(data stored in ACNUC15260 zone)

EMBL: BK004447

ID   BK004447; SV 1; linear; genomic DNA; STD; HUM; 930 BP.
XX
AC   BK004447;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   30-APR-2014 (Rel. 120, Last updated, Version 4)
XX
DE   TPA: Homo sapiens olfactory receptor OR9-24 gene, complete cds.
XX
KW   Third Party Data; TPA; TPA:inferential.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Proc Natl Acad Sci U S A. 2004 May 4;101(18):7205]
RP   1-930
RX   DOI; 10.1073/pnas.0307882100.
RX   PUBMED; 14983052.
RA   Malnic B., Godfrey P.A., Buck L.B.;
RT   "The human olfactory receptor gene family";
RL   Proc. Natl. Acad. Sci. U.S.A. 101(8):2584-2589(2004).
XX
RN   [2]
RP   1-930
RA   Malnic B., Godfrey P.A., Buck L.B.;
RT   ;
RL   Submitted (02-JAN-2004) to the INSDC.
RL   Basic Sciences, Howard Hughes Medical Institute, Fred Hutchinson Cancer
RL   Research Center, 1100 Fairview Avenue N., Seattle, WA 98109-1024, USA
XX
DR   MD5; 630a42d0bb75269e3c9e51d5a3d1fc9a.
DR   Ensembl-Gn; ENSG00000171496; homo_sapiens.
DR   Ensembl-Tr; ENST00000304865; homo_sapiens.
DR   Ensembl-Tr; ENST00000641027; homo_sapiens.
XX
AH   LOCAL_SPAN      PRIMARY_IDENTIFIER   PRIMARY_SPAN   COMP
AS   1-930           AL162254.16          64838-65767    c
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..930
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>930
FT                   /product="olfactory receptor OR9-24"
FT   CDS_pept        1..930
FT                   /codon_start=1
FT                   /product="olfactory receptor OR9-24"
FT                   /db_xref="GOA:Q8NGR8"
FT                   /db_xref="HGNC:HGNC:15110"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NGR8"
FT                   /protein_id="DAA04845.1"
FT                   /translation="MERINHTSSVSEFILLGLSSRPEDQKTLFVLFLIVYLVTITGNLL
FT                   IILAIRFNPHLQTPMYFFLSFLSLTDICFTTSVVPKMLMNFLSEKKTISYAGCLTQMYF
FT                   LYALGNSDSCLLAVMAFDRYVAVCDPFHYVTTMSHHHCVLLVAFSCSFPHLHSLLHTLL
FT                   LNRLTFCDSNVIHHFLCDLSPVLKLSCSSIFVNEIVQMTEAPIVLVTRFLCIAFSYIRI
FT                   LTTVLKIPSTSGKRKAFSTCGFYLTVVTLFYGSIFCVYLQPPSTYAVKDHVATIVYTVL
FT                   SSMLNPFIYSLRNKDLKQGLRKLMSKRS"
XX
SQ   Sequence 930 BP; 202 A; 278 C; 167 G; 283 T; 0 other;
     atggaaagaa tcaaccacac cagcagtgtc tccgagttta tcctcctggg actctcctcc        60
     cggcctgagg accaaaagac actctttgtt ctcttcctca tcgtgtacct ggtcaccata       120
     acagggaacc tgctcatcat cctggccatt cgcttcaacc cccatcttca gacccctatg       180
     tatttcttct tgagttttct gtctctcact gatatttgct ttacaacaag cgttgtcccc       240
     aagatgctga tgaacttcct gtcagaaaag aagaccatct cctatgctgg gtgtctgaca       300
     cagatgtatt ttctctatgc cttgggcaac agtgacagct gccttctggc agtcatggcc       360
     tttgaccgct atgtggccgt ctgtgaccct ttccactatg tcaccaccat gagccaccac       420
     cactgtgtcc tgctggtggc cttctcctgc tcatttcctc acctccactc actcctgcac       480
     acacttctgc tgaatcgtct caccttctgt gactccaatg ttatccacca ctttctctgt       540
     gacctcagcc ctgtgctgaa attgtcctgc tcttccatat ttgtcaatga aattgtgcag       600
     atgacagaag cacctattgt tttggtgact cgttttctct gcattgcttt ctcttatata       660
     cgaatcctca ctacagttct caagattccc tctacttctg ggaaacgcaa agccttctcc       720
     acctgtggtt tttacctcac cgtggtgacg ctcttttatg gaagcatctt ctgtgtctat       780
     ttacagcccc catccaccta cgctgtcaag gaccacgtgg caacaattgt ttacacagtt       840
     ttgtcatcca tgctcaatcc ttttatctac agcctgagaa acaaagacct gaaacagggc       900
     ctgaggaagc ttatgagcaa gagatcctag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page