(data stored in ACNUC31108 zone)

EMBL: BC161493

ID   BC161493; SV 1; linear; mRNA; STD; VRT; 2920 BP.
XX
AC   BC161493;
XX
DT   03-APR-2008 (Rel. 95, Created)
DT   18-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Xenopus tropicalis CD151 molecule (Raph blood group), mRNA (cDNA clone
DE   MGC:135515 IMAGE:7557822), complete cds.
XX
KW   MGC.
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-2920
RX   DOI; 10.1002/dvdy.10174.
RX   PUBMED; 12454917.
RA   Klein S.L., Strausberg R.L., Wagner L., Pontius J., Clifton S.W.,
RA   Richardson P.;
RT   "Genetic and genomic tools for Xenopus research: The NIH Xenopus
RT   initiative";
RL   Dev. Dyn. 225(4):384-391(2002).
XX
RN   [2]
RP   1-2920
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [3]
RC   NIH-MGC Project
RP   1-2920
RA   Klein S., Gerhard D.S.;
RT   ;
RL   Submitted (01-APR-2008) to the INSDC.
RL   National Institutes of Health, Xenopus Gene Collection (XGC), National
RL   Institute of Child Health and Human Development, 6100 Executive Boulevard,
RL   Room 4B01, Rockville, MD 20892-7510, USA
XX
DR   MD5; d96c9bf6fc00310279651e6ca1119590.
DR   Ensembl-Gn; ENSXETG00000019035; xenopus_tropicalis.
DR   Ensembl-Tr; ENSXETT00000041276; xenopus_tropicalis.
XX
CC   Contact: XGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Richard M. Harland Laboratory, University of
CC   California, Berkeley
CC   cDNA Library Preparation: Richard M. Harland Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 334 Row: j Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis, Similarity but not identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2920
FT                   /organism="Xenopus tropicalis"
FT                   /lab_host="E. coli XL1-Blue derivative, Stratagene
FT                   ElectroTen-Blue"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_XGC_tropGas7"
FT                   /clone="MGC:135515 IMAGE:7557822"
FT                   /tissue_type="Whole embryo, Gastrula (st. 10.5-12.5)"
FT                   /note="Vector: pCS108"
FT                   /db_xref="taxon:8364"
FT   gene            1..2920
FT                   /gene="cd151"
FT   CDS_pept        106..867
FT                   /codon_start=1
FT                   /gene="cd151"
FT                   /product="cd151 protein"
FT                   /db_xref="GOA:B1WAT5"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="UniProtKB/TrEMBL:B1WAT5"
FT                   /protein_id="AAI61493.1"
FT                   /translation="MSEYNEKKETCGTICLKYLLFTFNFFFWLAGLAVMAVGIWTLIQK
FT                   SDYISLLPSNTYAATAYILVIAGAIVMITGILGCCATFKERKSLLKVYFILLLCIFILE
FT                   VLAGILAYIYYQQLNAELKQSLKQTMTTKYKQPGEEKVTNAVDKLQQEFKCCGSNNSED
FT                   WRDSIWINSPEAEKRLVPDSCCKTVTQRCGIRDHPSNIYKTEGGCITKLETFIRAHLLI
FT                   IGAVGIGIACVQLFGMIFTCCLYRSLKSEPY"
XX
SQ   Sequence 2920 BP; 823 A; 631 C; 609 G; 857 T; 0 other;
     cgacaccctg tctggtacat taaaagcact gctgccgaac ccggtctgga tctgttgccc        60
     tgagaagatt ccatagtgtt actgagtcgc aaccgcagag tcacaatgag cgagtacaat       120
     gagaaaaagg agacctgtgg cactatttgc ctgaaatacc tgctcttcac ctttaacttt       180
     ttcttctggt tggcaggcct ggcagtaatg gccgtgggga tctggacact cattcagaaa       240
     agcgattaca ttagtcttct gccttccaac acctatgcag ccactgccta cattctggtc       300
     attgctggag ccatcgttat gataacgggc atcctgggat gttgtgccac ctttaaggag       360
     agaaaaagcc tgctcaaagt gtatttcatc ttgttgctat gcatctttat cctagaggtc       420
