(data stored in ACNUC8465 zone)

EMBL: BK006938

ID   BK006938; SV 2; linear; genomic DNA; STD; FUN; 1531933 BP.
XX
AC   BK006938;
XX
PR   Project:PRJNA43747;
XX
DT   08-JUN-2010 (Rel. 105, Created)
DT   01-NOV-2019 (Rel. 142, Last updated, Version 26)
XX
DE   TPA: Saccharomyces cerevisiae S288C chromosome IV, complete sequence.
XX
KW   Third Party Data; TPA; TPA:inferential.
XX
OS   Saccharomyces cerevisiae S288C
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-1531933
RX   DOI; 10.1126/science.274.5287.546.
RX   PUBMED; 8849441.
RA   Goffeau A., Barrell B.G., Bussey H., Davis R.W., Dujon B., Feldmann H.,
RA   Galibert F., Hoheisel J.D., Jacq C., Johnston M., Louis E.J., Mewes H.W.,
RA   Murakami Y., Philippsen P., Tettelin H., Oliver S.G.;
RT   "Life with 6000 genes";
RL   Science, e1252229 274(5287):546-546(1996).
XX
RN   [2]
RP   1-1531933
RX   PUBMED; 9169867.
RA   Jacq C., Alt-Morbe J., Andre B., Arnold W., Bahr A., Ballesta J.P.,
RA   Bargues M., Baron L., Becker A., Biteau N., Blocker H., Blugeon C.,
RA   Boskovic J., Brandt P., Bruckner M., Buitrago M.J., Coster F., Delaveau T.,
RA   del Rey F., Dujon B., Eide L.G., Garcia-Cantalejo J.M., Goffeau A.,
RA   Gomez-Peris A., Zaccaria P.et.al.;
RT   "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV";
RL   Nature 387(6632 Suppl):75-78(1997).
XX
RN   [3]
RP   1-1531933
RG   Saccharomyces Genome Database
RA   ;
RT   ;
RL   Submitted (11-DEC-2009) to the INSDC.
RL   Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA
XX
RN   [4]
RC   Sequence update by submitter
RP   1-1531933
RG   Saccharomyces Genome Database
RA   ;
RT   ;
RL   Submitted (31-MAR-2011) to the INSDC.
RL   Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA
XX
RN   [5]
RC   Protein update by submitter
RP   1-1531933
RG   Saccharomyces Genome Database
RA   ;
RT   ;
RL   Submitted (04-MAY-2012) to the INSDC.
RL   Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA
XX
RN   [6]
RC   Protein update by submitter
RP   1-1531933
RG   Saccharomyces Genome Database
RA   ;
RT   ;
RL   Submitted (06-FEB-2013) to the INSDC.
RL   Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA
XX
RN   [7]
RC   Protein update by submitter
RP   1-1531933
RG   Saccharomyces Genome Database
RA   ;
RT   ;
RL   Submitted (16-JAN-2015) to the INSDC.
RL   Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA
XX
DR   MD5; 74180788027e20df3de53dcb2367d9e3.
DR   Ensembl-Gn; YDR118W-A; saccharomyces_cerevisiae.
DR   Ensembl-Gn; YDR320W-B; saccharomyces_cerevisiae.
DR   Ensembl-Gn; YDR371C-A; saccharomyces_cerevisiae.
DR   Ensembl-Scaffolds; BK006938.2:1-1531933; saccharomyces_cerevisiae.
DR   Ensembl-Scaffolds; IV:1-1531933; saccharomyces_cerevisiae.
DR   Ensembl-Tr; YDR118W-A_mRNA; saccharomyces_cerevisiae.
DR   Ensembl-Tr; YDR320W-B_mRNA; saccharomyces_cerevisiae.
DR   Ensembl-Tr; YDR371C-A_mRNA; saccharomyces_cerevisiae.
DR   EnsemblGenomes-Gn; ENSRNA049604897.
DR   EnsemblGenomes-Gn; ENSRNA049604964.
DR   EnsemblGenomes-Gn; ENSRNA049605026.
DR   EnsemblGenomes-Gn; ENSRNA049605064.
DR   EnsemblGenomes-Gn; ENSRNA049605098.
DR   EnsemblGenomes-Gn; ENSRNA049605166.
DR   EnsemblGenomes-Gn; ENSRNA049605204.
DR   EnsemblGenomes-Gn; ENSRNA049605258.
DR   EnsemblGenomes-Gn; ENSRNA049605298.
DR   EnsemblGenomes-Gn; ENSRNA049605333.
DR   EnsemblGenomes-Gn; ENSRNA049605390.
DR   EnsemblGenomes-Gn; ENSRNA049605431.
DR   EnsemblGenomes-Gn; ENSRNA049605484.
DR   EnsemblGenomes-Gn; ENSRNA049605534.
DR   EnsemblGenomes-Gn; ENSRNA049605579.
DR   EnsemblGenomes-Gn; ENSRNA049605602.
DR   EnsemblGenomes-Gn; ENSRNA049605640.
DR   EnsemblGenomes-Gn; ENSRNA049605718.
DR   EnsemblGenomes-Gn; ENSRNA049605793.
DR   EnsemblGenomes-Gn; ENSRNA049605817.
DR   EnsemblGenomes-Gn; ENSRNA049605851.
DR   EnsemblGenomes-Gn; ENSRNA049605874.
DR   EnsemblGenomes-Gn; ENSRNA049605913.
DR   EnsemblGenomes-Gn; ENSRNA049606001.
DR   EnsemblGenomes-Gn; ENSRNA049606042.
DR   EnsemblGenomes-Gn; ENSRNA049606089.
DR   EnsemblGenomes-Gn; ENSRNA049652019.
DR   EnsemblGenomes-Gn; ENSRNA049652032.
DR   EnsemblGenomes-Gn; YDL022C-A.
DR   EnsemblGenomes-Gn; YDL114W-A.
DR   EnsemblGenomes-Gn; YDL185C-A.
DR   EnsemblGenomes-Gn; YDL240C-A.
DR   EnsemblGenomes-Gn; YDL247W-A.
DR   EnsemblGenomes-Gn; YDR008C.
DR   EnsemblGenomes-Gn; YDR048C.
DR   EnsemblGenomes-Gn; YDR094W.
DR   EnsemblGenomes-Gn; YDR112W.
DR   EnsemblGenomes-Gn; YDR118W-A.
DR   EnsemblGenomes-Gn; YDR134C.
DR   EnsemblGenomes-Gn; YDR149C.
DR   EnsemblGenomes-Gn; YDR154C.
DR   EnsemblGenomes-Gn; YDR157W.
DR   EnsemblGenomes-Gn; YDR183C-A.
DR   EnsemblGenomes-Gn; YDR187C.
DR   EnsemblGenomes-Gn; YDR193W.
DR   EnsemblGenomes-Gn; YDR199W.
DR   EnsemblGenomes-Gn; YDR203W.
DR   EnsemblGenomes-Gn; YDR215C.
DR   EnsemblGenomes-Gn; YDR230W.
DR   EnsemblGenomes-Gn; YDR320W-B.
DR   EnsemblGenomes-Gn; YDR371C-A.
DR   EnsemblGenomes-Gn; YDR406W-A.
DR   EnsemblGenomes-Gn; YDR545C-A.
DR   EnsemblGenomes-Gn; snR13.
DR   EnsemblGenomes-Gn; snR47.
DR   EnsemblGenomes-Gn; snR63.
DR   EnsemblGenomes-Gn; snR84.
DR   EnsemblGenomes-Gn; tA(AGC)D.
DR   EnsemblGenomes-Gn; tD(GUC)D.
DR   EnsemblGenomes-Gn; tE(CUC)D.
DR   EnsemblGenomes-Gn; tF(GAA)D.
DR   EnsemblGenomes-Gn; tG(CCC)D.
DR   EnsemblGenomes-Gn; tG(GCC)D1.
DR   EnsemblGenomes-Gn; tG(GCC)D2.
DR   EnsemblGenomes-Gn; tI(AAU)D.
DR   EnsemblGenomes-Gn; tI(UAU)D.
DR   EnsemblGenomes-Gn; tK(CUU)D1.
DR   EnsemblGenomes-Gn; tK(CUU)D2.
DR   EnsemblGenomes-Gn; tK(UUU)D.
DR   EnsemblGenomes-Gn; tL(CAA)D.
DR   EnsemblGenomes-Gn; tL(UAA)D.
DR   EnsemblGenomes-Gn; tM(CAU)D.
DR   EnsemblGenomes-Gn; tQ(UUG)D1.
DR   EnsemblGenomes-Gn; tQ(UUG)D2.
DR   EnsemblGenomes-Gn; tQ(UUG)D3.
DR   EnsemblGenomes-Gn; tR(ACG)D.
DR   EnsemblGenomes-Gn; tR(UCU)D.
DR   EnsemblGenomes-Gn; tS(AGA)D1.
DR   EnsemblGenomes-Gn; tS(AGA)D2.
DR   EnsemblGenomes-Gn; tS(AGA)D3.
DR   EnsemblGenomes-Gn; tT(AGU)D.
DR   EnsemblGenomes-Gn; tV(CAC)D.
DR   EnsemblGenomes-Gn; tV(UAC)D.
DR   EnsemblGenomes-Gn; tX(XXX)D.
DR   EnsemblGenomes-Gn; tY(GUA)D.
DR   EnsemblGenomes-Tr; YDL022C-A.
DR   EnsemblGenomes-Tr; YDL114W-A.
DR   EnsemblGenomes-Tr; YDL185C-A.
DR   EnsemblGenomes-Tr; YDL240C-A.
DR   EnsemblGenomes-Tr; YDL247W-A.
DR   EnsemblGenomes-Tr; YDR008C.
DR   EnsemblGenomes-Tr; YDR048C.
DR   EnsemblGenomes-Tr; YDR094W.
DR   EnsemblGenomes-Tr; YDR112W.
DR   EnsemblGenomes-Tr; YDR118W-A.
DR   EnsemblGenomes-Tr; YDR134C.
DR   EnsemblGenomes-Tr; YDR149C.
DR   EnsemblGenomes-Tr; YDR154C.
DR   EnsemblGenomes-Tr; YDR157W.
DR   EnsemblGenomes-Tr; YDR183C-A.
DR   EnsemblGenomes-Tr; YDR187C.
DR   EnsemblGenomes-Tr; YDR193W.
DR   EnsemblGenomes-Tr; YDR199W.
DR   EnsemblGenomes-Tr; YDR203W.
DR   EnsemblGenomes-Tr; YDR215C.
DR   EnsemblGenomes-Tr; YDR230W.
DR   EnsemblGenomes-Tr; YDR320W-B.
DR   EnsemblGenomes-Tr; YDR371C-A.
DR   EnsemblGenomes-Tr; YDR406W-A.
DR   EnsemblGenomes-Tr; YDR545C-A.
