(data stored in ACNUC23405 zone)

EMBL: BC162717

ID   BC162717; SV 1; linear; mRNA; STD; VRT; 999 BP.
XX
AC   BC162717;
XX
DT   14-JUN-2008 (Rel. 96, Created)
DT   14-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Danio rerio homeo box HB9 like a, mRNA (cDNA clone MGC:194133
DE   IMAGE:9038133), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-999
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-999
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-APR-2008) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 85d23aaf2b8fa9a877cf7910d01cb7a9.
DR   Ensembl-Gn; ENSDARG00000042106; danio_rerio.
DR   Ensembl-Tr; ENSDART00000061716; danio_rerio.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Harvard
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCY Plate: 2 Row: J Column: 19.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..999
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_38"
FT                   /clone="MGC:194133 IMAGE:9038133"
FT                   /tissue_type="Pooled, Harvard Zebrafish Pool, whole embryo
FT                   5 somites, whole embryo 20 hpf, whole embryo 24 hpf, whole
FT                   embryo 48 hpf, whole adult fish"
FT                   /note="Vector: pCR4-TOPO reverse; Clone identification
FT                   sequence tag: GGTGGCTG"
FT                   /db_xref="taxon:7955"
FT   gene            1..999
FT                   /gene="hlxb9la"
FT                   /note="synonym: mnr2a"
FT   CDS_pept        30..959
FT                   /codon_start=1
FT                   /gene="hlxb9la"
FT                   /product="homeo box HB9 like a"
FT                   /db_xref="GOA:B3DHA2"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:B3DHA2"
FT                   /db_xref="ZFIN:ZDB-GENE-040415-1"
FT                   /protein_id="AAI62717.1"
FT                   /translation="MDKSKNFRIDALLSESSQQIVRGDSPGLCSEGVDVDMCKRTENSL
FT                   PRAFQLQTGVIPKPGMLNISHPGLTSLSQGSMPGMYPSPMYSITALGAQHPSFAYSGFT
FT                   QPYPDHLKAAAMAGSLPLEHWLRAGLIMPRLADYSGAPQSGLIGKCRRPRTAFTSQQLL
FT                   ELENQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSRKAKEQAAQLETDG
FT                   CKSGKRGNKPKDLSRCSAHDEDEDLDPEEEAEEDEEEFRRSINVGVSLPRHSDFLQHSS
FT                   ALSYSSHGSYSDDDLEEIGADRKIRLGL"
XX
SQ   Sequence 999 BP; 268 A; 260 C; 263 G; 208 T; 0 other;
     cgcgctcttg attctgaaag tttgccttca tggataagtc gaagaacttt cggatagacg        60
     ctctgctgtc ggaaagctct cagcagatcg tgcgcggcga ttccccggga ctgtgcagtg       120
     aaggtgttga tgtcgacatg tgcaaacgga cagaaaactc tcttcctcgc gcttttcagc       180
     tccagacagg ggtcataccc aaaccgggca tgctaaatat ttctcatcca ggattaacct       240
     cactttctca agggtctatg ccaggaatgt atccatcgcc aatgtactcc atcacggcac       300
     tgggagcgca gcatcccagc ttcgcgtact ctggtttcac gcagccgtat ccggatcacc       360
     tgaaagcggc tgccatggcc ggttcattac cgctggagca ctggctgcgt gcgggactca       420
     taatgcctcg ccttgcagac tacagcgggg cacctcagtc tggactgatt ggaaagtgcc       480
     ggagaccacg cacagccttc accagccagc aactcctgga gctggaaaat cagttcaaac       540
     tcaacaagta tctatcaaga cccaagcgct ttgaagtggc cacatctctc atgctgactg       600
     agacacaggt aaagatttgg ttccagaacc ggcgaatgaa atggaagcgc agccgtaaag       660
     ctaaagagca ggctgcgcaa ctggaaacag acgggtgtaa atctggcaag agaggaaaca       720
     agcccaaaga cctgagccgc tgcagtgcac atgacgaaga tgaggatctg gacccagagg       780
     aggaagccga agaagacgaa gaggagttca gacgatctat taatgtaggt gtgagtctac       840
     ctcgccattc agacttcctg cagcacagct cagcactgag ctacagctct catggctctt       900
     actctgacga cgacctggaa gaaattggag cagaccgaaa gatcaggcta gggttataag       960
     gaatcaaagg ctactttagt ctgcgtgtcc actggtgaa                              999
//

If you have problems or comments...

PBIL Back to PBIL home page