(data stored in ACNUC10243 zone)

EMBL: BC158074

ID   BC158074; SV 1; linear; mRNA; STD; MUS; 1603 BP.
XX
AC   BC158074;
XX
DT   13-MAY-2008 (Rel. 95, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Mus musculus predicted gene, EG627828, mRNA (cDNA clone MGC:189871
DE   IMAGE:9007371), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1603
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1603
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (24-DEC-2007) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 410f60b15bead3f95c886699537d6765.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: LLDM Plate: 689 Row: a Column: 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1603
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_390"
FT                   /clone="MGC:189871 IMAGE:9007371"
FT                   /tissue_type="Brain,thymus,testicle,kidney,spleen,liver,
FT                   heart,lung,ovary,embryo - PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: ACTATCTT"
FT                   /db_xref="taxon:10090"
FT   gene            1..1603
FT                   /gene="EG627828"
FT   CDS_pept        29..1084
FT                   /codon_start=1
FT                   /gene="EG627828"
FT                   /product="EG627828 protein"
FT                   /db_xref="GOA:B2RXM2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034513"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:3643578"
FT                   /db_xref="UniProtKB/TrEMBL:B2RXM2"
FT                   /protein_id="AAI58075.1"
FT                   /translation="MEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVM
FT                   RDPQTKRSRGFGFVTYSCVEEVDAAMCARPYKVDGRVVEPKRAVSREDSVKPGAHLTVK
FT                   KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVV
FT                   QKYHTINGHNCEVKKALSKQEMRSAGSQRDRGGGSGNFMGRGGNFGGGGGNFGGRGGYG
FT                   GGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGYGGGGGG
FT                   YDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPYGGGYGSG
FT                   GGSGGYGSRRF"
XX
SQ   Sequence 1603 BP; 486 A; 206 C; 497 G; 414 T; 0 other;
     agttggaaga ggcgagtccg gtctcaaaat ggagggccat gatccaaagg aaccagagca        60
     gctgaggaag ctatttattg gtggtctgag ctttgaaacc acagatgata gcttaagaga       120
     acattttgag aaatggggca cacttacaga ctgtgtggta atgagagatc cccaaacaaa       180
     acgttccaga ggctttggtt ttgtgaccta ctcttgtgtt gaagaggtgg atgctgcaat       240
     gtgtgctcgg ccatacaagg ttgatgggcg tgtggtggaa ccaaagagag ctgtctctag       300
     agaggattct gtaaagcctg gtgcccattt aacggtgaag aaaatttttg ttggtggtat       360
     taaagaggat acggaagaat ataacctgag agactacttt gaaaagtatg gcaagattga       420
     aaccatagag gttatggaag acaggcagag tgggaaaaag agaggatttg cttttgtaac       480
     ttttgatgat catgacacag ttgataaaat tgttgttcag aaataccaca ctattaatgg       540
     gcataattgt gaagtgaaaa aggccctttc taaacaagag atgcggtctg ctggatcaca       600
     gagagatcgt ggaggtggat ctggcaactt tatgggtcgt ggaggaaact ttggaggtgg       660
     tggaggaaac tttggaggaa gaggtggcta tggtggtgga ggtggtggca gcagaggtag       720
     ttatggaggt ggtgatggtg gatataatgg atttggaggt gatggtggca actatggtgg       780
     tggtcctggt tacagtagta gaggaggtta tggaggtggt ggaccaggat atggaaacca       840
     gggtggtgga tatggtggtg gaggaggagg ctatgatggt tacaatgaag gaggaaattt       900
     tggtggaggt aactatggtg gtggtggaaa ctataatgac tttggaaatt atagtggaca       960
     gcaacaatca aattatggac ccatgaaggg gggcagtttt ggtggaagaa gctcaggcag      1020
     tccctatggt ggtggctatg gatctggagg tggaagtggt ggatatggta gcagaaggtt      1080
     ttaaaataaa acagaaacgg ctacagttct tagcaggaga gagagcgagg agttgtcagg      1140
     aaagctgcag gttactttga gacagtcgtc ccaaatgcat tagaggaact gtaaaaatct      1200
     gccacagaag gaacgatgat ccatagtcag aaaagttact gcagcttaaa caggaaaccc      1260
     ttcttgttca ggactgtcat agccacagtt tgcaaaaagt gcagctattg attaatgcaa      1320
     tgtagtgtca attagatgta cattcctgag gtcttttatc tgttgtagct ttgtcttttt      1380
     ctttttcttt tcattacatc aggtatattg ccctgtaaat tgtggtagtg gtaccaggaa      1440
     taaaaattaa ggaatttaaa aaaaaaaaag aaataaatga ggacacgagg attttaagta      1500
     tggtggaggt ttattgtaga tatgagggag agtgtagcca gaggcatctg gaagggtcca      1560
     cactaaactg ggccatgaga ggagaggggg aggaaagaag gga                        1603
//

If you have problems or comments...

PBIL Back to PBIL home page