(data stored in ACNUC404 zone)

EMBL: BC162170

ID   BC162170; SV 1; linear; mRNA; STD; VRT; 1407 BP.
XX
AC   BC162170;
XX
DT   14-JUN-2008 (Rel. 96, Created)
DT   14-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Danio rerio si:ch211-243g18.2, mRNA (cDNA clone MGC:193689 IMAGE:9037882),
DE   complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1407
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1407
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-APR-2008) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7bdd3498f2117da2007c9b04f74a4816.
DR   Ensembl-Gn; ENSDARG00000044261; danio_rerio.
DR   Ensembl-Tr; ENSDART00000028855; danio_rerio.
DR   Ensembl-Tr; ENSDART00000064977; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Harvard
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCY Plate: 1 Row: P Column: 8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1407
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_38"
FT                   /clone="MGC:193689 IMAGE:9037882"
FT                   /tissue_type="Pooled, Harvard Zebrafish Pool, whole embryo
FT                   5 somites, whole embryo 20 hpf, whole embryo 24 hpf, whole
FT                   embryo 48 hpf, whole adult fish"
FT                   /note="Vector: pCR4-TOPO reverse; Clone identification
FT                   sequence tag: CGGCATTA"
FT                   /db_xref="taxon:7955"
FT   gene            1..1407
FT                   /gene="si:ch211-243g18.2"
FT                   /note="synonyms: fc18h11, krtt1c10, wu:fc18h11"
FT   CDS_pept        41..1327
FT                   /codon_start=1
FT                   /gene="si:ch211-243g18.2"
FT                   /product="si:ch211-243g18.2"
FT                   /db_xref="GOA:F6P9S6"
FT                   /db_xref="InterPro:IPR002957"
FT                   /db_xref="InterPro:IPR018039"
FT                   /db_xref="InterPro:IPR039008"
FT                   /db_xref="InterPro:IPR042180"
FT                   /db_xref="UniProtKB/TrEMBL:F6P9S6"
FT                   /db_xref="ZFIN:ZDB-GENE-030131-2830"
FT                   /protein_id="AAI62170.1"
FT                   /translation="MSSSLSVRSLSLGRQPSFSSMSLRDSGRARSKAAVSFAAAKPLSR
FT                   SSSMSMSDLNGLGSMSLNGLHGNSTNEKEAMQSLNSRLANYLDKVRSLEKSNADLELRL
FT                   KQLMLDRVPKGHDIDSMMAQAHALEQEVRKKTLENARIMLEIDNAKLAADDFRIKWETE
FT                   SAMCQSVERDCVALKKAKSDHDQIIATLRGDLDSLKEELYFLRKNHEEEMDSLRARIAQ
FT                   EDVNVEVDAARGPELGTVLSDLRSQYEGIVQKNKEEAESWYRKKLETVQTQVRESNEAL
FT                   RGAQSELTERQRFLQTLEVELESLHKQVAALEGNLSETGQKYTLEMERLQATLAQLEDS
FT                   LSQLRLDMQRNKTDYEQLLRIKQNLEMEIATYRRLLEGEETVKEIPPPPKKEPDVRTRK
FT                   IVKVVTQTMINGKVVDESSEVEQIEETKK"
XX
SQ   Sequence 1407 BP; 394 A; 350 C; 397 G; 266 T; 0 other;
     cagcacagaa aacaccctcc cttcactgac aacagagatc atgtcgtcca gtctctcagt        60
     acggagctta tctctgggcc ggcagccttc tttctccagc atgtctctga gggacagtgg       120
     acgtgcccga tccaaagctg cggtctcttt cgctgcagcc aagcctctgt ctcgctcttc       180
     ctccatgagc atgtcagatc tgaacggcct cggcagcatg tctctcaacg gcctgcatgg       240
     caacagcacc aatgaaaaag aggccatgca aagcctgaac agccgattgg ccaactacct       300
     agataaggtg cgctctctgg agaagtccaa cgctgacctg gagctgaggc tcaaacaact       360
     gatgctggac cgtgtgccga aaggacacga tatcgattcc atgatggccc aagctcatgc       420
     tctcgaacag gaagtaagga agaaaactct ggagaatgct cggatcatgc ttgagatcga       480
     taatgccaag ttggctgcag atgatttcag aatcaaatgg gagacggaga gcgcaatgtg       540
     tcagtcggtg gaacgagact gcgtggccct gaagaaagcc aagtcagacc atgaccagat       600
     catcgccaca ctccgtggtg acctggacag cctgaaagaa gaactctact tcttgaggaa       660
     gaaccatgag gaggaaatgg acagtctgag agcccggatt gctcaagagg atgtcaatgt       720
     ggaggtggat gcggcccgtg ggccagagct ggggactgtc ctctccgatc tcaggtctca       780
     gtatgaaggc attgtccaga agaacaagga ggaagctgag agctggtacc gtaaaaagtt       840
     ggagacagtg cagacgcagg tgcgtgagag caatgaagcc ctgagaggag ctcagagtga       900
     actcaccgag aggcagcgct ttctgcagac cctggaagtg gaactggaga gccttcataa       960
     acaggtggca gctctggaag gtaacctgag tgagacgggg cagaaataca ccctggagat      1020
     ggagcgtctg caggccaccc tggcccagct ggaggacagc ctgtctcagc tgcgtctgga      1080
     catgcagcgc aacaagactg actacgagca gctcctgcgc atcaaacaga acctggagat      1140
     ggagatcgcc acctacagga ggctgctgga gggcgaggag acggttaaag agattcctcc      1200
     accacccaag aaagagcctg acgttcgtac ccgcaagata gtaaaggtgg taacgcaaac      1260
     catgatcaat ggtaaagtcg tggacgaatc cagcgaagtc gaacagattg aggagacaaa      1320
     gaagtaaaac aagaacaaga ctgtctgtgt gattctccat ataaaagcct ctattgttca      1380
     tttagaagct gcattacctt ttggccc                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page