; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114954; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000232157; mus_musculus.
DR   EuropePMC; PMC4776457; 26858404.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 686 Row: m Column: 19.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5228
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_380"
FT                   /clone="MGC:189938 IMAGE:9088125"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR-XL-TOPO with reversed insert; Clone
FT                   identification sequence tag: GTATCACT"
FT                   /db_xref="taxon:10090"
FT   gene            1..5228
FT                   /gene="Kalrn"
FT                   /note="synonyms: DUET, TRAD"
FT   CDS_pept        48..5012
FT                   /codon_start=1
FT                   /gene="Kalrn"
FT                   /product="Kalrn protein"
FT                   /db_xref="GOA:A2CG49"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR028569"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="MGI:MGI:2685385"
FT                   /db_xref="PDB:1WFW"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2CG49"
FT                   /protein_id="AAI57951.1"
FT                   /translation="MTDRFWDQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAF
FT                   VSGGRDKRGGPILTFPARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSK
FT                   WDLIKPLLKTLQEAFPAEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLV
FT                   DPSQLTEEFDGSLDYNHEEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEG
FT                   SRRLIDEHTQLKKKVLKAPVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKI
FT                   TSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEI
FT                   GVSYQHALDLQTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQE
FT                   WKSFAAALDERSTILAMSAVFHQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQ
FT                   SLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHH
FT                   QRRLESIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARAL
FT                   QKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQ
FT                   RKLLLDMSVSFHTHTKELWTWMEDLQKEVLEDVCADSVDAVQELIKQFQQQQTATLDAT
FT                   LNVIKEGEDLIQQLRSAPPSLGEPTEARDSAMSNNKTPHSSSISHIESVLQQLDDAQVQ
FT                   MEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQ
FT                   RHTERKLAMNNMTFEVIQQGQDLHQYIMEVQASGIELICEKDLDLAAQVQELLEFLHEK
FT                   QHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVNASSLSEAEQLQ
FT                   REHEQFQLAIEKTHQSALQVQQKAEALLQAGHYDADAIRECAEKVALHWQQLMLKMEDR
FT                   LKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEMDHVIPLLSKHLE
FT                   QKEAFLKACTLARRNAEVFLKYIHRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVL
FT                   HFWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEYYLSTHTSTGETTEETQELLKEYG
FT                   EFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSL
FT                   EKALGVNTEDNKDLELDIIPASLSDREVKLRDANHEINEEKRKSARKKEFIMAELLQTE
FT                   KAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHIIFGNIQEIYDFHNNIFLKELEKYE
FT                   QLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEHAGTFFDEIQQRHGLANSISSYL
FT                   IKPVQRVTKYQLLLKELLTCCEEGKGELKDGLEVMLSVPKKANDAMHVSMLEGFDENLD
FT                   VQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLLTS
FT                   ELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKASNIETKQEWIKNIREVIQERIIHLKG
FT                   ALKEPIQLPKTPAKLRNNSKRDGVEDGDSQGDGSSQPDTISIASRTSQNTVESDKDGNL
