(data stored in ACNUC10243 zone)

EMBL: BC158038

ID   BC158038; SV 1; linear; mRNA; STD; MUS; 1712 BP.
XX
AC   BC158038;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   13-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Mus musculus heterogeneous nuclear ribonucleoprotein A3, mRNA (cDNA clone
DE   MGC:189841 IMAGE:9007341), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1712
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1712
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (24-DEC-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 43da42d8074beda1b5981999b7a04e69.
DR   Ensembl-Gn; ENSMUSG00000059005; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025856; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AKRJ_G0025802; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025828; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025588; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026275; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0025569; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025700; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025662; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025788; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026332; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025120; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000111962; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164947; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0055405; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AKRJ_T0055393; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0055369; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0055100; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0055851; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0055053; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0055157; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0055118; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0055258; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0055998; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0054373; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 688 Row: f Column: 7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1712
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:189841 IMAGE:9007341"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CCCCGTGC"
FT                   /db_xref="taxon:10090"
FT   gene            1..1712
FT                   /gene="Hnrnpa3"
FT                   /note="synonym: Hnrpa3"
FT   CDS_pept        29..1102
FT                   /codon_start=1
FT                   /gene="Hnrnpa3"
FT                   /product="heterogeneous nuclear ribonucleoprotein A3"
FT                   /db_xref="GOA:Q0VG47"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034513"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:1917171"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VG47"
FT                   /protein_id="AAI58039.1"
FT                   /translation="MEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVM
FT                   RDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVK
FT                   KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVV
FT                   QKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFG
FT                   GRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGY
FT                   GGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPYG
FT                   GGYGSGGGSGGYGSRRF"
XX
SQ   Sequence 1712 BP; 506 A; 232 C; 493 G; 481 T; 0 other;
     agttggaaga ggcgagtccg gtctcaaaat ggagggccat gatccaaagg aaccagagca        60
     gctgaggaag ctatttattg gtggtctgag ctttgaaacc acagatgata gcttaagaga       120
     acattttgag aaatggggca cacttacaga ctgtgtggta atgagagatc cccaaacaaa       180
     acgttccaga ggctttggtt ttgtgaccta ctcttgtgtt gaagaggtgg atgctgcaat       240
     gtgtgctcgg ccacacaagg ttgatgggcg tgtggtggaa ccgaagagag ctgtttctag       300
     agaggattct gtaaagcctg gtgcccattt aacggtgaag aaaatttttg ttggtggtat       360
     taaagaggat acggaagaat ataacctgag agactacttt gaaaagtatg gcaagattga       420
     aaccatagag gttatggaag acaggcagag tgggaaaaag agaggatttg cttttgtaac       480
     ttttgatgat catgacacag ttgataaaat tgttgttcag aaataccaca ctattaatgg       540
     gcataattgt gaagtgaaaa aggccctttc taaacaagag atgcagtctg ctggatcaca       600
     gagaggtcgt ggaggtggat ctggcaactt tatgggtcgt ggaggaaact ttggaggtgg       660
     tggaggaaac tttggtcgtg gaggaaactt tggtggaaga ggtggctatg gtggtggagg       720
     tggtggcagc agaggtagtt atggaggtgg tgatggtgga tataatggat ttggaggtga       780
     tggtggcaac tatggtggtg gtcctggtta cagcagtaga ggaggttatg gaggtggtgg       840
     accaggatat ggaaaccagg gtggtggata tggtggtgga ggaggaggct atgatggtta       900
     caatgaagga ggaaattttg gtggaggtaa ctatggtggt ggtggaaact ataatgactt       960
     tggaaattat agtggacagc aacaatcaaa ttatggaccc atgaaggggg gcagttttgg      1020
     tggaagaagc tcaggcagtc cctatggtgg tggctatgga tctggaggtg gaagtggtgg      1080
     atatggtagc agaaggtttt aaaataaaac agaaacggct acagttctta gcaggagaga      1140
     gagcgaggag ttgtcaggaa agctgcaggt tactttgaga cagtcgtccc aaatgcatta      1200
     gaggaactgt aaaaatctgc cacagaagga acgatgatcc atagtcagaa aagttactgc      1260
     agcttaaaca ggaaaccctt cttgttcagg actgtcatag ccacagtttg caaaaagtgc      1320
     agctattgat taatgcaatg tagtgtcaat tagatgtaca ttcctgaggt cttttatctg      1380
     ttgtagcttt gtctttttct ttttcttttc attacatcag gtatattgcc ctgtaaattg      1440
     tggtagtggt accaggaata aaaaattaag gaatttttaa cttttcaata tttgtgtagt      1500
     tcagtttttc tacattttag tacagaaact ttaacaaaat gcagtttcga aggtgtttcc      1560
     ttgtgagtta acacttgaag aagatcattg ttaattacta ttttgtatga attttgctaa      1620
     agttaactgt aaagaaacac ctactgactt gcaatttaag gggaatctat tctccccatt      1680
     tccaaaacaa tgatgaatgg gcgctgacat gt                                    1712
//

If you have problems or comments...

PBIL Back to PBIL home page