(data stored in ACNUC7421 zone)

EMBL: BC172016

ID   BC172016; SV 1; linear; mRNA; STD; MUS; 2977 BP.
XX
AC   BC172016;
XX
DT   04-JAN-2009 (Rel. 98, Created)
DT   04-JAN-2009 (Rel. 98, Last updated, Version 1)
XX
DE   Mus musculus DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-linked, mRNA
DE   (cDNA clone MGC:198721 IMAGE:9054302), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2977
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2977
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-DEC-2008) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 61154fc4e356f4557df243697096e645.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Ambion
CC   cDNA Library Preparation: British Columbia Cancer Research Center
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRCK Plate: 21 Row: M Column: 2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2977
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_378"
FT                   /clone="MGC:198721 IMAGE:9054302"
FT                   /tissue_type="Brain, PCR rescued clones"
FT                   /note="Vector: pCR4-TOPO with reversed insert; Clone
FT                   identification sequence tag: CATGCGCA"
FT                   /db_xref="taxon:10090"
FT   gene            1..2977
FT                   /gene="Ddx3x"
FT   CDS_pept        46..2031
FT                   /codon_start=1
FT                   /gene="Ddx3x"
FT                   /product="Ddx3x protein"
FT                   /db_xref="GOA:B7ZWF1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:103064"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZWF1"
FT                   /protein_id="AAI72016.1"
FT                   /translation="MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASRRYIPPHLRNR
FT                   EATKGFYDKDSSGWSSSKDKDAYSSFGSRGDSRGKSSFFGDRGSGSRGRFDDRGRGDYD
FT                   GIGGRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYD
FT                   DIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMAC
FT                   AQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQI
FT                   YEEARKFSYRSRVRPCVVYGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFC
FT                   KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEY
FT                   IFLAVGRVGSTSENITQKVVWVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLED
FT                   FLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDL
FT                   PSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAFE
FT                   HHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGGSRGFGG
FT                   GGYGGFYNSDGYGGNYNSQGVDWWGN"
XX
SQ   Sequence 2977 BP; 882 A; 552 C; 746 G; 797 T; 0 other;
     tttgctcagc agcggaagac tccgatttct cggtactctt cagggatgag tcatgtggca        60
     gtggaaaatg cgctcgggct ggaccagcag tttgctggcc tagacctgaa ctcttcagat       120
     aatcagagtg gaggaagtac agcaagcagg cgttatatcc cacctcattt aaggaacaga       180
     gaagctacta aaggattcta tgacaaagac agttcagggt ggagttctag taaagataag       240
     gatgcataca gcagttttgg atcacggggt gattcaagag ggaagtctag cttctttgga       300
     gatcgtggaa gtggatcaag gggaaggttt gatgatcgtg gacggggaga ctatgatggc       360
     attggtggcc gtggagatag aagtggcttt ggcaaatttg aaagaggtgg aaatagtcgc       420
     tggtgtgaca aatcagatga agatgactgg tcaaagccac tcccaccaag tgaacgattg       480
     gaacaggaac tcttttctgg aggcaatact gggattaact ttgagaaata tgatgacatt       540