DR   EnsemblGenomes-Tr; snR13.
DR   EnsemblGenomes-Tr; snR47.
DR   EnsemblGenomes-Tr; snR63.
DR   EnsemblGenomes-Tr; snR84.
DR   EnsemblGenomes-Tr; tA(AGC)D.
DR   EnsemblGenomes-Tr; tD(GUC)D.
DR   EnsemblGenomes-Tr; tE(CUC)D.
DR   EnsemblGenomes-Tr; tF(GAA)D.
DR   EnsemblGenomes-Tr; tG(CCC)D.
DR   EnsemblGenomes-Tr; tG(GCC)D1.
DR   EnsemblGenomes-Tr; tG(GCC)D2.
DR   EnsemblGenomes-Tr; tI(AAU)D.
DR   EnsemblGenomes-Tr; tI(UAU)D.
DR   EnsemblGenomes-Tr; tK(CUU)D1.
DR   EnsemblGenomes-Tr; tK(CUU)D2.
DR   EnsemblGenomes-Tr; tK(UUU)D.
DR   EnsemblGenomes-Tr; tL(CAA)D.
DR   EnsemblGenomes-Tr; tL(UAA)D.
DR   EnsemblGenomes-Tr; tM(CAU)D.
DR   EnsemblGenomes-Tr; tQ(UUG)D1.
DR   EnsemblGenomes-Tr; tQ(UUG)D2.
DR   EnsemblGenomes-Tr; tQ(UUG)D3.
DR   EnsemblGenomes-Tr; tR(ACG)D.
DR   EnsemblGenomes-Tr; tR(UCU)D.
DR   EnsemblGenomes-Tr; tS(AGA)D1.
DR   EnsemblGenomes-Tr; tS(AGA)D2.
DR   EnsemblGenomes-Tr; tS(AGA)D3.
DR   EnsemblGenomes-Tr; tT(AGU)D.
DR   EnsemblGenomes-Tr; tV(CAC)D.
DR   EnsemblGenomes-Tr; tV(UAC)D.
DR   EnsemblGenomes-Tr; tX(XXX)D.
DR   EnsemblGenomes-Tr; tY(GUA)D.
DR   EuropePMC; PMC5361769; 28367482.
DR   GOA; P0C5L7.
DR   GOA; P0C5M0.
DR   GOA; P0C5M1.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF01203; snR47.
DR   RFAM; RF01223; snR13.
DR   RFAM; RF01259; snR63.
DR   RFAM; RF01270; snR84.
DR   StrainInfo; 725481; 0.
DR   UniProtKB/Swiss-Prot; P0C5L7; YD18A_YEAST.
DR   UniProtKB/Swiss-Prot; P0C5M0; YD320_YEAST.
DR   UniProtKB/Swiss-Prot; P0C5M1; YD371_YEAST.
XX
CC   On Apr 18, 2011 this sequence version replaced BK006938.1.
CC   ##Genome-Annotation-Data-START##
CC   Annotation Provider :: SGD
CC   Annotation Status   :: Full Annotation
CC   Annotation Version  :: R64-2-1
CC   URL                 :: http://www.yeastgenome.org/
CC   ##Genome-Annotation-Data-END##
XX
AH   LOCAL_SPAN       PRIMARY_IDENTIFIER   PRIMARY_SPAN   COMP
AS   1-5984           Z74296.1             1-5984
AS   2954-8682        Z74295.1             1-5729
AS   7815-11656       Z74294.1             1-3842
AS   9757-16203       Z74293.1             1-6447
AS   13361-17576      Z74292.1             1-4216
AS   17227-18958      Z74291.1             1-1732
AS   18567-20634      Z74290.1             1-2068
AS   19313-22822      Z74289.1             1-3510
AS   21007-26402      Z74288.1             1-5396
AS   25877-28984      Z74287.1             1-3108
AS   28776-30656      Z74286.1             1-1881
AS   30455-32295      Z74285.1             1-1841
AS   31830-33414      Z74284.1             1-1585
AS   33235-34236      Z74283.1             1-1003
AS   33919-36796      Z74282.1             1-2879
AS   35232-38486      Z74281.1             1-3255
AS   38174-38866      Z74280.1             1-693
AS   38598-42699      Z74279.1             1-4102
AS   42245-44064      Z74278.1             1-1820
AS   43708-46270      Z74277.1             1-2563
AS   45919-51114      Z74275.1             1-5196
AS   48032-52444      Z74274.1             1-4413
AS   52174-54396      Z74273.1             1-2223
AS   54101-57264      Z74272.1             1-3164
AS   56347-60871      Z74271.1             1-4525
AS   60406-62010      Z74270.1             1-1605
AS   61802-65241      Z74269.1             1-3440
AS   65019-66492      Z74267.1             1-1474
AS   65766-67982      Z74266.1             1-2217
AS   67348-68996      Z74265.1             1-1649
AS   68607-70639      Z74264.1             1-2033
AS   70365-74445      Z74263.1             1-4081
AS   73919-77288      Z74262.1             1-3370
AS   76546-78425      Z74261.1             1-1880
AS   77967-79293      Z74260.1             1-1327
AS   79059-84269      Z74259.1             1-5211
AS   80413-86206      Z74258.1             1-5794
AS   85986-87460      Z74257.1             1-1475
AS   87227-88247      Z74256.1             1-1021
AS   87983-90175      Z74255.1             1-2193
AS   89865-92761      Z74254.1             1-2897
AS   92465-94604      Z74253.1             1-2140
AS   93746-96081      Z74252.1             1-2336
AS   95787-98474      Z74251.1             1-2688
AS   97954-99560      Z74250.1             1-1607
AS   99225-100500     Z74249.1             1-1276
AS   100422-101289    Z74248.1             1-868
AS   100664-103648    Z74247.1             1-2985
AS   103354-104916    Z74246.1             1-1563
AS   104552-106740    Z74245.1             1-2189
AS   106495-107207    Z74244.1             1-713
AS   107071-111579    Z74243.1             1-4509
AS   111030-114671    Z74242.1             1-3642
AS   114235-116320    Z74241.1             1-2086
AS   115800-117663    Z74240.1             1-1864
AS   116867-118706    Z74239.1             1-1840
AS   118518-121977    Z74238.1             1-3460
AS   121593-123864    Z74237.1             1-2272
AS   123590-125508    Z74236.1             1-1919
AS   124999-126786    Z74235.1             1-1788
AS   126450-130406    Z74233.1             1-3957
AS   130003-130870    Z74232.1             1-868
AS   130485-133436    Z74231.1             1-2952
AS   131834-135178    Z74230.1             1-3345
AS   133958-135895    Z74229.1             1-1938
AS   135437-138290    Z74228.1             1-2854
AS   137540-139521    Z74227.1             1-1982
AS   139206-141208    Z74226.1             1-2003
AS   141115-142096    Z74225.1             1-982
AS   141722-144483    Z74224.1             1-2762
AS   144224-145825    Z74223.1             1-1602
AS   145519-148190    Z74222.1             1-2672
AS   147590-149202    Z74221.1             1-1613
AS   149087-156317    Z74219.1             1-7231
AS   155641-158063    Z74218.1             1-2423
AS   157905-159603    Z74217.1             1-1699
AS   158736-160994    Z74216.1             1-2259
AS   160765-163448    Z74215.1             1-2684
AS   163155-164289    Z74214.1             1-1135
AS   164043-164986    Z74213.1             1-944
AS   164866-167358    Z74212.1             1-2493
AS   167259-170409    Z74210.1             1-3151
AS   169079-172480    Z74208.1             1-3402
AS   171931-174231    Z74207.1             1-2301
AS   174175-174917    Z74205.1             1-743
AS   174589-176772    Z74204.1             1-2184
AS   176487-178333    Z74203.1             1-1847
AS   178057-181185    Z74202.1             1-3129
AS   181040-183317    Z74201.1             1-2278
AS   183188-184924    Z74199.1             1-1737
AS   184612-188153    Z74197.1             1-3542
AS   187919-190923    Z74196.1             1-3005
AS   190587-192749    Z74195.1             1-2163
AS   192262-194570    Z74194.1             1-2309
AS   194226-198661    Z74193.1             1-4436
AS   194953-199995    Z74192.1             1-5043
AS   199742-201718    Z74191.1             1-1977
AS   201583-203038    Z74190.1             1-1456
AS   202571-205359    Z74189.1             1-2789
AS   205112-211374    Z74188.1             1-6263
AS   210562-213350    Z74187.1             1-2789
AS   212119-216528    Z74186.1             1-4409
AS   215643-217599    Z74185.1             1-1956
AS   217075-218679    Z74184.1             1-1605
AS   218368-219661    Z74183.1             1-1294
AS   219289-222426    Z74182.1             1-3138
AS   220772-224303    Z74181.1             1-3532
AS   222523-227392    Z74180.1             1-4870
AS   226752-229905    Z74179.1             1-3154
AS   228716-231023    Z74178.1             1-2308
AS   230528-232651    Z74177.1             1-2124
AS   231900-234926    Z74176.1             1-3027
AS   233888-236156    Z74175.1             1-2268
AS   235768-239018    Z74174.1             1-3251
AS   238665-240258    Z74173.1             1-1594
AS   239607-241417    Z74172.1             1-1811
AS   241198-242551    Z74171.1             1-1354
AS   241841-245132    Z74170.1             1-3292
AS   244982-245922    Z74169.1             1-941
AS   245583-246688    Z74168.1             1-1106
AS   246448-248580    Z74167.1             1-2133
AS   247683-251565    Z74165.1             1-3883
AS   251239-253994    Z74164.1             1-2756
AS   253747-255603    Z74163.1             1-1857
AS   254718-256632    Z74162.1             1-1915
AS   256531-258914    Z74161.1             1-2384
AS   258556-263312    Z74160.1             1-4757
AS   261776-264511    Z74159.1             1-2736
AS   264111-265257    Z74158.1             1-1147
AS   264965-267697    Z74157.1             1-2733
AS   267202-268920    Z74156.1             1-1719
AS   268700-270221    Z74155.1             1-1522
AS   269977-272388    Z74154.1             1-2412
AS   271902-273652    Z74153.1             1-1751
AS   273598-275147    Z74152.1             1-1550
AS   274877-276871    Z74151.1             1-1995
AS   276582-280306    Z74150.1             1-3725
AS   280166-282111    Z74149.1             1-1946
AS   281849-283418    Z74148.1             1-1570
AS   283177-284580    Z74147.1             1-1404
AS   284445-285390    Z74146.1             1-946
AS   285166-286997    Z74145.1             1-1832
AS   286696-289571    Z74144.1             1-2876
AS   289513-292780    Z74142.1             1-3268
AS   292141-293391    Z74140.1             1-1251
AS   292901-295033    Z74139.1             1-2133
AS   294760-296819    Z74138.1             1-2060
AS   296330-298416    Z74137.1             1-2087
AS   298275-300213    Z74136.1             1-1939
AS   300004-301412    Z74135.1             1-1409
AS   301000-303210    Z74134.1             1-2211
AS   302235-305236    Z74133.1             1-3002
AS   304849-306925    Z74132.1             1-2077
AS   306578-308423    Z74131.1             1-1846
AS   307790-309801    Z74130.1             1-2012
AS   309389-310641    Z74129.1             1-1253
AS   310123-312950    Z74128.1             1-2828
AS   312472-315356    Z74127.1             1-2885
AS   314749-316970    Z74126.1             1-2222
AS   316389-320667    Z74125.1             1-4279
AS   320121-322225    Z74124.1             1-2105
AS   321553-324046    Z74123.1             1-2494
AS   322989-326612    Z74122.1             1-3624
AS   326150-329835    Z74121.1             1-3686
AS   329568-330665    Z74120.1             1-1099
AS   330047-333120    Z74119.1             1-3074
AS   332941-334216    Z74117.1             1-1275
AS   333830-334834    Z74115.1             1-1005
AS   334397-336248    Z74114.1             1-1852
AS   336122-337486    Z74113.1             1-1365
AS   337302-338271    Z74112.1             1-970
AS   338071-340627    Z74111.1             1-2557
AS   340002-341618    Z74109.1             1-1617
