(data stored in ACNUC9306 zone)

EMBL: BC162439

ID   BC162439; SV 1; linear; mRNA; STD; VRT; 1855 BP.
XX
AC   BC162439;
XX
DT   14-JUN-2008 (Rel. 96, Created)
DT   14-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Danio rerio similar to neurofibromin 2, mRNA (cDNA clone MGC:194620
DE   IMAGE:9037609), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1855
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1855
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-APR-2008) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8a6f31033ba52a2da33df43be3f03151.
DR   Ensembl-Gn; ENSDARG00000020204; danio_rerio.
DR   Ensembl-Tr; ENSDART00000132564; danio_rerio.
DR   Ensembl-Tr; ENSDART00000180681; danio_rerio.
DR   Ensembl-Tr; ENSDART00000181363; danio_rerio.
DR   Ensembl-Tr; ENSDART00000186998; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Harvard
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCY Plate: 1 Row: D Column: 23.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1855
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_38"
FT                   /clone="MGC:194620 IMAGE:9037609"
FT                   /tissue_type="Pooled, Harvard Zebrafish Pool, whole embryo
FT                   5 somites, whole embryo 20 hpf, whole embryo 24 hpf, whole
FT                   embryo 48 hpf, whole adult fish"
FT                   /note="Vector: pCR4-TOPO reverse; Clone identification
FT                   sequence tag: GACTATCT"
FT                   /db_xref="taxon:7955"
FT   gene            1..1855
FT                   /gene="LOC561184"
FT   CDS_pept        25..1806
FT                   /codon_start=1
FT                   /gene="LOC561184"
FT                   /product="similar to neurofibromin 2"
FT                   /db_xref="GOA:B3DGL5"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="UniProtKB/TrEMBL:B3DGL5"
FT                   /db_xref="ZFIN:ZDB-GENE-080722-7"
FT                   /protein_id="AAI62439.1"
FT                   /translation="MASALASKMGLSLRRKQAKIFNVTVVTMDADLEFSCELKWRGKDL
FT                   FELVCRTLGLRETWFFGLRYDVKDTVAWLKMDKKVLDHDVPKEEPIVFYFLAKFYPENV
FT                   EEELVQDITQHLFFLQVKKSILEEEIYCPPEASVLLASYAVHAKYGDYNPNVHKPGFLS
FT                   QDELLPKRVINLYQMTAEMWEERITVCYAEHRGRTRDEAEMEYLKIAQDLEMYGVNYFS
FT                   IRNKKGTSLLLGVDALGLHIYDLDNRLTPKISFPWNEIRNISYSDKEFAIKPVDKRADV
FT                   FKFNSSKLRVNKLILQLCIGNHDLFMRRRRVDSLEVQQMKTQAREEKARKQMERQRLER
FT                   EKQLREDAERARDELQRRLIQLQDEAHLANEALLRSEETADLLAEKAQIAEEEAKLLAQ
FT                   KAAEAEQEMQRIKVTAIRSEEEKRLMEQKMLEAEMIALKMAEESERRAKEADQLKQDLQ
FT                   EARESERRAKNKLLEITSKTEYSPVPLSANSLPADGPNFNFSMENLSFDFKDTDMKRLS
FT                   MEIEKEKVEYMEKSKHLQEQLNELKTEIESLKLKERETPLDILHNENTEKGTSKQSNFK
FT                   KLTLQSTKSRVAFFQEL"
XX
SQ   Sequence 1855 BP; 559 A; 387 C; 506 G; 403 T; 0 other;
     gaggagaacc catgagcagc tattatggct agtgcccttg catcaaaaat gggactctct        60
     cttcggagga agcaagccaa aatcttcaat gttacagttg ttacaatgga tgctgatttg       120
     gagttcagct gtgagctgaa gtggcgagga aaggatctgt ttgaacttgt atgccggaca       180
     ttggggctca gggagacttg gttttttggt ctgcggtacg acgtcaaaga cactgtggcc       240
     tggctgaaaa tggacaagaa ggttttggat catgatgtgc ccaaagagga gcctatagtg       300
     ttttatttcc tggccaagtt ttaccctgaa aatgtagaag aagagttggt acaagacatc       360
     acgcagcacc tcttcttcct ccaggtgaag aagagcattt tagaagagga gatctactgt       420
     cctcccgagg cttcggtgct gttagcctct tacgccgtcc atgctaagta tggtgattac       480
     aaccctaatg tccacaagcc gggcttcctg tcccaagacg agctgctacc aaagagagtt       540
     attaatctgt accagatgac tgcagagatg tgggaggaga gaataacggt ctgctacgct       600
     gagcacaggg gcagaaccag agatgaagca gagatggagt atttaaaaat agctcaggat       660
     ctggagatgt atggggtcaa ttacttttcc attaggaata aaaagggaac cagccttctg       720
     cttggtgttg acgctttggg cctccacatt tatgacctgg ataacagact gacgcccaaa       780
     atctcctttc catggaatga gatccgaaac atctcctaca gcgataaaga gtttgcaatt       840
     aaacctgtgg ataagagagc agatgtcttc aaattcaact cttcaaagct cagagtaaat       900
     aaactgattc tccagctgtg catcgggaac catgatctct tcatgaggag acgcagggtt       960
     gattcattgg aggtccagca gatgaagact caggctagag aagagaaagc tcgcaaacag      1020
     atggagcggc agcggctaga gagagagaaa cagttgcgtg aggatgcaga gagagcgcgt      1080
     gatgaactcc agaggagact cattcagtta caggacgaag ctcacttggc caatgaagca      1140
     ctgttgcgtt cagaggagac ggcagatttg ttggcggaaa aggcacaaat cgctgaggag      1200
     gaggccaagc ttttggctca gaaagcggct gaggctgaac aggagatgca gcgtattaag      1260
     gtgacagcca ttcgctctga ggaggagaag agactgatgg agcagaagat gctggaggct      1320
     gagatgattg cgctcaagat ggcagaagag tctgaaagga gggccaaaga ggccgaccag      1380
     ctgaaacagg acctgcagga ggccagagaa tcggagcgca gagccaaaaa caaactactg      1440
     gagatcacca gcaaaacgga atattcgcct gtgccgttgt ctgccaactc tcttcctgcc      1500
     gatggtccta acttcaactt cagcatggag aacctgagtt ttgacttcaa agacacagac      1560
     atgaaacgtc tgtccatgga gatcgagaag gaaaaggttg agtacatgga gaagagcaaa      1620
     caccttcagg agcagctgaa tgaactgaag actgagattg agtcattaaa gctaaaggag      1680
     cgagaaacgc ctctagacat cctccataat gagaacacgg agaaaggcac cagcaagcag      1740
     agcaacttta aaaagctcac tctacagagc accaaatcca gagtggcctt cttccaggag      1800
     ctttaaccct tcagacacac tggactataa tgtctgaatc gggtgtctca ctgtg           1855
//

If you have problems or comments...

PBIL Back to PBIL home page