     ctggcaggaa tcctggccta tatttactac cagcagctga atgcagagct caagcagagc       480
     ctcaagcaaa ctatgaccac aaagtacaaa cagccaggag aggagaaagt gaccaatgct       540
     gtggacaaac tgcaacagga gtttaaatgc tgcggcagta ataattctga ggactggagg       600
     gacagcatat ggattaactc tcctgaggcc gaaaagcggt tggttcctga cagctgctgc       660
     aagacggtta ctcaacgatg tggcattcgg gatcacccat ccaacatcta caagacggag       720
     ggtggatgca tcaccaagct tgaaaccttt attcgggctc acctgctaat tataggtgct       780
     gtggggattg gcattgcctg tgttcagctt tttgggatga ttttcacctg ctgcctgtac       840
     aggagcctaa agtcagagcc atattgaaaa catttaagac ttgtcttgtt gccttgtttt       900
     tccctgctga caacatatcc tgctgcctta aacacccccc tggcactgag gcctgttatg       960
     gtcctattgt aatggcagaa tgttatctca tatcactgtg tggacccttt ggaactctgc      1020
     ggtttttaac ccatgatatc atcagcctgc gactgtatcc agtgccaaac atcaatgtaa      1080
     ccaagttctc atgctagaga ctgcaaaaac aaaacaaatc ctttcttttg cttgatgact      1140
     tttgctaatg atgttcgcag ccacagctag agatctgacc tccgttaaat gggcagaaca      1200
     agacactggg aatagttgca ccaaatgaca atctctggaa attgactctc tgtccgtccc      1260
     tatgactact cttcggtcct tcctttcaat cccgatgact tggttttcct atggagaaga      1320
     ttcaagaggg cattgggcat aatttgccat ggcaaagtct gttataacat gacttacaag      1380
     caaaactggt accattttgc aagtgaacga aaacatgtac tggagggggc cacactatat      1440
     aaaatattat taatatacag taggtttgtt tatagagtta actgaagtag aagtgtggag      1500
     gagttttcgt gccttcctta acacagttgg cttattaaga gaattccaaa gtgttctcag      1560
     aatcttctgt ttagcacatt ttccctttaa aaacccaggt ggtgcactat ttccatggaa      1620
     tttcatagct ttattttact ataccccaca gaagactctt ttattggttt tatccccatt      1680
     gggccctttt ttacccagag gcccctgggt atgctatccc catagtcaca aggctggtta      1740
     tagggataaa ttgggttaca atcaagtttt taatgaatta tgaacttaaa gctctacttc      1800
     ttatttaatt gccagcatac tcctttcaag ctccaggcct taaagtggaa agaacataca      1860
     gccccagtta atgaatataa gcacttttgg ggtgagtcag agtccctgtt aaactagtat      1920
     accaccattt gcaccccctg gccacccttg acacttatgt gccaatataa agtacagcag      1980
     actggaaagc agatctaatg gaatagtgac tgttttagaa tgcagcattt ataaaatccc      2040
     ctgttatttc ttgtctgtat agtcagagcc gtttttattg ctgtaatggg gctctggtat      2100
     tcatataaaa tagtcttttt caacctgggg ccctttagct gtaattgaat gcccaatgcc      2160
     cacttatagc ctgtggctat tggagggatg taatgtgcct aaatttaggc agcatgatga      2220
     gaagtgctgt tgttgcctta ctaattctcc tatcccataa tctttgcttg gccctcccct      2280
     aatactttct tgtctccatt ttggacccct cacaaacaga cctgtttata gtacagcatg      2340
     agatgtgcct attactagga cttggaactt accacagaga acctttgtat cagggatgca      2400
     gaacctaatt aatttcaaga ggaagcaaag atgctctgga attgacaaaa atggagtgtc      2460
     atttttcagt gttcaagtac aacacagaaa tgtaaaccct caaaactagg gtttgcaatg      2520
     tcgccaagcg agtggatctt ctcccgatat tgcccaccta cgggtgggcg atatcgggag      2580
     aattcaggct aattcgattg tttggccctg accttagtaa tgaacagcag ttggagctgt      2640
     tgctgcaaat tcattaaatg aaattaaaaa ctaagggaaa tatttagcat aaatgagtta      2700
     aaagagctct ctgagcagtg ttacattcat ttgttttgag catattgcag tcacttgcct      2760
     tttaactccc tctttgtgaa ttccactccc agattataaa ctggtccata aacccagctc      2820
     ctggtgtatg tgctataaat gttctgtttg gcatttatta gtctggatat taaatcaagg      2880
     catatgtgta aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa                            2920
//

If you have problems or comments...

PBIL Back to PBIL home page