AS   340799-344236    Z74108.1             1-3438
AS   343986-345664    Z74107.1             1-1679
AS   344954-351433    Z74106.1             1-6480
AS   347229-352876    Z74105.1             1-5648
AS   352421-355673    Z74104.1             1-3253
AS   355379-359824    Z74103.1             1-4446
AS   356760-361698    Z74102.1             1-4939
AS   361286-362671    Z74101.1             1-1386
AS   362257-363951    Z74100.1             1-1695
AS   363584-365067    Z74099.1             1-1484
AS   364818-366738    Z74097.1             1-1921
AS   365875-369770    Z74096.1             1-3894
AS   367701-371239    Z74095.1             1-3536
AS   370707-372687    Z74094.1             1-1980
AS   371762-373966    Z74093.1             1-2205
AS   373609-375679    Z74092.1             1-2071
AS   375290-376756    Z74091.1             1-1467
AS   376481-378873    Z74090.1             1-2393
AS   378456-381984    Z74088.1             1-3530
AS   381439-384600    Z74087.1             1-3162
AS   384082-387512    Z74085.1             1-3431
AS   385588-389171    Z74084.1             1-3584
AS   388902-392658    Z74083.1             1-3757
AS   392128-394216    Z74081.1             1-2089
AS   394002-397536    Z74079.1             1-3535
AS   397205-399339    Z74078.1             1-2135
AS   399130-400996    Z74077.1             1-1867
AS   400639-403694    Z74076.1             1-3056
AS   403292-405343    Z74075.1             1-2052
AS   405061-408450    Z74073.1             1-3390
AS   407207-411760    Z74072.1             1-4554
AS   409858-413952    Z74071.1             1-4095
AS   413001-415112    Z74069.1             1-2112
AS   414889-417662    Z74068.1             1-2774
AS   416709-422832    Z74067.1             1-6124
AS   420773-424208    Z74066.1             1-3436
AS   423511-426001    Z74065.1             1-2491
AS   425873-427363    Z74063.1             1-1491
AS   426935-429066    Z74062.1             1-2132
AS   427883-431107    Z74061.1             1-3225
AS   430927-432307    Z74060.1             1-1381
AS   431518-433496    Z74059.1             1-1979
AS   433233-438046    Z74056.1             1-4814
AS   433995-439908    Z74055.1             1-5914
AS   439361-441013    Z74054.1             1-1653
AS   440407-477810    Z48008.1             1-37404
AS   440755-443028    Z74053.1             1-2274
AS   470425-473156    Z74308.1             1-2732
AS   475990-478473    Z74311.1             1-2483
AS   477677-488627    Z49770.1             1-10951
AS   478200-479114    Z74312.1             1-915
AS   478759-482669    Z74313.1             1-3911
AS   480292-484162    Z74314.1             1-3871
AS   483861-485745    Z74315.1             1-1885
AS   485366-486803    Z74316.1             1-1438
AS   486445-488071    Z74317.1             1-1627
AS   488004-489507    Z74318.1             1-1504
AS   488449-503273    Z47814.1             1-14825
AS   488663-491016    Z74319.1             1-2354
AS   490897-491514    Z74320.1             1-618
AS   491145-492555    Z74321.1             1-1411
AS   492325-494648    Z74322.1             1-2324
AS   494269-497834    Z74323.1             1-3566
AS   501415-503497    Z74326.1             1-2083
AS   503267-527893    Z68196.1             1-24628
AS   503274-504098    Z74327.1             1-824
AS   512110-523210    Z74331.1             1-11101
AS   527216-531306    Z74334.1             1-4091
AS   527894-535191    Z74335.1             1-7298
AS   531779-541777    Z54075.1             1-9999
AS   541755-547918    Z49812.1             1-6165
AS   547831-588929    Z49209.1             1-41099
AS   565641-567722    Z74353.1             1-2082
AS   578160-579457    Z74359.1             1-1299
AS   579113-580686    Z74360.1             1-1574
AS   583466-584938    Z74364.1             1-1473
AS   584132-622891    Z46796.1             1-38760
AS   589403-592438    Z74368.1             1-3035
AS   589772-593892    Z74369.1             1-4120
AS   603400-607303    Z74376.1             1-3904
AS   609163-612015    Z74378.1             1-2853
AS   617171-618496    Z74383.1             1-1326
AS   618307-622111    Z74384.1             1-3805
AS   619132-625065    Z74385.1             1-5934
AS   622854-631313    Z50111.1             1-8460
AS   631241-667457    Z47746.1             1-36217
AS   665212-704024    Z48758.1             1-38813
AS   703670-741221    Z48179.1             1-37552
AS   741200-745540    Z54139.1             1-4341
AS   745514-788981    Z50046.1             1-43468
AS   787984-801614    Z47813.1             1-13631
AS   800596-839930    Z46727.1             1-39334
AS   838927-858162    Z48784.1             1-19236
AS   858126-897953    Z68194.1             1-39827
AS   897516-932101    Z48612.1             1-34586
AS   932083-962589    Z49701.1             1-30507
AS   962590-981170    Z70202.1             1-18581
AS   962590-986590    Z68329.1             1-24000
AS   979210-994241    Z74387.1             1-15032
AS   992643-996304    Z70202.1             18592-22253
AS   992754-996304    Z68290.1             1-3551
AS   995078-1030143   U51030.1             1-35066
AS   1027544-1052485  U51031.1             1-24942
AS   1051686-1095571  U28374.1             1-43887
AS   1095372-1134546  U32517.2             1-39173
AS   1133147-1172460  U51032.1             1-39313
AS   1172061-1203242  U28372.1             1-31184
AS   1202643-1244775  U28373.1             1-42133
AS   1237261-1292619  U32274.1             1-55359
AS   1291770-1370269  U33007.1             1-78500
AS   1369270-1438278  U33050.4             1-69009
AS   1437729-1509848  U33057.1             1-72119
AS   1509733-1527005  U43834.1             1-17267
AS   1526028-1531933  Z74389.1             1-5906
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1531933
FT                   /organism="Saccharomyces cerevisiae S288C"
FT                   /chromosome="IV"
FT                   /strain="S288C"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:559292"
FT   telomere        complement(1..904)
FT                   /note="TEL04L; Telomeric region on the left arm of
FT                   Chromosome IV; composed of an X element core sequence, X
FT                   element combinatorial repeats, and a terminal stretch of
FT                   telomeric repeats"
FT   rep_origin      137..1392
FT                   /note="ARS400; Autonomously Replicating Sequence"
FT   gene            1802..2953
FT                   /gene="COS7"
FT                   /locus_tag="YDL248W"
FT   mRNA            1802..2953
FT                   /gene="COS7"
FT                   /locus_tag="YDL248W"
FT                   /product="Cos7p"
FT   CDS_pept        1802..2953
FT                   /codon_start=1
FT                   /gene="COS7"
FT                   /locus_tag="YDL248W"
FT                   /product="Cos7p"
FT                   /note="Endosomal protein involved in turnover of plasma
FT                   membrane proteins; member of the DUP380 subfamily of
FT                   conserved, often subtelomeric COS genes; required for the
FT                   multivesicular vesicle body sorting pathway that
FT                   internalizes plasma membrane proteins for degradation; Cos
FT                   proteins provide ubiquitin in trans for nonubiquitinated
FT                   cargo proteins; the authentic, non-tagged protein is
FT                   detected in highly purified mitochondria in high-throughput
FT                   studies"
FT                   /db_xref="GOA:Q07788"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07788"
FT                   /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
FT                   vacuole [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0038024 cargo
FT                   receptor activity [PMID:9560393]"
FT                   /protein_id="DAA11619.1"
FT                   /translation="MKENEVKDEKSVDVLSFKQLESQKIVLPQDLFRSSFTWFCYEIYK
FT                   SLAFRIWMLLWLPLSVWWKLSNNCIYPLIVSLLVLFLGPIFVLVICGLSRKRSLSKQLI
FT                   QFCKEITENTPSSDPHDWEVVVANLNSYLYENKAWNTKNFFFNATDCEKMFRTTVLEPF
FT                   SLKKDKAAKVKSFKDSVPYIEEALQVYATGFDKQWKLFITEKSWSPVGLEDVQLPKDIH
FT                   RSKLTWFLKRIFTIYSLPLWLAFLNCICVSQHFCLAFRILCPGLFFLMMVWLFQNMRTT
FT                   ALLVKMEHKMQFLLTIINEQESGANGWDEIARKMNRYLFEKKAWKNEEFFFDGIDCEWF
FT                   FSHFFYRLLSAKKSMWLLPLNVELWPYIKEAQLSRNEESLMKK"
FT   gene            5985..7814
FT                   /gene="MPH2"
FT                   /locus_tag="YDL247W"
FT   mRNA            5985..7814
FT                   /gene="MPH2"
FT                   /locus_tag="YDL247W"
FT                   /product="alpha-glucoside permease"
FT   CDS_pept        5985..7814
FT                   /codon_start=1
FT                   /gene="MPH2"
FT                   /locus_tag="YDL247W"
FT                   /product="alpha-glucoside permease"
FT                   /note="Alpha-glucoside permease; transports maltose,
FT                   maltotriose, alpha-methylglucoside, and turanose; almost
FT                   identical to Mph3p; encoded in a subtelomeric position in a
FT                   region likely to have undergone duplication"
FT                   /db_xref="GOA:P0CD99"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CD99"
FT                   /experiment="EXISTENCE:direct assay:GO:0005363 maltose
FT                   transmembrane transporter activity [PMID:12210897]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008643 carbohydrate
FT                   transport [PMID:12210897]"
FT                   /experiment="EXISTENCE:direct assay:GO:0055085
FT                   transmembrane transport [PMID:12210897]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /protein_id="DAA11620.1"
FT                   /translation="MKNLSFLINRRKENTSDSNVYPGKAKSHEPSWIEMDDQTKKDGLD
FT                   IVHVEFSPDTRAPSDSNKVITEIFDATEDAKEADESERGMPLATALNTYPKAAAWSLLV
FT                   STTLIMEGYDTAILGAFYALPIFQRKFGSQNDKTGEWEISASWQIGLTLCYMAGEIVGL
FT                   QLTGPSVDLVGNRYTLIIALFFLAAFTFILYFCNSLGMIAVGQALCGMPWGCFQCLTVS
FT                   YASEICPLALRYYLTTYSNLCWLFGQLFAAGIMKNSQKKYADSELGYKLPFALQWILPV
FT                   PLALGIFFAPESPWWLVKKGRFDEARRSLRRTLSGKGPEKEILVTLEVDKIKVTIDKEK
FT                   RLTSKEGSYSDCFEDKINRRRTRITCLCWAGQATCGSILIGYSTYFYEKAGVSTEMSFT
FT                   FSIIQYCLGICATFLSWWASKYFGRYDLYAFGLAFQTIVFFIIGGLGCSSTHGSKMGSG
FT                   SLLMAVAFFYNLGIAPVVFCLVSEMPSSRLRTKTIILARNTYNVVSIICSVLILYQLNS