FT                   VPRWHLGPGDPFSTYV"
XX
SQ   Sequence 5228 BP; 1328 A; 1387 C; 1497 G; 1016 T; 0 other;
     gaggctgtgc cctggagact gactgtgaag gatgagttca gggtgggatg acggaccgct        60
     tctgggacca gtggtatctt tggtatctcc gcttgcttcg gcttctggat cgaggatctt       120
     ttcggaatga tggtttgaaa gcttctgatg tccttcctat cctaaaggag aaagtggcct       180
     ttgtgtctgg ggggcgtgac aagcgaggtg gacccatcct gaccttccct gcccgaagca       240
     atcatgacag aataagacag gaagacctac ggaaacttgt gacgtatttg gccagcgtgc       300
     caagtgagga cgtttgcaaa cgtggcttca ccgtcatcat cgacatgcgg ggctccaagt       360
     gggatctcat caagcccctc ctcaagacgc tgcaggaagc cttccccgcc gagatccatg       420
     tggccctcat catcaagcct gacaacttct ggcagaagca gaagaccaac tttggcagct       480
     ccaaattcat ctttgagaca agcatggtgt ctgtggaggg cctcacgaag ctggtggacc       540
     cctcccagct gacagaggag tttgacggct ccctggatta caaccatgag gagtggattg       600
     agttgcgcct ctccctggag gagttcttca acagtgcggt ccacctgctc tcacgccttg       660
     aggacctgca ggagatgctg gcccggaagg agttccctgt ggatgtggag ggctctcgga       720
     ggcttatcga cgagcacacg caacttaaga aaaaggtgct gaaggccccc gtggaagagc       780
     tggaccggga ggggcagcgt ctactgcagt gcatccgctg cagcgatggc ttctcagggc       840
     gcaactgcat cccaggaagt gccgacttcc agagccttgt acccaagatc accagcctcc       900
     tggacaagct gcattccacc cgacaacacc tgcaccaaat gtggcacgtg cgaaagctca       960
     agctggatca gtgcttccag ctgcggctct tcgagcagga tgctgagaag atgttcgact      1020
     ggataagcca caacaaggag ttatttcttc agagccacac agagatcgga gtcagctacc      1080
     agcatgcact agacctccag acacagcaca atcactttgc catgaactcc atgaatgcct      1140
     atgtcaacat caaccgcatc atgtctgtcg cttcccgcct ctcagaggcc ggccattatg      1200
     cctcccagca aatcaagcag atctccacgc agctagacca ggagtggaag agctttgccg      1260
     ctgccctgga tgaacgcagt acaatcctgg ccatgtctgc tgtgttccac cagaaggcag      1320
     agcagttcct gtcaggcgtg gatgcctggt gtaagatgtg cagcgaaggc ggccttcctt      1380
     ctgagatgca ggacctggag ctggcaatcc accatcacca gtccttatat gagcaggtga      1440
     cccaggccta cacagaggtc agccaggatg gcaaagcact actggatgtc ctgcagcgtc      1500
     ccctgagtcc tgggaactct gagtccctca cagccacagc caactactcc aaggcggtcc      1560
     accaggtgct ggatgtggtc cacgaggtgc tgcaccatca gcgacggctc gagagcatct      1620
     ggcagcaccg caaggtgcgg cttcaccagc ggctgcagct gtgtgtcttc cagcaggatg      1680
     tgcagcaggt gctggactgg attgaaaacc atggcgaggc ctttctcagc aaacacactg      1740
     gggttggcaa gtccttgcat cgagcacgtg cactacagaa gaggcatgat gactttgaag      1800
     aagtggcaca gaatacatac accaatgcgg acaagctcct agaagcagcg gagcagctgg      1860
     ctcagactgg ggaatgtgac ccggaggaga tctacaaggc agcccggcac ctggaggtgc      1920
     gcatccaaga ctttgtgcgc agagtggagc agcggaagct gcttctggac atgtcggtct      1980
     ctttccacac gcacaccaaa gagctgtgga catggatgga ggaccttcag aaggaggtgc      2040
     tggaggatgt ctgtgcagac tctgtggatg cggtccagga gctgatcaag cagttccagc      2100
     agcagcagac cgccaccctg gatgccactc tcaatgtcat caaggaaggc gaagacctta      2160
     tccagcagct caggtcagcg cctccctccc tgggggagcc caccgaggcc agggactcag      2220
     cgatgtccaa caacaagaca ccccacagta gctctatcag ccatattgag tctgtcctcc      2280
     agcagctgga cgatgctcag gtacagatgg aagagctgtt tcacgagcgg aagatcaagc      2340
     tggacatctt cctacagctg cgcatctttg aacagtacac cattgaggtc actgcagagc      2400
     tggatgcctg gaacgaggac ttgctccggc agatgaatga tttcaacaca gaggatctga      2460
     ccctggctga gcagcggcta cagcgccaca cagaacggaa gcttgccatg aacaacatga      2520
     cgttcgaggt catccagcag ggccaggacc tgcaccagta catcatggaa gtgcaagcgt      2580
     caggaatcga gttaatctgt gagaaggacc ttgacctggc agctcaggtg caggagctgc      2640
