(data stored in ACNUC16935 zone)

EMBL: BC167447

ID   BC167447; SV 1; linear; mRNA; STD; VRT; 1627 BP.
XX
AC   BC167447;
XX
DT   06-JUN-2008 (Rel. 96, Created)
DT   05-AUG-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Danio rerio zgc:172187, mRNA (cDNA clone MGC:172187 IMAGE:8745072),
DE   complete cds.
XX
KW   MGC.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1627
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1627
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-JUN-2008) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 9279af83a59e8ca8ad7e1d7085db5b03.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Dr. David W. Barnes
CC   cDNA Library Preparation: Open Biosystems
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 310 Row: k Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis, Similarity but not identity to protein.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1627
FT                   /organism="Danio rerio"
FT                   /lab_host="T1-resistant E.coli DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_ZGC_32"
FT                   /clone="MGC:172187 IMAGE:8745072"
FT                   /tissue_type="Embryo cell line, ZEM-2 S, 5 hrs
FT                   postfertilization ~ 1000 cell blastula, mixed sex,
FT                   wildtype"
FT                   /note="Vector: pExpress1"
FT                   /db_xref="taxon:7955"
FT   gene            1..1627
FT                   /gene="zgc:172187"
FT                   /note="synonyms: Ubi-p63E, ubc, zUBC, im:6892314"
FT   CDS_pept        48..1424
FT                   /codon_start=1
FT                   /gene="zgc:172187"
FT                   /product="zgc:172187 protein"
FT                   /db_xref="GOA:B3DLH2"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:B3DLH2"
FT                   /db_xref="ZFIN:ZDB-GENE-050411-10"
FT                   /protein_id="AAI67447.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI
FT                   PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEP
FT                   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGSD
FT                   "
XX
SQ   Sequence 1627 BP; 506 A; 413 C; 360 G; 348 T; 0 other;
     atcagtttca ggagccgtac tgttccgttt caacgcaaat attaacgatg cagatctttg        60
     tcaaaaccct tactggtaag accatcaccc tcgaggtaga gccaagtgac accattgaga       120
     acgtcaaggc caaaatccaa gacaaagaag gcattccccc tgaccagcag aggttgatct       180
     ttgctggcaa acagctagaa gatggccgca ccctgtccga ctacaacatc cagaaagagt       240
     ccaccttgca tctggtgttg cgtctcaggg gaggcatgca gatctttgtt aagaccttga       300
     caggaaagac catcaccctc gaggtagagc caagtgacac cattgagaac gtcaaggcca       360
     aaatccaaga caaagaaggc attccccctg accagcagag gttgatcttt gctggcaaac       420
     agctagaaga tggccgcacc ctgtccgact acaacatcca gaaagagtcc accttgcatc       480
     tggtgctgcg tcttagagga ggcatgcaga tctttgtaaa aaccttgaca ggaaagacca       540
     tcaccctcga ggtagagcca agcgacacca ttgagaatgt caaggccaaa atccaagaca       600
     aagaaggcat tccccctgac cagcagaggt taatctttgc tggcaaacag ctagaagatg       660
     gccgcaccct gtctgactac aacatccaga aagagtccac cttgcatctg gtgttgcgtc       720
     tcaggggagg catgcagatc ttcgttaaga ccttgacagg aaagaccatc accctcgagg       780
     tagagccaag tgacaccatt gagaacgtca aggccaaaat ccaagacaaa gaaggcattc       840
     cccctgacca gcagaggttg atctttgccg gcaaacagct agaagatggc cgcaccctgt       900
     ctgactacaa catccagaaa gagtccacct tgcatctggt gctgcgtctc aggggaggca       960
     tgcagatctt cgttaagacc ttgacaggaa agaccataac tcttgaggta gagccaagcg      1020
     acaccattga gaacgtcaag gccaaaatcc aagacaaaga aggcattccc cctgaccagc      1080
     agaggttgat ctttgctgga aaacagctag aagatggacg caccctgtcc gactacaaca      1140
     tccagaaaga gtccaccttg catctggtgt tgcgtctcag gggaggcatg cagattttcg      1200
     ttaaaacctt gacaggaaag accatcaccc tcgaggtaga gccaagtgac accattgaga      1260
     acgtcaaggc caaaatccaa gacaaagaag gcattccccc tgaccagcag aggttgatct      1320
     ttgctggtaa acagctagaa gatggccgca ccttgtctga ttacaacatc cagaaagagt      1380
     ctactttgca ccttgtgctg cgtctccgag gaggctcaga ttagaaccga cagtcttagg      1440
     gatggacatt aaattctcag tatcccctgc ttatgcactc accacttttt cccattattt      1500
     tattcatgtt gtgttgctaa atccaactac attcgtatta ccatgttctt tcatttgttt      1560
     ttttttatct cagctgtcaa aataaaagca ttgaaataca aaaaaaaaaa aaaaaaaaaa      1620
     aaaaaaa                                                                1627
//

If you have problems or comments...

PBIL Back to PBIL home page