FT                   KKWNWGAKSGFFWGVLCFCTLIWAVVDLPETAGKTFVEINELFKLGVSARKFKSTKVDP
FT                   FVVKTPLKTSLITTPREISKLPLQRNSNVSHHL"
FT   gene            complement(8683..9756)
FT                   /gene="SOR2"
FT                   /locus_tag="YDL246C"
FT   mRNA            complement(8683..9756)
FT                   /gene="SOR2"
FT                   /locus_tag="YDL246C"
FT                   /product="L-iditol 2-dehydrogenase SOR2"
FT   CDS_pept        complement(8683..9756)
FT                   /codon_start=1
FT                   /gene="SOR2"
FT                   /locus_tag="YDL246C"
FT                   /product="L-iditol 2-dehydrogenase SOR2"
FT                   /EC_number="1.1.1.9"
FT                   /note="Sorbitol dehydrogenase; protein sequence is 99%
FT                   identical to the Sor1p sorbitol dehydrogenase"
FT                   /db_xref="GOA:Q07786"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07786"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0003939 L-iditol
FT                   2-dehydrogenase activity [PMID:26996892]"
FT                   /protein_id="DAA11621.1"
FT                   /translation="MSQNSNPAVVLEKVGDIAIEQRPIPTIKDPHYVKLAIKATGICGS
FT                   DIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRVAIEPGVPSRYSDET
FT                   KEGSYNLCPHMAFAATPPIDGTLVKYYLSPEDFLVKLPEGVSYEEGACVEPLSVGVHSN
FT                   KLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNS
FT                   SQFSTDKAQDLADGVQKLLGGNHADVVFECSGADVCIDAAVKTTKVGGTMVQVGMGKNY
FT                   TNFPIAEVSGKEMKLIGCFRYSFGDYRDAVNLVATGKVNVKPLITHKFKFEDAAKAYDY
FT                   NIAHGGEVVKTIIFGPE"
FT   gene            complement(11657..13360)
FT                   /gene="HXT15"
FT                   /gene_synonym="HLT2"
FT                   /locus_tag="YDL245C"
FT   mRNA            complement(11657..13360)
FT                   /gene="HXT15"
FT                   /gene_synonym="HLT2"
FT                   /locus_tag="YDL245C"
FT                   /product="hexose transporter HXT15"
FT   CDS_pept        complement(11657..13360)
FT                   /codon_start=1
FT                   /gene="HXT15"
FT                   /gene_synonym="HLT2"
FT                   /locus_tag="YDL245C"
FT                   /product="hexose transporter HXT15"
FT                   /note="Putative transmembrane polyol transporter; supports
FT                   growth on and uptake of mannitol, sorbitol and xylitol with
FT                   moderate affinity when overexpressed in a strain deleted
FT                   for hexose family members; minor hexose transport activity
FT                   when overexpressed in a similar strain; similarity to
FT                   hexose transporters; expression is induced by low levels of
FT                   glucose and repressed by high levels of glucose"
FT                   /db_xref="GOA:P54854"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54854"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0015795
FT                   sorbitol transport [PMID:26996892]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0015797
FT                   mannitol transport [PMID:26996892]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:1902341
FT                   xylitol transport [PMID:26996892]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005353 fructose
FT                   transmembrane transporter activity [PMID:10618490]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005355 glucose
FT                   transmembrane transporter activity [PMID:10618490]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0008645 hexose
FT                   transmembrane transport [PMID:10618490]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0015578 mannose
FT                   transmembrane transporter activity [PMID:10618490]"
FT                   /protein_id="DAA11622.1"
FT                   /translation="MASEQSSPEINADNLNSSAADVHVQPPGEKEWSDGFYDKEVINGN
FT                   TPDAPKRGFLGYLIIYLLCYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEY
FT                   YLSNVRMGLLVAMFSVGCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKW
FT                   YQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGT
FT                   RKYSNTAQWRIPVGLCFLWALIIIVGMLLVPESPRYLIECERHEEACVSIAKINKVSPE
FT                   DPWVLKQADEINAGVLAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFF
FT                   FYGTTIFKSVGLTDGFETSIVLGTVNFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVI
FT                   FASIGVKCLYPHGQDGPSSKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKS
FT                   KAMSISTAFNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSL
FT                   EEIQLLYEEGIKPWKSASWVPPSRRGASSRETEAKKKSWKEVLKFPKSFN"
FT   rep_origin      15493..15739
FT                   /note="ARS403; Autonomously Replicating Sequence"
FT   gene            16204..17226
FT                   /gene="THI13"
FT                   /locus_tag="YDL244W"
FT   mRNA            16204..17226
FT                   /gene="THI13"
FT                   /locus_tag="YDL244W"
FT                   /product="4-amino-5-hydroxymethyl-2-methylpyrimidine
FT                   phosphate synthase"
FT   CDS_pept        16204..17226
FT                   /codon_start=1
FT                   /gene="THI13"
FT                   /locus_tag="YDL244W"
FT                   /product="4-amino-5-hydroxymethyl-2-methylpyrimidine
FT                   phosphate synthase"
FT                   /note="Protein involved in synthesis of the thiamine
FT                   precursor HMP; member of a subtelomeric gene family
FT                   including THI5, THI11, THI12, and THI13;
FT                   hydroxymethylpyrimidine is also known as HMP"
FT                   /db_xref="GOA:Q07748"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07748"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0009228
FT                   thiamine biosynthetic process [PMID:12777485]"
FT                   /protein_id="DAA11623.1"
FT                   /translation="MSTDKITFLLNWQPTPYHIPIFLAQTKGYFKEQGLDIAILEPTNP
FT                   SDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGVLYLKGSGITEDFQ
FT                   SLKGKKIGYVGEFGKIQIDELTKHYGMKPEDYTAVRCGMNVAKYIIEGKIDAGIGIECM
FT                   QQVELEEYLAKQGRPASDAKMLRIDKLACLGCCCFCTVLYICNDEFLKKNPEKVRKFLK
FT                   AIKKATDYVLADPVKAWKEYIDFKPQLNNDLSYKQYQRCYAYFSSSLYNVHRDWKKVTG
FT                   YGKRLAILPPDYVSNYTNEYLSWPEPEEVSDPLEAQRLMAIHQEKCRQEGTFKRLALPA
FT                   "
FT   gene            complement(17577..18566)
FT                   /gene="AAD4"
FT                   /locus_tag="YDL243C"
FT   mRNA            complement(17577..18566)
FT                   /gene="AAD4"
FT                   /locus_tag="YDL243C"
FT                   /product="putative aryl-alcohol dehydrogenase"
FT   CDS_pept        complement(17577..18566)
FT                   /codon_start=1
FT                   /gene="AAD4"
FT                   /locus_tag="YDL243C"
FT                   /product="putative aryl-alcohol dehydrogenase"
FT                   /note="Putative aryl-alcohol dehydrogenase; involved in
FT                   oxidative stress response; similar to P. chrysosporium
FT                   aryl-alcohol dehydrogenase; expression induced in cells
FT                   treated with the mycotoxin patulin; members of the AAD gene
FT                   family comprise three pairs (AAD3 + AAD15, AAD6/AAD16 +
FT                   AAD4, AAD10 + AAD14) whose two genes are more related to
FT                   one another than to other members of the family"
FT                   /db_xref="GOA:Q07747"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07747"
FT                   /experiment="EXISTENCE:direct assay:GO:0047681 aryl-alcohol
FT                   dehydrogenase (NADP+) activity [PMID:29079624]"
FT                   /protein_id="DAA11624.1"
FT                   /translation="MGSMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMKS
FT                   RKLRDQIVIATKFTGDYKKYEVGGGKSANYCGNHKHSLHVSVRDSLRKLQTDWIDILYV
FT                   HWWDYMSSIEEVMDSLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSIYQGK
FT                   WNVLNRDFERDIIPMARHFGMALAPWDVMGGGRFQSKKAMEERKKNGEGLRTVSGTSKQ
FT                   TDKEVKISEALAKVAEEHGTESVTAIAIAYVRSKAKNVFPLVGGRKIEHLKQNIEALSI
FT                   KLTPEQIEYLESIIPFDVGFPTNFIGDDPAVTKKASLLTAMSAQISFD"
FT   gene            18959..19312
FT                   /locus_tag="YDL242W"
FT   mRNA            18959..19312
FT                   /locus_tag="YDL242W"
FT                   /product="hypothetical protein"
FT   CDS_pept        18959..19312
FT                   /codon_start=1
FT                   /locus_tag="YDL242W"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; conserved across S. cerevisiae
FT                   strains"
FT                   /db_xref="GOA:Q07746"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07746"
FT                   /protein_id="DAA80273.1"
FT                   /translation="MNLEESQSNRGTLNIKKILVIVCMTNKICKHLIQSLLLSKRRLVS
FT                   VLFDNYQGDMKLRSSPSAIPLVPSTKILQAMEARNDIVDSLIINSHATESDRRTLGDHE
FT                   VRQCEDTNFGFKI"
FT   gene            20635..21006
FT                   /locus_tag="YDL241W"
FT   mRNA            20635..21006
FT                   /locus_tag="YDL241W"
FT                   /product="hypothetical protein"
FT   CDS_pept        20635..21006
FT                   /codon_start=1
FT                   /locus_tag="YDL241W"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; SWAT-GFP and mCherry fusion
FT                   proteins localize to the endoplasmic reticulum; YDL241W is
FT                   not an essential gene"
FT                   /db_xref="GOA:Q07738"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07738"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:26928762]"
FT                   /protein_id="DAA11625.1"
FT                   /translation="MNVTENALLFKCGSKGYINQTYTPTEIYNCGVAEGKKTAKEKNPT
FT                   YSIFYDTFLTGQPAESPETFTCGSHGFTNASYVASDFYACGFLQGKGTETNAGIHNTRP
FT                   SHSLAKFTILFMLVLYTIV"
FT   gene            22823..25876
FT                   /gene="LRG1"
FT                   /locus_tag="YDL240W"
FT   mRNA            22823..25876
FT                   /gene="LRG1"
FT                   /locus_tag="YDL240W"
FT                   /product="Lrg1p"
FT   CDS_pept        22823..25876
FT                   /codon_start=1