     tggagtttct ccatgagaag cagcacgagc tggagctcaa tgcggagcag acgcacaagc      2700
     ggctagagca gtgtctccag ctgaggcacc tccaggctga ggtcaaacag gttctgggat      2760
     ggatccgcaa tggagagtcg atgctcaacg ccagcctggt caacgccagc tctttgtcgg      2820
     aggcagagca gctgcagcgg gagcatgaac agttccagct agccatcgag aagacgcacc      2880
     agagcgccct gcaggtacag cagaaggcag aggcactgct ccaggccggc cactacgacg      2940
     cagacgccat ccgggaatgt gctgagaagg tggccctcca ctggcaacag ctcatgctaa      3000
     agatggagga ccggctgaag cttgtcaacg cctctgtggc cttttacaag acctctgagc      3060
     aggtgtgcag tgttctggag agcttggagc aggagtaccg gagagacgag gactggtgtg      3120
     gtgggagaga caagctgggg ccggcggcag agatggacca cgttattcca ctcctcagca      3180
     agcacctgga gcagaaggag gccttcctga aggcctgcac gctggcaagg cggaacgccg      3240
     aggtgttcct caaatacatc cacaggaaca atgtgagcat gcctagtgtt gccagccaca      3300
     cccgggggcc tgaacagcaa gtaaaagcca tcttgagcga gctcttgcag agggagaatc      3360
     gagtcctgca cttctggacc ttgaagaagc ggcggttaga ccagtgtcag caatatgtgg      3420
     tgtttgagcg cagtgctaag caggcactgg actggatcca agaaacagga gaatattacc      3480
     tctcaacaca tacctccacc ggagagacca cggaggagac tcaggagctg ctgaaagagt      3540
     atggagaatt cagggtgcct gccaagcaaa cgaaggagaa ggtgaaactt ctgatccagc      3600
     tagcagacag ctttgtggaa aagggccaca tccacgccac agagatacgg aaatgggtga      3660
     ccacggtgga caagcactac cgcgatttct ccctgaggat ggggaagtac cggtactcgc      3720
     tggagaaggc gctgggggtc aacacggagg ataacaagga cctagagctg gacatcatcc      3780
     cagcaagcct ttcggatcgg gaggtcaagc tccgggacgc taaccatgag atcaatgaag      3840
     agaaacggaa gtcagctcga aagaaagagt tcattatggc tgaactgctc caaactgaga      3900
     aggcttatgt aagggacttg cacgagtgct tggagaccta cctgtgggag atgactagtg      3960
     gtgtggaaga gatacccccc ggcatcctca ataaggaaca tatcatcttc ggcaacatcc      4020
     aggagatcta tgacttccat aacaacatct tcctcaaaga gctggagaag tacgagcagc      4080
     tgcctgagga tgtgggacac tgctttgtta cctgggcaga caaatttcag atgtatgtca      4140
     cctactgtaa aaacaagcct gattccaacc agctgatcct ggagcatgcg ggcaccttct      4200
     ttgatgagat ccagcagcgg catggcctgg ccaactccat ctcctcctac ctaattaagc      4260
     ctgtccagag ggttaccaag taccagctgc tcctgaagga acttctaact tgctgtgaag      4320
     aagggaaagg agagctgaag gatggcctgg aggtgatgct cagtgtcccc aagaaagcca      4380
     acgatgccat gcatgtcagc atgctggaag ggttcgatga aaacttggat gtacaggggg      4440
     agttgattct ccaggatgcc tttcaagtgt gggacccaaa gtcgctgatc cggaaggggc      4500
     gggagcgcca tctgttcctc tttgagatct ccttggtgtt tagcaaagag atcaaagact      4560
     cttcaggaca cacgaaatat gtttacaaga acaagctact gacctcagag ctgggtgtga      4620
     ccgagcatgt agaaggtgac ccctgcaaat tcgccttgtg gtctgggcgc accccatcct      4680
     cagacaataa aacagtgctc aaagcttcca acatcgaaac caagcaggaa tggatcaaga      4740
     acattcgaga agtgattcag gagaggatca ttcatcttaa aggcgcttta aaggagccaa      4800
     ttcagctccc caaaacacca gccaaactga ggaacaatag taagagggat ggggtagagg      4860
     atggtgacag ccaaggggat gggagcagcc agccagatac catatccatt gcctccagga      4920
     cctctcagaa cacagtggaa agtgacaagg atggcaacct tgttcctcgt tggcacctgg      4980
     gacctggaga tcctttctcc acttacgttt agcgcgcagc ctgggacatg tccctgcagc      5040
     tcaccgggtt agccgtggca ccgttgggac ctcccaccag gactccaatc acccaactct      5100
     attgagactg ctctgacagg gctggtatgg ggtgcagcct ttgctcagag ggcaacatgt      5160
     tccaagcaaa atctgcccgc ctgggccatg ggctcacccc gggcctccct gcttctctcc      5220
     tgggtgca                                                               5228
//

If you have problems or comments...

PBIL Back to PBIL home page