(data stored in ACNUC7820 zone)

EMBL: BK004268

ID   BK004268; SV 1; linear; genomic DNA; STD; HUM; 1038 BP.
XX
AC   BK004268;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   30-APR-2014 (Rel. 120, Last updated, Version 4)
XX
DE   TPA: Homo sapiens olfactory receptor OR19-6 gene, complete cds.
XX
KW   Third Party Data; TPA; TPA:inferential.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Proc Natl Acad Sci U S A. 2004 May 4;101(18):7205]
RP   1-1038
RX   DOI; 10.1073/pnas.0307882100.
RX   PUBMED; 14983052.
RA   Malnic B., Godfrey P.A., Buck L.B.;
RT   "The human olfactory receptor gene family";
RL   Proc. Natl. Acad. Sci. U.S.A. 101(8):2584-2589(2004).
XX
RN   [2]
RP   1-1038
RA   Malnic B., Godfrey P.A., Buck L.B.;
RT   ;
RL   Submitted (02-JAN-2004) to the INSDC.
RL   Basic Sciences, Howard Hughes Medical Institute, Fred Hutchinson Cancer
RL   Research Center, 1100 Fairview Avenue N., Seattle, WA 98109-1024, USA
XX
DR   MD5; fa46f5bb9ef0aab7fe6663034a4a09b2.
DR   Ensembl-Gn; ENSG00000170923; homo_sapiens.
DR   Ensembl-Tr; ENST00000641081; homo_sapiens.
XX
AH   LOCAL_SPAN      PRIMARY_IDENTIFIER   PRIMARY_SPAN   COMP
AS   1-1038          AC011464.5           122668-123705
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1038
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>1038
FT                   /product="olfactory receptor OR19-6"
FT   CDS_pept        1..1038
FT                   /codon_start=1
FT                   /product="olfactory receptor OR19-6"
FT                   /db_xref="GOA:Q8NG99"
FT                   /db_xref="HGNC:HGNC:8466"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NG99"
FT                   /protein_id="DAA04666.1"
FT                   /translation="MPMQLLLTDFIIFSIRFIINSMEARNQTAISKFLLLGLIEDPELQ
FT                   PVLFSLFLSMYLVTILGNLLILLAVISDSHLHTPMYFFLSNLSFLDICLSTTTIPKMLV
FT                   NIQAQNRSITYSGCLTQICFVLFFAGLENCLLAAMAYDRYVAICHPLRYTVIMNPRLCG
FT                   LLILLSLLTSVVNALLLSLMVLRLSFCTDLEIPLFFCELAQVIQLTCSDTLINNILIYF
FT                   AACIFGGVPLSGIILSYTQITSCVLRMPSASGKHKAVSTCGSHLSIVLLFYGAGLGVYI
FT                   SSVVTDSPRKTAVASVMYSVFPQMVNPFIYSLRNKDMKGTLRKFIGRIPSLLWCAICFG
FT                   FRFLE"
XX
SQ   Sequence 1038 BP; 220 A; 275 C; 214 G; 329 T; 0 other;
     atgccgatgc agctgctgct tacagatttt attatctttt ccatcagatt catcatcaac        60
     agcatggaag cgagaaacca aacagctatt tcaaaattcc ttctcctggg actgatagag       120
     gatccggaac tgcagcccgt ccttttcagc ctgttcctgt ccatgtactt ggtcaccatc       180
     ctggggaacc tgctcatcct cttggctgtc atctctgact ctcacctcca cacccccatg       240
     tacttcttcc tctccaatct ctcctttttg gacatttgtt taagcacaac cacgatccca       300
     aagatgctgg tgaacatcca agctcagaat cggagcatca cgtactcagg ctgcctcacc       360
     cagatctgct ttgtcttgtt ttttgctggc ttggaaaatt gtctccttgc agcaatggcc       420
     tatgaccgct atgtggccat ttgtcacccc cttagataca cagtcatcat gaacccccgc       480
     ctctgtggcc tgctgattct tctctctctg ttgactagtg ttgtgaatgc ccttcttctc       540
     agcctgatgg tgttgaggct gtccttctgc acagacctgg aaatcccgct cttcttctgt       600
     gaactggctc aggtcatcca actcacctgt tcagacaccc tcatcaataa catcctgata       660
     tattttgcag cttgcatatt tggtggtgtt cctctgtctg gaatcatttt gtcttacact       720
     cagatcacct cctgtgtttt gagaatgcca tcagcaagtg gaaagcacaa agcagtttcc       780
     acctgtgggt ctcacctctc cattgttctc ttgttctatg gggcaggttt gggggtgtac       840
     attagttctg tggttactga ctcacctagg aagactgcag tggcttcagt gatgtattct       900
     gtgttccctc aaatggtgaa cccctttatc tatagtctga ggaataagga catgaaagga       960
     accttgagga agttcatagg gaggatacct tctcttctgt ggtgtgccat ttgctttgga      1020
     ttcaggtttc tagagtaa                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page