FT                   /gene="LRG1"
FT                   /locus_tag="YDL240W"
FT                   /product="Lrg1p"
FT                   /note="GTPase-activating protein (GAP); contains
FT                   Rho1p-specific GAP activity, interacting with activated
FT                   forms of Rho1p; functions along with Sac7p as a negative
FT                   regulator of the Pkc1p-mediated cell wall integrity
FT                   signaling pathway; negative regulator of cell wall
FT                   1,3-beta-glucan biosynthesis; required for efficient cell
FT                   fusion; contains a RhoGAP domain and three
FT                   Lin-11-Isl1-Mec-3 (LIM) domains"
FT                   /db_xref="GOA:P35688"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35688"
FT                   /experiment="EXISTENCE:direct assay:GO:0000131 incipient
FT                   cellular bud site [PMID:11447600]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005096 GTPase
FT                   activator activity [PMID:15514049]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005934 cellular bud
FT                   tip [PMID:11447600]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005935 cellular bud
FT                   neck [PMID:11447600|PMID:23613772|PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030427 site of
FT                   polarized growth [PMID:23613772]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043332 mating
FT                   projection tip [PMID:15514049]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043547 positive
FT                   regulation of GTPase activity [PMID:15514049]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000755
FT                   cytogamy [PMID:15514049]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0035024
FT                   negative regulation of Rho protein signal transduction
FT                   [PMID:11447600|PMID:11713681]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0060237
FT                   regulation of fungal-type cell wall organization
FT                   [PMID:11447600|PMID:11713681]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0090038
FT                   negative regulation of protein kinase C signaling
FT                   [PMID:11713681]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0090334
FT                   regulation of cell wall (1->3)-beta-D-glucan biosynthetic
FT                   process [PMID:11447600]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000755 cytogamy
FT                   [PMID:15514049]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0035024 negative
FT                   regulation of Rho protein signal transduction
FT                   [PMID:11713681]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0060237
FT                   regulation of fungal-type cell wall organization
FT                   [PMID:11713681]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0090038 negative
FT                   regulation of protein kinase C signaling [PMID:11713681]"
FT                   /protein_id="DAA11626.2"
FT                   /translation="MIQNSAGYRSLNTASPMTVQVKNQKKICARCNKLVIPDSQRTKTT
FT                   LKALGKYYHESCFTCQDCQKPLKPKYFPYQVDKTSESILLCQYDYFRRHNLLCHVCDTP
FT                   LRGLYYTAFGYRYDEEHFSCTICATPCGVKKCFMYGNQLYCKYHFLKYFSKRCKGCEFP
FT                   ISDQYIEFPKGEEIHCWHPECYGIHKYWHVNLAAETVGLQYLPKLEYNPNSGDKDINPT
FT                   AYELDKQMQAFNFILSKTWSVLYRFEEEAASCISDMFQYLTSNDQLKGIESTGLLVLKI
FT                   DCLFRGLDTLNLSTNKSMPVNSDQECIENNAMAASKYSKFPKNLSTKIMIYLQLLRKLG
FT                   TENKNETITISSFMSVITGLAHFLKLLTRFGLYTALENNKLTHSVNPLLRFLREVEKNE
FT                   LFENNPFQYIKTPVNATDSCAGCNKYIQEECIQFYEHRWHIACFTCSSCHKNINPRSLT
FT                   DPTFNKEKKKILCSHCSIDDPASVPGFKFVTKLAQLIFLLKIALVKSRTVMLKSKASNK
FT                   VGRNSLQSTMLKEQTYIRTLNDIKRLRSRRESVRVTHNKQQARKSVILETAETDLNDPT
FT                   KQGDSKNLVIQTDDPSSSQQVSTRENVFSNTKTLTLDDISRIVAAEQARELRPNAFAHF
FT                   KKLKETDDETSNVVPKKSGVYYSELSTMELSMIRAISLSLLAGKQLISKTDPNYTSLVS
FT                   MVFSNEKQVTGSFWNRMKIMMSMEPKKPITKTVFGAPLDVLCEKWGVDSDLGVGPVKIR
FT                   IPIIIDELISSLRQMDMSVEGIFRKNGNIRRLRELTANIDSNPTEAPDFSKENAIQLSA
FT                   LLKKFIRELPQPILSTDLYELWIKAAKIDLEDEKQRVILLIYSLLPTYNRNLLEALLSF
FT                   LHWTSSFSYIENEMGSKMDIHNLSTVITPNILYLRHKEISNDNVPDEPESGLVDSFAQN
FT                   KGENYFLAIEIVDYLITHNEEMAMVPKFLMNLLKDVQLQKLDNYESINHFISTVMQSKT
FT                   IDYSECDIKTPVTVKDSTTTVIQGEINK"
FT   gene            complement(26403..28775)
FT                   /gene="ADY3"
FT                   /locus_tag="YDL239C"
FT   mRNA            complement(26403..28775)
FT                   /gene="ADY3"
FT                   /locus_tag="YDL239C"
FT                   /product="Ady3p"
FT   CDS_pept        complement(26403..28775)
FT                   /codon_start=1
FT                   /gene="ADY3"
FT                   /locus_tag="YDL239C"
FT                   /product="Ady3p"
FT                   /note="Protein required for spore wall formation; subunit
FT                   of leading edge protein (LEP) complex
FT                   (Ssp1-Ady3-Don1-Irc10) that forms ring-like structure at
FT                   leading edge of prospore membrane during meiosis II;
FT                   mediates assembly of LEP complex, formation of ring-like
FT                   structure via interaction with spindle pole body
FT                   components, and prospore membrane maturation; potentially
FT                   phosphorylated by Cdc28p; ADY3 has a paralog, CNM67, that
FT                   arose from the whole genome duplication"
FT                   /db_xref="GOA:Q07732"
FT                   /db_xref="InterPro:IPR021750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07732"
FT                   /experiment="EXISTENCE:direct assay:GO:0005628 prospore
FT                   membrane [PMID:11742972|PMID:11973299]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005816 spindle pole
FT                   body [PMID:11742972|PMID:11973299]"
FT                   /experiment="EXISTENCE:direct assay:GO:0070056 prospore
FT                   membrane leading edge
FT                   [PMID:11742972|PMID:11973299|PMID:24390141]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000001
FT                   mitochondrion inheritance [PMID:17905927]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000001
FT                   mitochondrion inheritance [PMID:17905927]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030435
FT                   sporulation resulting in formation of a cellular spore
FT                   [PMID:11470404]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030476
FT                   ascospore wall assembly [PMID:11973299]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0032120
FT                   ascospore-type prospore membrane assembly [PMID:11742972]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0005816
FT                   spindle pole body [PMID:11973299]"
FT                   /protein_id="DAA11627.2"
FT                   /translation="MNHWLAFLNKPESLKEQNSDCDQQGEMRHVTDGTLTKSPESKPFR
FT                   ERRSQTWIDSEVPTSTEKSNVQESISSDIISKLSNRRSRRNRSESWAGSEASSPSGNIS
FT                   TLENATEKNTLKSPNKFLQRGGLPTVGIGSQALSPAGKPSTLGNVSPGKFTTYKVHNSI
FT                   EVNRFSSTPTKLLTNPHKVAAISNDEHYVVSNESLEENIEVAHLENVFRSSKTPDEEQS
FT                   EYMKLGEIRLSSSSYGGSISKENSLPKVLDELQSQNEEIKALRQKLEEKDDRIQELEEL
FT                   NSMNDAKLQRIEDLQKEFHNERKAASKRLNIVQDRFRKEIKKIREEKITDFQNKNASKK
FT                   EKNEVTSAKTKCKAFSQRNILVSELYRKQKQILNLQQENDKFLKDINESNNSIVKLRSE
FT                   VEILKSNLQLSQDENKKLHDNGSFYEKRLNDVYSYMQNLSLFEKDLGKFILEEMKCGHS
FT                   PSMFQNGFAKLYPDFQDIKNLENMEQYKQLKGKIELLEKNDRIRLEKIISVFKLINERL
FT                   HFMQQQHSHKIKYLQKEALTKEQQFRLEKRRWHDILNLKEENFQKLKSELKEKLILSEK
FT                   IQKNAEDKLNDYMNEHQEIVEKLQNQALIASRWSTQIQESENTHKKITDELAGKQSEIL
FT                   KLEETILSLKEDVFQEKLNLKKLYGDPSTELNFETVGKSFPHITKEKYDSLGLDILTDL
FT                   TYVQSQNLIKNLLIVLDIPLKTFLKIVPTIVIQLRCELTLLTKFANDLNLKVFGKQLDF
FT                   KSRRKVAMNEFLNNHDIAEVKHPLEYDLQALFKYFFS"
FT   gene            complement(28985..30454)
FT                   /gene="GUD1"
FT                   /locus_tag="YDL238C"
FT   mRNA            complement(28985..30454)
FT                   /gene="GUD1"
FT                   /locus_tag="YDL238C"
FT                   /product="guanine deaminase"
FT   CDS_pept        complement(28985..30454)
FT                   /codon_start=1
FT                   /gene="GUD1"
FT                   /locus_tag="YDL238C"
FT                   /product="guanine deaminase"
FT                   /EC_number="3.5.4.3"
FT                   /note="Guanine deaminase; a catabolic enzyme of the guanine
FT                   salvage pathway producing xanthine and ammonia from
FT                   guanine; activity is low in exponentially-growing cultures
FT                   but expression is increased in post-diauxic and
FT                   stationary-phase cultures"
FT                   /db_xref="GOA:Q07729"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07729"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006147 guanine
FT                   catabolic process [PMID:10542258]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008892 guanine
FT                   deaminase activity [PMID:15565584]"
FT                   /protein_id="DAA11628.1"
FT                   /translation="MTKSDLLFDKFNDKHGKFLVFFGTFVDTPKLGELRIREKTSVGVL
FT                   NGIIRFVNRNSLDPVKDCLDHDSSLSPEDVTVVDIIGKDKTRNNSFYFPGFVDTHNHVS
FT                   QYPNVGVFGNSTLLDWLEKYTFPIEAALANENIAREVYNKVISKTLSHGTTTVAYYNTI
FT                   DLKSTKLLAQLSSLLGQRVLVGKVCMDTNGPEYYIEDTKTSFESTVKVVKYIRETICDP
FT                   LVNPIVTPRFAPSCSRELMQQLSKLVKDENIHVQTHLSENKEEIQWVQDLFPECESYTD
FT                   VYDKYGLLTEKTVLAHCIHLTDAEARVIKQRRCGISHCPISNSSLTSGECRVRWLLDQG
FT                   IKVGLGTDVSAGHSCSILTTGRQAFAVSRHLAMRETDHAKLSVSECLFLATMGGAQVLR
FT                   MDETLGTFDVGKQFDAQMIDTNAPGSNVDMFHWQLKEKDQMQEQEQEQGQDPYKNPPLL
FT                   TNEDIIAKWFFNGDDRNTTKVWVAGQQVYQI"
FT   gene            30657..31829
FT                   /gene="AIM6"
FT                   /locus_tag="YDL237W"
FT   mRNA            30657..31829
FT                   /gene="AIM6"
FT                   /locus_tag="YDL237W"
FT                   /product="Aim6p"
