(data stored in ACNUC23390 zone)

EMBL: BC163315

ID   BC163315; SV 1; linear; mRNA; STD; VRT; 1152 BP.
XX
AC   BC163315;
XX
DT   14-JUN-2008 (Rel. 96, Created)
DT   05-AUG-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Danio rerio homeo box HB9 like b, mRNA (cDNA clone MGC:194669
DE   IMAGE:9038573), complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1152
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1152
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (03-APR-2008) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3e7bcfa86185f4563b582b96586f2cc4.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Harvard
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCY Plate: 4 Row: M Column: 3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1152
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_38"
FT                   /clone="MGC:194669 IMAGE:9038573"
FT                   /tissue_type="Pooled, Harvard Zebrafish Pool, whole embryo
FT                   5 somites, whole embryo 20 hpf, whole embryo 24 hpf, whole
FT                   embryo 48 hpf, whole adult fish"
FT                   /note="Vector: pCR4-TOPO reverse; Clone identification
FT                   sequence tag: AGCCGATT"
FT                   /db_xref="taxon:7955"
FT   gene            1..1152
FT                   /gene="hlxb9lb"
FT                   /note="synonym: mnr2b"
FT   CDS_pept        64..1050
FT                   /codon_start=1
FT                   /gene="hlxb9lb"
FT                   /product="hlxb9lb protein"
FT                   /db_xref="GOA:B3DJ06"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:B3DJ06"
FT                   /db_xref="ZFIN:ZDB-GENE-040415-2"
FT                   /protein_id="AAI63315.1"
FT                   /translation="MEKSKNFRIDALLAEEPHRGSREVSPGLSSDSPTGSPVSCRRGDT
FT                   PSPRGTPGAIHLQPGIIPKPGLLNLPHPGLTSIPGMYTTPMYPISALGGQHPALAYSGF
FT                   TQLTQPYPEQLKAAAMAGSLPLEHWIRAGIMVPRLPDYTCEWGSIQMTAPQSGLMGKCR
FT                   RPRTAFTSQQLLELENQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSRK
FT                   AKEQAAQVEVERQRGGTKPSGRDSRRAPAAPSVEEQEEEEEEEEEIDEDEEDEEDGQHK
FT                   FINNSLSVSRSTDFLHHTAALYHPDSPFSEDDIEELHGGERKIRAGL"
XX
SQ   Sequence 1152 BP; 317 A; 305 C; 321 G; 209 T; 0 other;
     tgcgcgtaaa acgcagctat cagcgcaatt acctgcaact ctaaacacaa caaaagtggt        60
     gcaatggaaa agtcaaagaa cttcaggatc gacgcccttt tagctgaaga accacatcga       120
     gggagccgag aagtttcccc tggactaagc agcgacagcc cgactgggag tccggtgtcc       180
     tgcaggcgcg gtgacacccc gtccccccgc gggaccccag gtgccataca cctccaaccc       240
     gggatcatac cgaaaccagg gctgctcaat ctccctcacc cgggactcac ttctatccca       300
     ggcatgtaca cgacgcccat gtaccccatt tcagcattgg gaggtcagca ccctgcacta       360
     gcgtactctg ggttcaccca gctgacgcag ccgtacccgg agcagctgaa ggcggcggcg       420
     atggccggat cattaccgct ggagcattgg atacgagctg gcatcatggt accacgactg       480
     cccgattaca cctgtgagtg gggtagcatt cagatgactg cccctcagtc tggtttgatg       540
     ggtaaatgtc gaaggcctcg gacagcattt actagtcaac aactactgga gctggaaaac       600
     cagtttaaac ttaataaata cctttccaga cccaaacgct tcgaagtggc cacatctcta       660
     atgctgactg agacacaggt gaagatctgg ttccagaacc ggcggatgaa gtggaagcgc       720
     agtcgtaaag ctaaagagca ggcggcgcag gtggaggtgg agcgacagcg cggaggaacc       780
     aaacccagcg gacgggacag cagacgcgct ccagcagctc ccagtgtgga ggaacaggag       840
     gaagaggagg aggaggaaga ggaaatagat gaagacgaag aggacgaaga ggatggacaa       900
     cacaagttca tcaacaacag cctcagcgtg tcccgatcca cagactttct gcaccacact       960
     gctgcgttat atcatcccga cagccccttc tcggaggacg acatagagga gctgcatgga      1020
     ggagagagga agatccgggc agggttatga agacttgttt aaatgactat ggaactttga      1080
     ctctatggta gcattagggg taaatatcag ccagcctttt agacacttat cagtgatggc      1140
     actggacatt gg                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page