(data stored in ACNUC8465 zone)

EMBL: BK001232

ID   BK001232; SV 1; linear; mRNA; STD; HUM; 2042 BP.
XX
AC   BK001232;
XX
DT   22-OCT-2003 (Rel. 77, Created)
DT   10-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   TPA: Homo sapiens Ras-related small GTPase (ARHB) mRNA, complete cds.
XX
KW   Third Party Data; TPA; TPA:experimental.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2042
RX   DOI; 10.1038/sj.onc.1206638.
RX   PUBMED; 13679852.
RA   Malcolm T., Ettehadieh E., Sadowski I.;
RT   "Mitogen-responsive expression of RhoB is regulated by RNA stability";
RL   Oncogene 22(40):6142-6150(2003).
XX
RN   [2]
RP   1-2042
RA   Sadowski I.;
RT   ;
RL   Submitted (13-MAR-2003) to the INSDC.
RL   Biochemistry and Molecular Biology, University of British Columbia, 2146
RL   Health Sciences Mall, Vancouver, BC V6T 1Z3, Canada
XX
DR   MD5; d908db4a01102955718f301529859287.
DR   Ensembl-Gn; ENSG00000143878; homo_sapiens.
DR   Ensembl-Tr; ENST00000272233; homo_sapiens.
XX
AH   LOCAL_SPAN      PRIMARY_IDENTIFIER   PRIMARY_SPAN   COMP
AS   1-698           BI550013.1           1-698
AS   611-1282        CB048297.1           1-672
AS   1083-2042       AL543824.1           1-960
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2042
FT                   /organism="Homo sapiens"
FT                   /chromosome="2"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..2042
FT                   /gene="ARHB"
FT                   /gene_synonym="RhoB"
FT   CDS_pept        396..986
FT                   /codon_start=1
FT                   /gene="ARHB"
FT                   /gene_synonym="RhoB"
FT                   /product="Ras-related small GTPase"
FT                   /db_xref="GOA:P62745"
FT                   /db_xref="HGNC:HGNC:668"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2FV8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62745"
FT                   /protein_id="DAA01138.1"
FT                   /translation="MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVAD
FT                   IEVDGKQVELALWDTAGQEDYDQLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVK
FT                   HFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKT
FT                   KEGVREVFETATRAALQKRYGSQNGCINCCKVL"
XX
SQ   Sequence 2042 BP; 389 A; 617 C; 624 G; 407 T; 5 other;
     agcggatctg ccaccgcagt ctggttggag ctgttgtctt gtatgctcag cgaggcccgg        60
     agagacccgg gagagagcta ggccgagtcc accgcccgag tctgctgccc gagcccgcgt       120
     tacgcacaaa gccgccgatc cccggcctgg ggtgagcaga gcgaccaccg cccgggagca       180
     gcgcggcgag acgcacggtg cgccctatgc ccccgcgccc ccaccgcccc cgccgcggca       240
     gccgaagcgc agcgagagaa cgcgccaccg cggggcccgg gtgcagctag cgaccctctc       300
     gccacctgcg cgcagcccga ggtgagcagt gagcggcgag cgggagggca gcgaggcgtt       360
     cgcgggcccc ctcctgctgc ccgggcccgg ccgtcatggc ggccatccgc aagaagctgg       420
     tggtggtggg cgacggcgcg tgtggcaaga cgtgcctgct gatcgtgttc agtaaggacg       480
     agttccccga ggtgtacgtg cccaccgtct tcgagaacta tgtggccgac attgaggtgg       540
     acggcaagca ggtggagctg gcgctgtggg acacggcggg ccaggaggac tacgaccagc       600
     tgcggccgct ctcctacccg gacaccgacg tcattctcat gtgcttctcg gtggacagcc       660
     cggactcgct ggagaacatc cccgagaagt gggtccccga ggtgaagcac ttctgtccca       720
     atgtgcccat catcctggtg gccaacaaaa aagacctgcg cagcgacgag catgtccgca       780
     cagagctggc ccgcatgaag caggaacccg tgcgcacgga tgacggccgc gccatggccg       840
     tgcgcatcca agcctacgac tacctcgagt gctctgccaa gaccaaggaa ggcgtgcgcg       900
     aggtcttcga gacggccacg cgcgccgcgc tgcagaagcg ctacggctcc cagaacggct       960
     gcatcaactg ctgcaaggtg ctatgagggc cgcgcccgtc gcgcctgccc ctgccggcac      1020
     ggctccccct cctggaccag tcccccgcga gcccggagaa ggggagaccc gtgtcccaca      1080
     aggaccccac cggcctgcct ggcatctgtc tgctgacgcc tctggcttgc gccaggactt      1140
     ggcgtgggca ccgggcgccc ccatcccagt gtctgtgtgc gtccagctgt gttgcacagg      1200
     cctgggctcc ccactgagtg ccaagggtcc cctgagcatg cttttctgaa gagccgggcc      1260
     tcagagtgtg tggctgtgtg tctgttcgac thccctckcc ccattttcac cccacccccg      1320
     cctctgatcc ccgggggcga gattggcgcg ggagtktggc cgcgccccat cagatgttct      1380
     yccttcacca gcgggagctt gatatccctt gtctgtaaca tagaccccgg gtactgcggg      1440
     aggggagggc tgctggggag gatgggggga tgttatataa atatagatat aattttattt      1500
     tcggagctaa gatggtgtta tttaagggtg gtgatgggtg agcgctctgg cccaggctgg      1560
     gccagactcc cgcccaagca tgaacaggac ttgaccatct ttccaacccc tggggaagac      1620
     atttgcaact kacttgggga ggacacagct tcagcacagc ctctcctgcg ggccagcccg      1680
     ctgcgaaccc tccaccagct accggaggag agagggagga tgcgctgtgg ggttgttttt      1740
     gccataagcg aactttgtgc ctgttctaga agtgaaaatt gttcagtcca agaaactgat      1800
     gttatttgat ttatttaaag gctaaaattt gtttttttat tctttgcaca attgtttcat      1860
     tgtttgacac ttaatgcact cgtcatttgc atacgacagt agcattctga ccacacttgt      1920
     acgctgtaac ctcatctact tctgatgttt ttaaaaaatg acttttaaca aggagaggga      1980
     aaagaaacca ctaaattttg ctttgtttct tgaagatgtg gcacactggt ttgtgattta      2040
     tt                                                                     2042
//

If you have problems or comments...

PBIL Back to PBIL home page