(data stored in ACNUC15260 zone)

EMBL: BK004288

ID   BK004288; SV 1; linear; genomic DNA; STD; HUM; 1164 BP.
XX
AC   BK004288;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   30-APR-2014 (Rel. 120, Last updated, Version 4)
XX
DE   TPA: Homo sapiens olfactory receptor OR2-1 gene, complete cds.
XX
KW   Third Party Data; TPA; TPA:inferential.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Proc Natl Acad Sci U S A. 2004 May 4;101(18):7205]
RP   1-1164
RX   DOI; 10.1073/pnas.0307882100.
RX   PUBMED; 14983052.
RA   Malnic B., Godfrey P.A., Buck L.B.;
RT   "The human olfactory receptor gene family";
RL   Proc. Natl. Acad. Sci. U.S.A. 101(8):2584-2589(2004).
XX
RN   [2]
RP   1-1164
RA   Malnic B., Godfrey P.A., Buck L.B.;
RT   ;
RL   Submitted (02-JAN-2004) to the INSDC.
RL   Basic Sciences, Howard Hughes Medical Institute, Fred Hutchinson Cancer
RL   Research Center, 1100 Fairview Avenue N., Seattle, WA 98109-1024, USA
XX
DR   MD5; ecf189ff02868eb96fabeef409a18c1e.
DR   Ensembl-Gn; ENSG00000182083; homo_sapiens.
DR   Ensembl-Tr; ENST00000402971; homo_sapiens.
XX
AH   LOCAL_SPAN      PRIMARY_IDENTIFIER   PRIMARY_SPAN   COMP
AS   1-1164          AC013469.8           112624-113787
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1164
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>1164
FT                   /product="olfactory receptor OR2-1"
FT   CDS_pept        1..1164
FT                   /codon_start=1
FT                   /product="olfactory receptor OR2-1"
FT                   /db_xref="GOA:Q6IFH4"
FT                   /db_xref="HGNC:HGNC:15041"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6IFH4"
FT                   /protein_id="DAA04686.1"
FT                   /translation="MVICKCKHTEVFYFKTQKISRSLLSPGALGSHVASLCTKTPHPSP
FT                   APLSLCLSCPAALSSCSLMFCRPAAPKHRGMSGENVTKVSTFILVGLPTAPGLQYLLFL
FT                   LFLLTYLFVLVENLAIILIVWSSTSLHRPMYYFLSSMSFLEIWYVSDITPKMLEGFLLQ
FT                   QKRISFVGCMTQLYFFSSLVCTECVLLASMAYDRYVAICHPLRYHVLVTPGLCLQLVGF
FT                   SFVSGFTISMIKVCFISSVTFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFII
FT                   LVFPLLATILSYWHITLAVLRIPSATGCWRAFSTCASHLTVVTVFYTALLFMYVRPQAI
FT                   DSQSSNKLISAVYTVVTPIINPLIYCLRNKEFKDALKKALGLGQTSH"
XX
SQ   Sequence 1164 BP; 208 A; 390 C; 250 G; 316 T; 0 other;
     atggttatat gtaaatgcaa gcacacagaa gttttctact ttaaaactca gaagatcagc        60
     agatcactgc tctctcctgg tgctctgggg agccacgtgg cctctctttg caccaaaact       120
     ccccatccaa gtccagctcc actctctctc tgcctcagct gccctgcagc cctttcctct       180
     tgctctttga tgttttgtag gcctgcagct cccaagcaca gaggcatgag tggggagaat       240
     gtcaccaagg tcagcacctt catcctggtg ggcctcccca cggccccagg gctgcagtac       300
     ctgctcttcc tcctcttcct gctcacctac ctctttgtcc tggtggagaa cctggccatc       360
     atcctcatcg tctggagcag cacctccctc cacaggccca tgtactactt tctgagctcc       420
     atgtctttcc tggagatctg gtacgtgtct gacatcaccc ccaagatgct ggagggcttc       480
     ctcctccagc agaaacgcat ctctttcgtc gggtgcatga cgcagctcta cttcttcagc       540
     tccctggtgt gcaccgagtg tgtgcttctg gcctccatgg cctacgaccg ctacgtggcc       600
     atctgccacc cgctgcgcta ccacgtcctt gtgaccccgg ggctgtgcct ccagctggtg       660
     ggcttctcct ttgtgagtgg cttcaccatc tccatgatca aggtctgttt tatctccagc       720
     gtcacgttct gtggctccaa cgtcttgaac cacttcttct gtgacatttc ccccatcctc       780
     aagctggcct gcacggactt ctccactgca gagctggtgg atttcatcct ggccttcatc       840
     atcctggtgt ttccgctcct ggccaccata ctgtcatatt ggcacatcac cctggctgtc       900
     ctgcgcatcc cctcggccac cggctgctgg agagccttct ctacctgcgc ctctcacctc       960
     accgtggtca ccgtcttcta tacagccttg cttttcatgt atgtccggcc ccaagccatt      1020
     gattcccaga gctccaacaa gctcatctct gccgtgtaca ctgttgtcac gccaataatt      1080
     aaccctttga tttactgcct gaggaacaag gaatttaagg acgccttgaa aaaggccttg      1140
     ggcttgggtc aaacttcaca ctaa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page