(data stored in ACNUC7421 zone)

EMBL: BC171102

ID   BC171102; SV 1; linear; mRNA; STD; VRT; 1087 BP.
XX
AC   BC171102;
XX
DT   29-DEC-2008 (Rel. 98, Created)
DT   29-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Xenopus tropicalis cDNA clone MGC:197829 IMAGE:9040364, complete cds.
XX
KW   MGC.
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-1087
RX   DOI; 10.1002/dvdy.10174.
RX   PUBMED; 12454917.
RA   Klein S.L., Strausberg R.L., Wagner L., Pontius J., Clifton S.W.,
RA   Richardson P.;
RT   "Genetic and genomic tools for Xenopus research: The NIH Xenopus
RT   initiative";
RL   Dev. Dyn. 225(4):384-391(2002).
XX
RN   [2]
RP   1-1087
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [3]
RC   NIH-MGC Project
RP   1-1087
RA   Klein S., Gerhard D.S.;
RT   ;
RL   Submitted (12-NOV-2008) to the INSDC.
RL   National Institutes of Health, Xenopus Gene Collection (XGC), National
RL   Institute of Child Health and Human Development, 6100 Executive Boulevard,
RL   Room 4B01, Rockville, MD 20892-7510, USA
XX
DR   MD5; 1afc9f8867a00438c3fe842d673b5e11.
XX
CC   Contact: XGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Mustafa K. Khokha, Yale University School of
CC   Medicine
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRBJ Plate: 2 Row: G Column: 18.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1087
FT                   /organism="Xenopus tropicalis"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_XGC_14"
FT                   /clone="MGC:197829 IMAGE:9040364"
FT                   /tissue_type="Neurula,head,brain,brain whole, ovary, lung,
FT                   intestine, gastrula, tailbud, oviduct, liver, testis,
FT                   tadpole"
FT                   /note="Vector: pCR4-TOPO reverse; Clone identification
FT                   sequence tag: GCCTACCT"
FT                   /db_xref="taxon:8364"
FT   CDS_pept        254..1030
FT                   /codon_start=1
FT                   /product="Unknown (protein for MGC:197829)"
FT                   /db_xref="GOA:B7ZU46"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZU46"
FT                   /protein_id="AAI71102.1"
FT                   /translation="MNVIIQRHGTILTIGINRPEARNAVNPETASQLVEAFNQFENDPG
FT                   LTAAVLHGIGGNFCAGFDLKAIAHSTSSLNIEQDVTKGPGPMGPSRMQFSKPVIAAVSG
FT                   YAVAGGLELSLLADLRVVEKSATFGVFCRRFGVPLIDGGTVRLPKLIGLSRALDLILTG
FT                   RPVNSQEAYEFGLANRVVPDGQGLQCAIELAQNISSFPQKCMLADRASAYNSTFDASEF
FT                   ADAMQYEFDTGAKVLVEESVAGAKRFSAGEGRKGKL"
XX
SQ   Sequence 1087 BP; 320 A; 207 C; 261 G; 299 T; 0 other;
     gcctgtgacc ggaggagttt caattaaact gccttggaga aacaagcttt tcatccagga        60
     aaagagtagg aaagactctg tgcaacacta caatcctgtt attgggatgt tcatagcttc       120
     tgcattcaga ataaaattat tcacttgtca aacacattgg tgtttattaa gtaaggctgt       180
     aacttcttgg aatacttcca ctgtaaggag gctgcaagac aagtcctttg aacaatcaca       240
     acagaaagaa atgatgaatg tgataatcca gagacatgga actattctga caattggaat       300
     taacaggcca gaagccagaa atgctgtgaa tccagagaca gcttcccagc ttgttgaggc       360
     ctttaatcag tttgagaatg atccaggcct gactgcggct gtcctccatg gaataggagg       420
     aaatttctgc gctgggtttg atttaaaggc aatagcacac agtacaagct cattgaatat       480
     agagcaagat gtgactaaag gaccaggccc aatgggacct tctaggatgc agttttccaa       540
     gccagtaatt gctgctgtga gtggatatgc agtagcggga gggcttgagt tatccctttt       600
     agctgatctg cgagttgtag agaaaagtgc aacatttgga gtattttgca gacgttttgg       660
     tgtcccttta attgatggtg ggacagtaag acttcccaag ctcattgggc tttcccgtgc       720
     cctggatctt atccttacag gtcggccagt taattcccaa gaagcatatg aatttggatt       780
     agctaatcgt gtggtacctg atggccaagg cttacagtgc gctattgagt tagcacaaaa       840
     tatatcgtcc tttccacaga agtgcatgct cgctgataga gcctccgcct acaacagcac       900
     gtttgacgca tcagagtttg cagatgcaat gcagtatgaa tttgatactg gagcaaaggt       960
     tctcgtagaa gagtctgttg ctggagccaa aagatttagt gcaggagaag ggaggaaagg      1020
     aaaactataa atatttttaa taaagactga atttcagtaa attacaattg gcctcttcct      1080
     cttggct                                                                1087
//

If you have problems or comments...

PBIL Back to PBIL home page