FT   CDS_pept        30657..31829
FT                   /codon_start=1
FT                   /gene="AIM6"
FT                   /locus_tag="YDL237W"
FT                   /product="Aim6p"
FT                   /note="hypothetical protein; required for respiratory
FT                   growth; YDL237W is not an essential gene"
FT                   /db_xref="GOA:Q07716"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR039559"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07716"
FT                   /protein_id="DAA11629.2"
FT                   /translation="MLGLKGCLTILIGYVIAVCALFSSRGRNPSLTDWEKLKDQKISNI
FT                   DNFGLTGQHLLEFFQENLPFLSFSEEKYRHKHVSLYYDVFKEYILRRASSKKCLPVDSA
FT                   IAKLNKDVNPMPVHSHNDYWRKLPLFEGLAYGASSTEADVWNIDEKILAVGHNEAYLDP
FT                   VELTLDKLYTGPLLEILDEVNCQDSDADRKNGVFFNSPETSLFFYIDFKSDDNELTYKL
FT                   LMEQYFKSLIDSGYLTYYDMKKDEIIWRPVTVILTGNYPTSLDILDNGNDNGYFESSQR
FT                   FAFLDAPLLSLEPKYSKLSVAATVSFSQLMKHCGSDHWKVSLRGRMDSNEISCAKSIID
FT                   GAHALKLKTRIWGAPTWPANLVETISRQIIHDLGSDLLNLDNLFMASSLI"
FT   gene            32296..33234
FT                   /gene="PHO13"
FT                   /locus_tag="YDL236W"
FT   mRNA            32296..33234
FT                   /gene="PHO13"
FT                   /locus_tag="YDL236W"
FT                   /product="4-nitrophenylphosphatase"
FT   CDS_pept        32296..33234
FT                   /codon_start=1
FT                   /gene="PHO13"
FT                   /locus_tag="YDL236W"
FT                   /product="4-nitrophenylphosphatase"
FT                   /EC_number="3.1.3.41"
FT                   /note="Conserved phosphatase acting as a metabolite repair
FT                   enzyme; shows specific dephosphorylating activity on two
FT                   side-products of central carbohydrate metabolism,
FT                   2-phosphoglycolate and 4-phosphoerythronate; alkaline
FT                   phosphatase specific for p-nitrophenyl phosphate; also has
FT                   protein phosphatase activity; human ortholog PGP shows
FT                   similar substrate specificity, deletion causes similar
FT                   metabolite accumulation phenotypes, suggesting conserved
FT                   role in eliminating glycolytic byproducts"
FT                   /db_xref="GOA:P19881"
FT                   /db_xref="InterPro:IPR006349"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19881"
FT                   /experiment="EXISTENCE:direct assay:GO:0004035 alkaline
FT                   phosphatase activity [PMID:9561742]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004721
FT                   phosphoprotein phosphatase activity [PMID:9561742]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006470 protein
FT                   dephosphorylation [PMID:9561742]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008967
FT                   phosphoglycolate phosphatase activity [PMID:27294321]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016791 phosphatase
FT                   activity [PMID:27294321]"
FT                   /experiment="EXISTENCE:direct assay:GO:0046838
FT                   phosphorylated carbohydrate dephosphorylation
FT                   [PMID:27294321]"
FT                   /protein_id="DAA11630.1"
FT                   /translation="MTAQQGVPIKITNKEIAQEFLDKYDTFLFDCDGVLWLGSQALPYT
FT                   LEILNLLKQLGKQLIFVTNNSTKSRLAYTKKFASFGIDVKEEQIFTSGYASAVYIRDFL
FT                   KLQPGKDKVWVFGESGIGEELKLMGYESLGGADSRLDTPFDAAKSPFLVNGLDKDVSCV
FT                   IAGLDTKVNYHRLAVTLQYLQKDSVHFVGTNVDSTFPQKGYTFPGAGSMIESLAFSSNR
FT                   RPSYCGKPNQNMLNSIISAFNLDRSKCCMVGDRLNTDMKFGVEGGLGGTLLVLSGIETE
FT                   ERALKISHDYPRPKFYIDKLGDIYTLTNNEL"
FT   gene            complement(33415..33918)
FT                   /gene="YPD1"
FT                   /locus_tag="YDL235C"
FT   mRNA            complement(33415..33918)
FT                   /gene="YPD1"
FT                   /locus_tag="YDL235C"
FT                   /product="Ypd1p"
FT   CDS_pept        complement(33415..33918)
FT                   /codon_start=1
FT                   /gene="YPD1"
FT                   /locus_tag="YDL235C"
FT                   /product="Ypd1p"
FT                   /note="Osmotic stress-responsive phosphorelay intermediate
FT                   sensor protein; phosphorylated by the plasma membrane
FT                   sensor Sln1p in response to osmotic stress and then in turn
FT                   phosphorylates the response regulators Ssk1p in the cytosol
FT                   and Skn7p in the nucleus"
FT                   /db_xref="GOA:Q07688"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="PDB:1C02"
FT                   /db_xref="PDB:1C03"
FT                   /db_xref="PDB:1OXB"
FT                   /db_xref="PDB:1OXK"
FT                   /db_xref="PDB:1QSP"
FT                   /db_xref="PDB:2R25"
FT                   /db_xref="PDB:5KBX"
FT                   /db_xref="PDB:6M7W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07688"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14665464]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14665464]"
FT                   /experiment="EXISTENCE:direct assay:GO:0007234 osmosensory
FT                   signaling via phosphorelay pathway [PMID:8808622]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016772 transferase
FT                   activity, transferring phosphorus-containing groups
FT                   [PMID:8808622]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007234
FT                   osmosensory signaling via phosphorelay pathway
FT                   [PMID:8808622]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0043424
FT                   protein histidine kinase binding [PMID:8808622]"
FT                   /protein_id="DAA11631.1"
FT                   /translation="MSTIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQ
FT                   MQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVN
FT                   TLSDKSIINGINIDEDDEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYY
FT                   NTNL"
FT   gene            complement(34237..36477)
FT                   /gene="GYP7"
FT                   /locus_tag="YDL234C"
FT   mRNA            complement(34237..36477)
FT                   /gene="GYP7"
FT                   /locus_tag="YDL234C"
FT                   /product="Gyp7p"
FT   CDS_pept        complement(34237..36477)
FT                   /codon_start=1
FT                   /gene="GYP7"
FT                   /locus_tag="YDL234C"
FT                   /product="Gyp7p"
FT                   /note="GTPase-activating protein for yeast Rab family
FT                   members; members include Ypt7p (most effective), Ypt1p,
FT                   Ypt31p, and Ypt32p (in vitro); involved in vesicle mediated
FT                   protein trafficking; contains a PH-like domain"
FT                   /db_xref="GOA:P48365"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48365"
FT                   /experiment="EXISTENCE:direct assay:GO:0005096 GTPase
FT                   activator activity [PMID:10508155]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016192
FT                   vesicle-mediated transport [PMID:11118206]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005096 GTPase
FT                   activator activity [PMID:10508155]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0032889
FT                   regulation of vacuole fusion, non-autophagic
FT                   [PMID:18809726]"
FT                   /protein_id="DAA11632.1"
FT                   /translation="MSKILFCKSKVFLHPTSDARDNIAGFLLLTLEANKLSHQAILQYI
FT                   PESGLSTLEISKLLKHEAKVGTCPTSTPFVIENSINFSNLVNTSLGQAFEISLSQIYCI
FT                   QFRPPSPNGWYVGSLVIYPLTEQFTGFQPPVLFFHDQLCPSTTDKLKRLRKSMNPFDDS
FT                   DELYWGGVDLRNKINELMELKKSNLEPEFWLVNPSLNDLRNFVSKDLLESYNNSKKDTT
FT                   ELATAGVKLNEKFQEWKWNVMSKIADVTTKSTNFIDSWLTNNSPIQKSQIDNEYLQKLL
FT                   NNEKVKQIEQDYDSARVYLANWSLGVKQEAERYQKQNKLFDSYRNNIFNDLNLTDELSD
FT                   TEINNALQRQFPLTEAKWNSLWDENDGRLRVTVNEVKDFIFHGGLENDSLRGKVWGFLL
FT                   EIYPWDSSQDERVQIDQTLAAEYDQLKLTWSKDFLQFDDEDEEEYWNDQLFRISKDVRR
FT                   CDRNLEIFQYNTIDGLPPPPQQLPANENNSTSPESANDESDDADDGVRNPHLIHLQNIL
FT                   ITYNVYNTNLGYVQGMTDLLSPIYVIMKEEWKTFWCFTHFMDIMERNFLRDQSGIHEQM
FT                   LTLVELVQLMLPELSEHLNKCDSGNLFFCFRMLLVWFKREFEMEDIMHIWENFWTFYYS
FT                   SQFQLFFMLAILQKNSQAILQHLNQFDQILKFFNELNGKLDWNDLMVRAELLFKKFEKM
FT                   MHVMERDLQNVSSSSSSSSTGVLPCQSERLTLLLSKKPIIRHEGQRSKNSVK"
FT   gene            36797..38173
FT                   /gene="MFG1"
FT                   /locus_tag="YDL233W"
FT   mRNA            36797..38173
FT                   /gene="MFG1"
FT                   /locus_tag="YDL233W"
FT                   /product="Mfg1p"
FT   CDS_pept        36797..38173
FT                   /codon_start=1
FT                   /gene="MFG1"
FT                   /locus_tag="YDL233W"
FT                   /product="Mfg1p"
FT                   /note="Regulator of filamentous growth; interacts with
FT                   FLO11 promoter and regulates FLO11 expression; binds to
FT                   transcription factors Flo8p and Mss11p; green fluorescent
FT                   protein (GFP)-fusion protein localizes to the nucleus;
FT                   YDL233W is not an essential gene"
FT                   /db_xref="GOA:Q07684"
FT                   /db_xref="InterPro:IPR029005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07684"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /protein_id="DAA11633.1"
FT                   /translation="MYQGPPQPPPQAVPMPYIVNNNTPPYPNGNINFPPTAQQNIPPTV
FT                   YPQQVPFPGQPQGGQFPQPSSEQQVFNQLPQVTQTFHNSAQNTNATGGPGSGSMPMFTP
FT                   VASFPHPMATAATAAAPLPRSASQASLSMLRVPYHVRKYLSNLAMLKLYEIINEVNTAM
FT                   GKIGLLSFWTELISDIFTPDAVIRYSKKSMTDYREFEFIIPVFPVICSTLGRFGIVRME
FT                   VKVLQLKTQVLSNSTIFFNCPRVTFVYYYPDGSYITHFSQMKGAFDLDLKINWLDVSMH
FT                   SFVPDIEWNAVERLLSDDTKSTEIEQIFRKLKQEDVKEQGNSFAENNATNVPPNFEAIT
FT                   QLRSYFDVFRNVSVFGTQEGLMRVMQISTVMSTLKNLRKFQIEKNIDSPVTALSAYIDA
FT                   DKKDSGSEPLHAKRRRNSGISPRTTTLGPNGNSNTSNEELPTSDVNDINKDMTKKKMKF
FT                   "
FT   gene            38487..38597
FT                   /gene="OST4"
FT                   /locus_tag="YDL232W"
FT   mRNA            38487..38597
