(data stored in ACNUC8465 zone)

EMBL: BC170979

ID   BC170979; SV 1; linear; mRNA; STD; VRT; 1442 BP.
XX
AC   BC170979;
XX
DT   29-DEC-2008 (Rel. 98, Created)
DT   29-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Xenopus tropicalis hypothetical protein LOC549042, mRNA (cDNA clone
DE   MGC:197706 IMAGE:9040238), complete cds.
XX
KW   MGC.
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-1442
RX   DOI; 10.1002/dvdy.10174.
RX   PUBMED; 12454917.
RA   Klein S.L., Strausberg R.L., Wagner L., Pontius J., Clifton S.W.,
RA   Richardson P.;
RT   "Genetic and genomic tools for Xenopus research: The NIH Xenopus
RT   initiative";
RL   Dev. Dyn. 225(4):384-391(2002).
XX
RN   [2]
RP   1-1442
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [3]
RC   NIH-MGC Project
RP   1-1442
RA   Klein S., Gerhard D.S.;
RT   ;
RL   Submitted (12-NOV-2008) to the INSDC.
RL   National Institutes of Health, Xenopus Gene Collection (XGC), National
RL   Institute of Child Health and Human Development, 6100 Executive Boulevard,
RL   Room 4B01, Rockville, MD 20892-7510, USA
XX
DR   MD5; e2562261607ae7234665cb5428946427.
XX
CC   Contact: XGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Mustafa K. Khokha, Yale University School of
CC   Medicine
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRBJ Plate: 2 Row: B Column: 12.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1442
FT                   /organism="Xenopus tropicalis"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_XGC_10"
FT                   /clone="MGC:197706 IMAGE:9040238"
FT                   /tissue_type="Neurula,ovary"
FT                   /note="Vector: pCR4-TOPO reverse; Clone identification
FT                   sequence tag: TCCTAGCT"
FT                   /db_xref="taxon:8364"
FT   gene            1..1442
FT                   /gene="LOC549042"
FT   CDS_pept        41..1387
FT                   /codon_start=1
FT                   /gene="LOC549042"
FT                   /product="hypothetical protein LOC549042"
FT                   /db_xref="GOA:Q28G43"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR034851"
FT                   /db_xref="UniProtKB/TrEMBL:Q28G43"
FT                   /protein_id="AAI70979.1"
FT                   /translation="MLLFGFGLPLDMDSQALVIRIRIPDGGAVDWTVQPATQLLFRDIL
FT                   DVIGQVLPDATTTAFEYEDEDGDRITVRSDEEMKAMLSYYCTMVLEQQGSGPLTEPLQI
FT                   YPRACKPPGKRNIHGLKVNTRAGSSSNSSPSVPDNIAGNSLKKSSAELKKILANGQINE
FT                   LDIQCRDILGHGNGGTVYKAYHVPSGKILAVKVIPLDITVELQRQIMSELEILYKCDSL
FT                   YIIGFYGAFFVENRISICTEFMDGGSLDVYRKIPEQVLGRIAVAVLKGLTYLWSLKILH
FT                   RDVKPSNMLVNTRGHVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERIAGEQYGIHSDVW
FT                   SLGISFMELALGRFPYPQIQKNHGSLMPLQILQCIVDEECPVLPLGEFSESFVHFITQC
FT                   MRKPPKERPAPEELMDHPFIVQFNDGNTEAVSMWVCRALEERRMQSGQA"
XX
SQ   Sequence 1442 BP; 370 A; 306 C; 396 G; 370 T; 0 other;
     ctcctgcgtc ccaaatgatg taacccggct acggcccggg atgctgttat ttggcttcgg        60
     cctgcctctg gacatggata gccaggctct ggttattcgg atacgaatcc ctgatggggg       120
     cgccgttgac tggacagtac agccggccac tcagttgctg ttccgggaca tcttggatgt       180
     gattggtcag gttctcccag atgcaacaac cactgccttt gagtatgaag atgaggatgg       240
     tgatcggatt acagttcgga gtgatgaaga aatgaaggcc atgttgtcat attattgcac       300
     catggtcctt gagcaacagg ggagtggccc tctgactgaa cctctgcaga tctatccacg       360
     tgcctgcaag cctcccggga agcggaacat acatggcctc aaggtgaaca ccagagccgg       420
     atcttccagt aacagcagtc cgtctgtgcc agacaatatt gccggcaata gcttaaagaa       480
     gtcctctgct gagctgaaga agattttggc taatggacag attaatgagc ttgatatcca       540
     gtgccgtgac attctggggc atggaaatgg agggaccgtg tataaagcat atcatgtgcc       600
     aagtgggaag attctggctg taaaggtcat cccattagat attactgtgg agctgcagag       660
     acagattatg tcagagctgg aaatcctgta caagtgcgat tctctgtaca taattgggtt       720
     ttacggagca ttttttgtgg aaaaccggat ttccatctgt actgaattta tggatggtgg       780
     atccctggat gtgtaccgga agattccaga acaggtcctt ggaagaattg ctgttgctgt       840
     attaaaaggc ttgacttacc tgtggagctt aaagatttta cacagagatg taaagccttc       900
     taacatgctg gtgaacacac gtggccatgt gaagttgtgc gactttggtg tgagcacaca       960
     gttggtgaat tctatcgcca agacgtatgt gggaacaaac gcttatatgg cgccagagcg      1020
     tattgcagga gaacagtatg gaatccactc tgatgtctgg agtttgggca tctcttttat      1080
     ggagttggcg cttggaagat tcccttatcc acagattcag aaaaaccacg gatctttaat      1140
     gccgctccag atattgcaat gcattgttga tgaggagtgt cccgtgctcc ctttgggtga      1200
     attctcagag tccttcgtac acttcattac acagtgtatg agaaagccac caaaggagag      1260
     accagcacct gaagagctaa tggatcaccc tttcattgtc cagtttaatg atggcaacac      1320
     agaagcagtg tccatgtggg tgtgccgggc actggaagag cggaggatgc aaagtggaca      1380
     ggcgtgatcc gtgtccatag tgaggatgtg aacctaatag cgagacgcac agagatcagc      1440
     gg                                                                     1442
//

If you have problems or comments...

PBIL Back to PBIL home page