(data stored in ACNUC13479 zone)

EMBL: BC164607

ID   BC164607; SV 1; linear; mRNA; STD; VRT; 868 BP.
XX
AC   BC164607;
XX
DT   24-AUG-2008 (Rel. 96, Created)
DT   04-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Danio rerio zgc:92746, mRNA (cDNA clone MGC:191782 IMAGE:100060091),
DE   complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-868
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-868
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-APR-2008) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ebb2be121f1efa2ed08b4a9edce8cd83.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Genecopoeia
CC   cDNA Library Preparation: GeneCopoeia, Inc
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: (null)
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: OCAF Plate: 7 Row: h Column: 8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..868
FT                   /organism="Danio rerio"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_50"
FT                   /clone="MGC:191782 IMAGE:100060091"
FT                   /tissue_type="PCR rescue, ZGC template clones."
FT                   /note="Vector: pENTR221, with TAG stop codon"
FT                   /db_xref="taxon:7955"
FT   gene            1..868
FT                   /gene="zgc:92746"
FT                   /note="synonyms: wu:fk57h10, zgc:111820"
FT   CDS_pept        35..835
FT                   /codon_start=1
FT                   /gene="zgc:92746"
FT                   /product="zgc:92746 protein"
FT                   /db_xref="GOA:Q502T9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q502T9"
FT                   /db_xref="ZFIN:ZDB-GENE-040718-311"
FT                   /protein_id="AAI64607.1"
FT                   /translation="MEERVDLDLEDFSSEPFLETFLKEIQNEDAVFLVGIFVALALVIL
FT                   TIVFFGNFWGSSKVRNAVLLLGLCDSGKTLLFTRLLLGKFVRTQTSITESSATYKSKSE
FT                   RGSSWTLIDVPGHESLRTQIVEKYKDVARAIVFVVDSSTFQKDVRDVAEFLYSILTDSI
FT                   LAKNAPTLVVACNKQDITMAKSAKLIQQQLEKELNTLRLTRSAALSSQDGAVGGSVYLG
FT                   KKGKDFEFSQLANRVEFIECKARGSKTKDGDADIDALEKCLAKL"
XX
SQ   Sequence 868 BP; 232 A; 186 C; 240 G; 210 T; 0 other;
     gtacaaaaaa gcaggcttga aggaattcgg taccatggag gaaagggttg atctggattt        60
     agaggatttc tcttcagagc cgtttttgga aacgttcttg aaagagatcc agaatgaaga       120
     cgctgttttc ctcgtcggga tatttgtagc attggcgctt gtgattctca ctatcgtttt       180
     ctttgggaat ttttggggct ccagtaaagt gaggaatgca gtgctgttgc tgggactgtg       240
     tgactccggg aagactcttc tgttcactcg attattacta ggaaagtttg tacgaactca       300
     gacgtccatc acagagagca gtgccacata caagagcaaa agtgagagag gcagcagttg       360
     gacccttatc gatgttcctg gtcatgaaag tttaagaact cagattgttg agaagtacaa       420
     ggatgtggca cgagccatcg tgttcgtggt ggacagcagc accttccaga aggatgtcag       480
     agatgtggct gagtttctct actccatcct cacagacagc atcctggcca aaaatgcccc       540
     aacactggtg gtggcctgca acaaacaaga tatcacgatg gccaaatctg ccaaattaat       600
     tcagcagcag ctagagaagg agttgaacac actgagactg acccgctcgg cagcgctctc       660
     ctctcaggac ggggcggtcg ggggctcggt gtacttaggg aagaaaggca aagatttcga       720
     gttctctcag ttggccaatc gggtggagtt catcgagtgc aaagccagag gaagcaaaac       780
     caaggatgga gatgctgaca ttgatgctct ggagaagtgc ctagccaaac tctagctcga       840
     gtgcggccgc aacccagctt tcttgtac                                          868
//

If you have problems or comments...

PBIL Back to PBIL home page