FT                   /gene="OST4"
FT                   /locus_tag="YDL232W"
FT                   /product="olichyl-diphosphooligosaccharide--protein
FT                   glycotransferase OST4"
FT   CDS_pept        38487..38597
FT                   /codon_start=1
FT                   /gene="OST4"
FT                   /locus_tag="YDL232W"
FT                   /product="olichyl-diphosphooligosaccharide--protein
FT                   glycotransferase OST4"
FT                   /note="Subunit of the oligosaccharyltransferase complex of
FT                   the ER lumen; complex catalyzes protein asparagine-linked
FT                   glycosylation; type I membrane protein required for
FT                   incorporation of Ost3p or Ost6p into the OST complex"
FT                   /db_xref="GOA:Q99380"
FT                   /db_xref="InterPro:IPR018943"
FT                   /db_xref="InterPro:IPR036330"
FT                   /db_xref="PDB:1RKL"
FT                   /db_xref="PDB:6C26"
FT                   /db_xref="PDB:6EZN"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99380"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030674 protein
FT                   binding, bridging [PMID:12810948]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005789
FT                   endoplasmic reticulum membrane [PMID:10677492]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0006487
FT                   protein N-linked glycosylation [PMID:9405463]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0008250
FT                   oligosaccharyltransferase complex [PMID:9405463]"
FT                   /protein_id="DAA11634.1"
FT                   /translation="MISDEQLNSLAITFGIVMMTLIVIYHAVDSTMSPKN"
FT   gene            complement(38867..42244)
FT                   /gene="BRE4"
FT                   /locus_tag="YDL231C"
FT   mRNA            complement(38867..42244)
FT                   /gene="BRE4"
FT                   /locus_tag="YDL231C"
FT                   /product="Bre4p"
FT   CDS_pept        complement(38867..42244)
FT                   /codon_start=1
FT                   /gene="BRE4"
FT                   /locus_tag="YDL231C"
FT                   /product="Bre4p"
FT                   /note="Zinc finger protein containing five transmembrane
FT                   domains; null mutant exhibits strongly fragmented vacuoles
FT                   and sensitivity to brefeldin A, a drug which is known to
FT                   affect intracellular transport"
FT                   /db_xref="GOA:Q07660"
FT                   /db_xref="InterPro:IPR018820"
FT                   /db_xref="InterPro:IPR023244"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07660"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006897
FT                   endocytosis [PMID:11378903]"
FT                   /protein_id="DAA11635.1"
FT                   /translation="MKRYERDRSPTPDPDIVKGSYSQTSLRSLHELNYKNPAGISGLSF
FT                   AGSPQQSVASLSQMRLENLVKDKHWEEVEDFGLEELRDGFFDAAFTKPDSKARSPNSDI
FT                   DDDNGAARKKLQSGFTKLSEYVWTAIYRPIIHFPRDIRKNGVSIFKFFIAYFIAIVICV
FT                   IRPSGRWIGHEFRYFLPIAVLIHHPVRNIGVQLEMTISSIIGASFGLGWSALAWYISTA
FT                   TKPTANYQGGILFQSLTMALLFAIWLRSVYRRFFYFTTSFSISIIFTHTVRLASSKFDL
FT                   KWQIFWDFGISYLFGLLLSLLVCVCVSPHSGNAELMEHYNKCLQTTKTFLMALVDTELI
FT                   KSKEQIYLAQVKMVKTLNIDLSQGFRDFVNQLTISRFDLQSLKSLRNSLTAMETSLRVL
FT                   PIAPKIFNDDELKKMYEELEKYRSDSATLSKEASASPQSSGIPTRENTPSAFKPIGPGL
FT                   LKNEIYINALKASFSKSIFNLILEMIFVLENLSRVLKKYESPNQKNNLDECVKILSHSH
FT                   SKLKRKIYKLDVCYRDFVNSSFFSQELLNDEESVDIFLFLRYLRNSARQLVTVIHDCQV
FT                   LGENIHWRIALPSYPLSRALTRLPKQCVLDEGAGNVLHYFEAKRDVDEIFERVYNTYTS
FT                   RHKYNKGEEEALRLDSQGGDEKSQNRKNHTISIRAIDHNDFNFHTTQNPWRFKLWKLSR
FT                   ILSGDECKWTLKITFCMIFLCLPTWLPESYHWYQEFHCWWAPLTFYLLAHRRYSGNWAL
FT                   VMRRLICGIVGIFWGWAANQSRHFGSPYVVCTFAGLIVVPFSINFLVYRNTKSSFTALM
FT                   CFTIIALEPYSKPNRHYNLTTAGIWKSTWVTGLALIIGILVSIPINWIVWPFRARTELR
FT                   DSMSSLLAHLGQSYQTVADRYLYRDADDAPTDLTFAFSHIREVRLTQSLEAIRELLKKA
FT                   RHEPIIISNFNPEKYASLINSCQFLLSKIIEARISGAFFEIWDQDFDIETTRALLSLRR
FT                   DSVSSVIFVFYILSNCFRSKNKIPRYLPNPIMSRKKLYHFIKKFSEMKDQSHSNLNSGG
FT                   NSMEKNLFKKIYQQKASSSGQQQLPLPSVANSSEIDSEKMHWTEVHGIAFARAFTDISE
FT                   ALFQVESCAKDILGEENF"
FT   gene            42700..43707
FT                   /gene="PTP1"
FT                   /locus_tag="YDL230W"
FT   mRNA            42700..43707
FT                   /gene="PTP1"
FT                   /locus_tag="YDL230W"
FT                   /product="tyrosine protein phosphatase PTP1"
FT   CDS_pept        42700..43707
FT                   /codon_start=1
FT                   /gene="PTP1"
FT                   /locus_tag="YDL230W"
FT                   /product="tyrosine protein phosphatase PTP1"
FT                   /EC_number="3.1.3.48"
FT                   /note="Phosphotyrosine-specific protein phosphatase;
FT                   dephosphorylates a broad range of substrates in vivo,
FT                   including Fpr3p; localized to the cytoplasm and the
FT                   mitochondria; proposed to be a negative regulator of
FT                   filamentation"
FT                   /db_xref="GOA:P25044"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR016277"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25044"
FT                   /experiment="EXISTENCE:direct assay:GO:0004725 protein
FT                   tyrosine phosphatase activity [PMID:1649172]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006470 protein
FT                   dephosphorylation [PMID:7559654]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001403 invasive
FT                   growth in response to glucose limitation [PMID:21460040]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006470 protein
FT                   dephosphorylation [PMID:7559654]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007124
FT                   pseudohyphal growth [PMID:21460040]"
FT                   /protein_id="DAA11636.1"
FT                   /translation="MAAAPWYIRQRDTDLLGKFKFIQNQEDGRLREATNGTVNSRWSLG
FT                   VSIEPRNDARNRYVNIMPYERNRVHLKTLSGNDYINASYVKVNVPGQSIEPGYYIATQG
FT                   PTRKTWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWES
FT                   PGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDM
FT                   NKPEEVVPIMELCAHSHSLNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITER
FT                   SRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIYHAAKYLNSLSVNQ"
FT   gene            44065..45906
FT                   /gene="SSB1"
FT                   /gene_synonym="YG101"
FT                   /locus_tag="YDL229W"
FT   mRNA            44065..45906
FT                   /gene="SSB1"
FT                   /gene_synonym="YG101"
FT                   /locus_tag="YDL229W"
FT                   /product="Hsp70 family ATPase SSB1"
FT   CDS_pept        44065..45906
FT                   /codon_start=1
FT                   /gene="SSB1"
FT                   /gene_synonym="YG101"
FT                   /locus_tag="YDL229W"
FT                   /product="Hsp70 family ATPase SSB1"
FT                   /EC_number="3.6.4.10"
FT                   /note="Cytoplasmic ATPase that is a ribosome-associated
FT                   molecular chaperone; functions with J-protein partner
FT                   Zuo1p; may be involved in folding of newly-made polypeptide
FT                   chains; member of the HSP70 family; interacts with
FT                   phosphatase subunit Reg1p; SSB1 has a paralog, SSB2, that
FT                   arose from the whole genome duplication"
FT                   /db_xref="GOA:P11484"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="PDB:3GL1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P11484"
FT                   /experiment="EXISTENCE:direct assay:GO:0005516 calmodulin
FT                   binding [PMID:17146552]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:19502427]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005844 polysome
FT                   [PMID:1394434|PMID:16413483]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:16622836]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016887 ATPase
FT                   activity [PMID:9860955]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051082 unfolded
FT                   protein binding [PMID:9670014]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051083 'de novo'
FT                   cotranslational protein folding [PMID:9670014]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000054
FT                   ribosomal subunit export from nucleus [PMID:20368619]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006364 rRNA
FT                   processing [PMID:20368619]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0042149
FT                   cellular response to glucose starvation [PMID:19723765]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0002181
FT                   cytoplasmic translation [PMID:1394434]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006415
FT                   translational termination [PMID:17483428]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006450
FT                   regulation of translational fidelity [PMID:15456889]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006452
FT                   translational frameshifting [PMID:16607023]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0002181
FT                   cytoplasmic translation [PMID:1394434]"
FT                   /protein_id="DAA11637.1"
FT                   /translation="MAEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVA
FT                   FTPEERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVDGNPV
FT                   IEVQYLEETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDA
FT                   GAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGGVYTV
FT                   KSTSGNTHLGGQDFDTNLLEHFKAEFKKKTGLDISDDARALRRLRTAAERAKRTLSSVT
FT                   QTTVEVDSLFDGEDFESSLTRARFEDLNAALFKSTLEPVEQVLKDAKISKSQIDEVVLV
FT                   GGSTRIPKVQKLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDETKDLLLLD
FT                   VAPLSLGVGMQGDMFGIVVPRNTTVPTIKRRTFTTCADNQTTVQFPVYQGERVNCKENT
FT                   LLGEFDLKNIPMMPAGEPVLEAIFEVDANGILKVTAVEKSTGKSSNITISNAVGRLSSE
