(data stored in ACNUC7421 zone)

EMBL: BC171144

ID   BC171144; SV 1; linear; mRNA; STD; VRT; 994 BP.
XX
AC   BC171144;
XX
DT   29-DEC-2008 (Rel. 98, Created)
DT   29-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Xenopus tropicalis hypothetical protein LOC100135206, mRNA (cDNA clone
DE   MGC:197871 IMAGE:9040406), complete cds.
XX
KW   MGC.
XX
OS   Xenopus tropicalis (tropical clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana.
XX
RN   [1]
RP   1-994
RX   DOI; 10.1002/dvdy.10174.
RX   PUBMED; 12454917.
RA   Klein S.L., Strausberg R.L., Wagner L., Pontius J., Clifton S.W.,
RA   Richardson P.;
RT   "Genetic and genomic tools for Xenopus research: The NIH Xenopus
RT   initiative";
RL   Dev. Dyn. 225(4):384-391(2002).
XX
RN   [2]
RP   1-994
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [3]
RC   NIH-MGC Project
RP   1-994
RA   Klein S., Gerhard D.S.;
RT   ;
RL   Submitted (12-NOV-2008) to the INSDC.
RL   National Institutes of Health, Xenopus Gene Collection (XGC), National
RL   Institute of Child Health and Human Development, 6100 Executive Boulevard,
RL   Room 4B01, Rockville, MD 20892-7510, USA
XX
DR   MD5; fa6da7a682fe9402f1fa7ae48380d2d2.
XX
CC   Contact: XGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Mustafa K. Khokha, Yale University School of
CC   Medicine
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRBJ Plate: 2 Row: I Column: 12.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..994
FT                   /organism="Xenopus tropicalis"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_XGC_14"
FT                   /clone="MGC:197871 IMAGE:9040406"
FT                   /tissue_type="Neurula,head,brain,brain whole, ovary, lung,
FT                   intestine, gastrula, tailbud, oviduct, liver, testis,
FT                   tadpole"
FT                   /note="Vector: pCR4-TOPO reverse; Clone identification
FT                   sequence tag: GCTCCGGG"
FT                   /db_xref="taxon:8364"
FT   gene            1..994
FT                   /gene="LOC100135206"
FT   CDS_pept        88..972
FT                   /codon_start=1
FT                   /gene="LOC100135206"
FT                   /product="hypothetical protein LOC100135206"
FT                   /db_xref="GOA:B7ZU88"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZU88"
FT                   /protein_id="AAI71144.1"
FT                   /translation="MGSLVRLLVGVQRALPGSVWAVRRLSSGASEVYAARLDGSNEGIA
FT                   EIIMSRPHARNSLGKVFVSEFFDTVDNLRHDSSVRVVVVKSSIPGIFCAGADLKERAQM
FT                   DNAEVSLFVQQLRKLMSEIAALPMPTIAAVDGFALGGGLELALACDLRVAASSAKMGLI
FT                   ETTRGLLPGAGGSQRLPRLLGIGLAKELIFTGRQIDGTEAQHIGLVNDAVPQNEEGDAA
FT                   YLRALELAQEILPQAPVAVRMAKLAMNRGIEVDIASGMAIEAMCYGQVIPTKDRLEGMS
FT                   AFREKRQPHYTGK"
XX
SQ   Sequence 994 BP; 248 A; 193 C; 298 G; 255 T; 0 other;
     tcgcttttgc tttgccacat atccttactc agagttcaaa taaaacctat agtggtcact        60
     aggggcgcag tcgggtccag ttaaagtatg gggagtctag ttaggctgct tgtgggtgtg       120
     cagcgggctc tgccgggatc agtgtgggct gtgagaaggc tgagttcggg ggcaagtgaa       180
     gtatatgctg cccggctaga tggaagcaat gagggaattg cggagatcat catgtccaga       240
     cctcatgcca ggaattcact gggaaaagtg tttgtcagtg agttctttga tactgtagac       300
     aatcttcgcc atgactccag cgtccgtgta gtggttgtaa aaagtagcat acctggcata       360
     ttctgtgctg gagccgattt aaaggagcgg gcacagatgg acaatgcaga agtctcgctc       420
     tttgtgcagc agctaagaaa actgatgagt gagattgctg cgcttccaat gcccactatt       480
     gctgcagtgg atggatttgc tctgggtggt ggcctagagt tggctcttgc ttgtgatctg       540
     agggtagctg catcttcagc taaaatggga ctaattgaga ccacaagggg actacttcca       600
     ggagcaggag gatcgcagag actgccacgc ctgcttggta tcggtcttgc caaagagctt       660
     atatttactg gtcgtcagat tgatggtaca gaggcacagc atatagggct ggtgaatgat       720
     gcagtgcctc agaatgagga aggagatgct gcatacttga gagctttgga gctggctcag       780
     gaaatacttc cccaggctcc agtggctgtt aggatggcca agttggctat gaataggggc       840
     attgaggttg atattgcatc tggaatggcc attgaagcaa tgtgttatgg acaggttatt       900
     cccactaagg atcgattgga aggaatgtca gcttttcggg agaaacgcca gccacattac       960
     actggcaaat aatgccagga gattatgaaa acgc                                   994
//

If you have problems or comments...

PBIL Back to PBIL home page