(data stored in ACNUC4305 zone)

EMBL: BC167139

ID   BC167139; SV 1; linear; mRNA; STD; VRT; 898 BP.
XX
AC   BC167139;
XX
DT   06-MAY-2008 (Rel. 95, Created)
DT   18-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Xenopus tropicalis transmembrane 4 L six family member 1, mRNA (cDNA clone
DE   IMAGE:7877238), partial cds.
XX
KW   .
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-898
RX   DOI; 10.1002/dvdy.10174.
RX   PUBMED; 12454917.
RA   Klein S.L., Strausberg R.L., Wagner L., Pontius J., Clifton S.W.,
RA   Richardson P.;
RT   "Genetic and genomic tools for Xenopus research: The NIH Xenopus
RT   initiative";
RL   Dev. Dyn. 225(4):384-391(2002).
XX
RN   [2]
RP   1-898
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [3]
RC   NIH-MGC Project
RP   1-898
RA   Klein S., Gerhard D.S.;
RT   ;
RL   Submitted (03-MAY-2008) to the INSDC.
RL   National Institutes of Health, Xenopus Gene Collection (XGC), National
RL   Institute of Child Health and Human Development, 6100 Executive Boulevard,
RL   Room 4B01, Rockville, MD 20892-7510, USA
XX
DR   MD5; aee4145a6832792ac397db83870f59a1.
DR   Ensembl-Gn; ENSXETG00000016042; xenopus_tropicalis.
DR   Ensembl-Tr; ENSXETT00000063286; xenopus_tropicalis.
XX
CC   Contact: XGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Robert M. Grainger
CC   cDNA Library Preparation: Bruce Blumberg Laboratory, University of
CC   California, Irvine
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 345 Row: c Column: 24
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Similarity but not
CC   identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..898
FT                   /organism="Xenopus tropicalis"
FT                   /lab_host="ElectroMAX DH10B T1 Phage Resistent cells"
FT                   /strain="N6 (Nigerian 6th generation inbred)"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_XGC_tropSki1"
FT                   /clone="IMAGE:7877238"
FT                   /tissue_type="Skin, adult, strain N6 (Nigerian 6th
FT                   generation inbred)"
FT                   /note="Vector: pCS107"
FT                   /db_xref="taxon:8364"
FT   gene            <1..898
FT                   /gene="tm4sf1"
FT   CDS_pept        <1..572
FT                   /codon_start=3
FT                   /gene="tm4sf1"
FT                   /product="tm4sf1 protein"
FT                   /db_xref="GOA:B2RZF7"
FT                   /db_xref="InterPro:IPR008661"
FT                   /db_xref="UniProtKB/TrEMBL:B2RZF7"
FT                   /protein_id="AAI67139.1"
FT                   /translation="LILAIFCIAANILLFFPNGETQYASQNHLSRFVWFFHGIGGAGLL
FT                   MLLPAGVFIGLENEDCCGCCGNERCGKSCAMLSSILAALIGVAGAGYCVVISALGLAEG
FT                   PLCLNNNQWSYAFESTNGKYLTDYQSWSTCTEPRNVVVWNVTLFSILLGLSGIQVILCL
FT                   IQIINGLIGGICGVWCCQDSQQSYAC"
XX
SQ   Sequence 898 BP; 230 A; 156 C; 214 G; 298 T; 0 other;
     ttctcattct ggcaatattc tgcattgctg caaacatttt actttttttt cccaatggag        60
     agacccagta tgcttcacag aaccacttga gtagatttgt atggttcttc catggaattg       120
     gtggtgcagg gctactgatg ctgcttccag caggagtatt cattgggctg gaaaatgagg       180
     attgctgtgg atgctgcggc aatgagagat gtgggaaaag ctgtgcaatg ctgtcctcta       240
     ttttggctgc attaattggg gttgctggag ctggatactg tgttgttatt tctgcactgg       300
     gcttagctga ggggccactg tgtttgaaca ataaccagtg gtcttatgca ttcgaaagca       360
     ctaatgggaa atatctgaca gattatcagt cctggtccac atgcactgag ccaaggaatg       420
     ttgttgtgtg gaacgttact ctgttttcca tacttctggg tctgtctgga atccaggtca       480
     tcctgtgcct cattcagatc attaatggtt taattggtgg gatttgtggt gtgtggtgct       540
     gccaagattc acaacagtcc tacgcttgct gagtcatgca agactttggc tgacccaaga       600
     aattgcactg atgaagaaca gacttgtgta tttgtttaaa ttctaatgta tagaattgta       660
     tgatttgtca tctactttat actggatgga accaaagact gtcagtgagt acagcagaag       720
     aaccatttgt cagagtgtaa agaacatgga tacaatgagc tcctactctc cccacatctg       780
     ttctactgtg tgcgaatagg gtggggtatt ttgcatcaac attgtttgtt tgtttctttt       840
     ttatttaata ttgtcttatt atgaatacaa taaatgctgt attagaaaga aaaaaaaa         898
//

If you have problems or comments...

PBIL Back to PBIL home page