     ccagtcgaag caacaggcaa caactgtcct ccacacattg aaagtttcag tgatgtcgag       600
     atgggagaaa ttattatggg aaacattgag cttactcgtt atactcgccc aactccagtg       660
     cagaagcatg ctattcctat tatcaaagag aaaagagact tgatggcttg tgctcaaaca       720
     ggctctggaa aaactgcagc atttctcttg cccatcttga gtcagatcta tgctgatggt       780
     ccaggagaag ctctgagggc tatgaaggaa aatggaagat atggccgtcg taaacagtat       840
     ccaatctctt tggtactggc accaacgaga gaattggcag tgcagatcta tgaggaagcc       900
     agaaaattct cataccgatc tagagtccgt ccttgcgtgg tttatggtgg tgctgaaatt       960
     ggccagcaga ttcgagactt agaacgtgga tgccacttgt tagtagccac tccaggacgt      1020
     ctagtggata tgatggagag agggaagatc gggttagact tctgcaaata cctggtgtta      1080
     gatgaagctg accggatgtt agatatgggg tttgaacctc agatacgaag aatagttgaa      1140
     caagacacta tgcctccaaa aggtgtccgc cacactatga tgtttagtgc tacttttcct      1200
     aaggaaatac agatgctggc ccgtgatttc ttagatgagt acatatttct ggctgtagga      1260
     agagttgggt ctacttcaga gaacatcaca caaaaagtgg tttgggtgga ggagatagac      1320
     aaaaggtcat ttctgcttga ccttctaaat gcaacaggca aggattccct gactctagtg      1380
     tttgtggaga ccaaaaaggg ggcagattcg ctggaggatt tcttatacca tgaaggatat      1440
     gcttgtacca gtatccatgg agaccgttct cagagagata gggaagaggc ccttcaccag      1500
     ttccgctcag gaaaaagccc aattctagtg gctacagcag tagcagcaag aggactggat      1560
     atttcaaatg tgaagcatgt tattaatttt gacctgccta gtgatatcga agaatatgtg      1620
     catcgcatag gccgtacagg ccgtgtggga aaccttggtc ttgccacctc attctttaat      1680
     gaaaggaata taaatatcac aaaggattta ctggatcttc ttgttgaagc aaaacaagaa      1740
     gtgccttctt ggttagagaa catggctttt gaacaccact acaagggtag cagtcgtgga      1800
     cgttctaaga gcagtcgatt tagtggaggg tttggtgcca gagactaccg acagagtagc      1860
     ggtgccagca gttccagctt cagcagcagc cgtgcaagca gcagtcgaag tggtggaggt      1920
     ggccatggcg gcagtcgagg atttggtgga ggtggctacg gaggctttta caacagtgat      1980
     ggatatggag ggaattataa ctcccagggg gttgactggt ggggtaactg agcctgctct      2040
     gtagtaggtc accctgccaa acaagctaat atggaaacca catgtaactt agccagacta      2100
     taccttgtgt agcttcaaga actcgcagta cattaccagc tgtgattctc cactgaaatt      2160
     ttttttttaa gggagctcaa ggtcacaagt aaagatgaaa ggaacaatca gcagccctgt      2220
     ctgaaggtgg tttgaagact tcattgctgt agtttggatt aacgcccctc ccgcctaccc      2280
     ctatcccaaa ctgcatttat aattttgtga ctgaggatca tttgtttgtt aatgtactgt      2340
     gcctttaact ttagacaact ttttattttg atgtcctgtt ggctcagtaa tgctcaagat      2400
     tccaattgtt tttgacaaaa taaatttact gaacttgggc taaaatcaaa ccttggcaca      2460
     caggtgtgat acaacttaac aggaatcatc gattcatcca taaataatat aaggaaaaac      2520
     tcaagtggta gcctgtctta aggcttttga tacttgcaga ttggggaaaa acaaacaaca      2580
     aacgtcttga agcatattaa tggaattagt ttctaatgtg gcaaactgta ttaagttaaa      2640
     agttctgatt tgctcactct atcctggata ggtatttaga acctgataat agtctttaaa      2700
     caagccattc cagtcatgat gaggtgatgt atggatacat gcatacattc aaagcactgt      2760
     tctcaaagtt aatgcaagta aatacagcaa ttcctctttc aatgtttagg cagatcgtta      2820
     actatgagct agccaaatgt gggcatgtta ttacagggaa agtttaaagg tctgataact      2880
     tgaaataggt ttaggagaat tcatctactt agacttttta aatgcctgcc ataaaaaatt      2940
     gaaatggtag aatggctgac cacagcaatg accagcc                               2977
//

If you have problems or comments...

PBIL Back to PBIL home page