FT                   EIEKMVNQAEEFKAADEAFAKKHEARQRLESYVASIEQTVTDPVLSSKLKRGSKSKIEA
FT                   ALSDALAALQIEDPSADELRKAEVGLKRVVTKAMSSR"
FT   rep_origin      46185..46237
FT                   /note="ARS404; Autonomously Replicating Sequence"
FT   gene            complement(46271..48031)
FT                   /gene="HO"
FT                   /locus_tag="YDL227C"
FT   mRNA            complement(46271..48031)
FT                   /gene="HO"
FT                   /locus_tag="YDL227C"
FT                   /product="Hop"
FT   CDS_pept        complement(46271..48031)
FT                   /codon_start=1
FT                   /gene="HO"
FT                   /locus_tag="YDL227C"
FT                   /product="Hop"
FT                   /note="Site-specific endonuclease; required for gene
FT                   conversion at the MAT locus (homothallic switching) through
FT                   the generation of a ds DNA break; expression restricted to
FT                   mother cells in late G1 as controlled by Swi4p-Swi6p,
FT                   Swi5p, and Ash1p"
FT                   /db_xref="GOA:P09932"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR007868"
FT                   /db_xref="InterPro:IPR007869"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09932"
FT                   /experiment="EXISTENCE:direct assay:GO:0000728 gene
FT                   conversion at mating-type locus, DNA double-strand break
FT                   formation [PMID:6313222]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004519 endonuclease
FT                   activity [PMID:6313222]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007533 mating
FT                   type switching [PMID:6297747]"
FT                   /protein_id="DAA11638.1"
FT                   /translation="MLSENTTILMANGEIKDIANVTANSYVMCADGSAARVINVTQGYQ
FT                   KIYNIQQKTKHRAFEGEPGRLDPRRRTVYQRLALQCTAGHKLSVRVPTKPLLEKSGRNA
FT                   TKYKVRWRNLQQCQTLDGRIIIIPKNHHKTFPMTVEGEFAAKRFIEEMERSKGEYFNFD
FT                   IEVRDLDYLDAQLRISSCIRFGPVLAGNGVLSKFLTGRSDLVTPAVKSMAWMLGLWLGD
FT                   STTKEPEISVDSLDPKLMESLRENAKIWGLYLTVCDDHVPLRAKHVRLHYGDGPDENRK
FT                   TRNLRKNNPFWKAVTILKFKRDLDGEKQIPEFMYGEHIEVREAFLAGLIDSDGYVVKKG
FT                   EGPESYKIAIQTVYSSIMDGIVHISRSLGMSATVTTRSAREEIIEGRKVQCQFTYDCNV
FT                   AGGTTSQNVLSYCRSGHKTREVPPIIKREPVYFSFTDDFQGESTVYGLTIEGHKNFLLG
FT                   NKIEVKSCRGCCVGEQLKISQKKNLKHCVACPRKGIKYFYKDWSGKNRVCARCYGRYKF
FT                   SGHHCINCKYVPEAREVKKAKDKGEKLGITPEGLPVKGPECIKCGGILQFDAVRGPHKS
FT                   CGNNAGARIC"
FT   gene            complement(51115..52173)
FT                   /gene="GCS1"
FT                   /locus_tag="YDL226C"
FT   mRNA            complement(51115..52173)
FT                   /gene="GCS1"
FT                   /locus_tag="YDL226C"
FT                   /product="Gcs1p"
FT   CDS_pept        complement(51115..52173)
FT                   /codon_start=1
FT                   /gene="GCS1"
FT                   /locus_tag="YDL226C"
FT                   /product="Gcs1p"
FT                   /note="ADP-ribosylation factor GTPase activating protein
FT                   (ARF GAP); involved in ER-Golgi transport; required for
FT                   prospore membrane formation; regulates phospholipase
FT                   Spo14p; shares functional similarity with Glo3p; GCS1 has a
FT                   paralog, SPS18, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:P35197"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="PDB:5FJX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35197"
FT                   /experiment="EXISTENCE:direct assay:GO:0003779 actin
FT                   binding [PMID:10069805]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005096 GTPase
FT                   activator activity [PMID:15975906|PMID:8816753]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005768 endosome
FT                   [PMID:16452633]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005802 trans-Golgi
FT                   network [PMID:16452633]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006890 retrograde
FT                   vesicle-mediated transport, Golgi to endoplasmic reticulum
FT                   [PMID:9927415]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005856
FT                   cytoskeleton [PMID:10069805]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006888
FT                   endoplasmic reticulum to Golgi vesicle-mediated transport
FT                   [PMID:9927415]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006890
FT                   retrograde vesicle-mediated transport, Golgi to endoplasmic
FT                   reticulum [PMID:9927415]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030037 actin
FT                   filament reorganization involved in cell cycle
FT                   [PMID:10069805]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043001 Golgi to
FT                   plasma membrane protein transport [PMID:16926193]"
FT                   /protein_id="DAA11639.1"
FT                   /translation="MSDWKVDPDTRRRLLQLQKIGANKKCMDCGAPNPQWATPKFGAFI
FT                   CLECAGIHRGLGVHISFVRSITMDQFKPEELLRMEKGGNEPLTEWFKSHNIDLSLPQKV
FT                   KYDNPVAEDYKEKLTCLCEDRVFEEREHLDFDASKLSATSQTAASATPGVAQSREGTPL
FT                   ENRRSATPANSSNGANFQKEKNEAYFAELGKKNQSRPDHLPPSQGGKYQGFGSTPAKPP
FT                   QERSAGSSNTLSLENFQADPLGTLSRGWGLFSSAVTKSFEDVNETVIKPHVQQWQSGEL
FT                   SEETKRAAAQFGQKFQETSSYGFQAFSNFTKNFNGNAEDSSTAGNTTHTEYQKIDNNDK
FT                   KNEQDEDKWDDF"
FT   gene            52445..54100
FT                   /gene="SHS1"
FT                   /gene_synonym="SEP7"
FT                   /locus_tag="YDL225W"
FT   mRNA            52445..54100
FT                   /gene="SHS1"
FT                   /gene_synonym="SEP7"
FT                   /locus_tag="YDL225W"
FT                   /product="septin SHS1"
FT   CDS_pept        52445..54100
FT                   /codon_start=1
FT                   /gene="SHS1"
FT                   /gene_synonym="SEP7"
FT                   /locus_tag="YDL225W"
FT                   /product="septin SHS1"
FT                   /note="Component of the septin ring that is required for
FT                   cytokinesis; present at the ends of rod-like septin
FT                   hetero-oligomers; C-terminal extension is important for
FT                   recruitment of Bni5p to the mother-bud neck, which in turn
FT                   is required for Myo1p recruitment and cytokinesis;
FT                   undergoes sumoylation and phosphorylation during mitosis;
FT                   protein abundance increases in response to DNA replication
FT                   stress"
FT                   /db_xref="GOA:Q07657"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07657"
FT                   /experiment="EXISTENCE:direct assay:GO:0000144 cellular bud
FT                   neck septin ring [PMID:17603111]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005200 structural
FT                   constituent of cytoskeleton [PMID:22144691|PMID:29321251]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005525 GTP binding
FT                   [PMID:14597621]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005628 prospore
FT                   membrane [PMID:24390141]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005935 cellular bud
FT                   neck [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043332 mating
FT                   projection tip [PMID:19053807]"
FT                   /experiment="EXISTENCE:direct assay:GO:0061163 endoplasmic
FT                   reticulum polarization [PMID:25083872]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000082 G1/S
FT                   transition of mitotic cell cycle [PMID:18431499]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000921
FT                   septin ring assembly [PMID:17603111]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0097271
FT                   protein localization to bud neck [PMID:25971666]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000915
FT                   actomyosin contractile ring assembly [PMID:17603111]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000917 division
FT                   septum assembly [PMID:17603111]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005200
FT                   structural constituent of cytoskeleton [PMID:22144691]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0010458 exit
FT                   from mitosis [PMID:12699621]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0032186 cellular
FT                   bud neck septin ring organization [PMID:12636916]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0005935
FT                   cellular bud neck [PMID:25083872]"
FT                   /protein_id="DAA11640.1"
FT                   /translation="MSTASTPPINLFRRKKEHKRGITYTMLLCGPAGTGKTAFANNLLE
FT                   TKIFPHKYQYGKSNASISSNPEVKVIAPTKVVSFNSKNGIPSYVSEFDPMRANLEPGIT
FT                   ITSTSLELGGNKDQGKPEMNEDDTVFFNLIMTHGIGENLDDSLCSEEVMSYLEQQFDIV
FT                   LAEETRIKRNPRFEDTRVHVALYFIEPTGHGLREVDVELMKSISKYTNVLPIITRADSF
FT                   TKEELTQFRKNIMFDVERYNVPIYKFEVDPEDDDLESMEENQALASLQPFAIITSDTRD
FT                   SEGRYVREYPWGIISIDDDKISDLKVLKNVLFGSHLQEFKDTTQNLLYENYRSEKLSSV
FT                   ANAEEIGPNSTKRQSNAPSLSNFASLISTGQFNSSQTLANNLRADTPRNQVSGNFKENE
FT                   YEDNGEHDSAENEQEMSPVRQLGREIKQENENLIRSIKTESSPKFLNSPDLPERTKLRN
FT                   ISETVPYVLRHERILARQQKLEELEAQSAKELQKRIQELERKAHELKLREKLINQNKLN
FT                   GSSSSINSLQQSTRSQIKKNDTYTDLASIASGRD"
FT   gene            complement(54397..56346)
FT                   /gene="WHI4"
FT                   /locus_tag="YDL224C"
FT   mRNA            complement(54397..56346)
FT                   /gene="WHI4"
FT                   /locus_tag="YDL224C"
FT                   /product="Whi4p"
FT   CDS_pept        complement(54397..56346)
FT                   /codon_start=1
FT                   /gene="WHI4"
FT                   /locus_tag="YDL224C"
FT                   /product="Whi4p"
FT                   /note="Putative RNA binding protein; regulates the cell
FT                   size requirement for passage through Start and commitment
FT                   to cell division; WHI4 has a paralog, WHI3, that arose from
FT                   the whole genome duplication"
FT                   /db_xref="GOA:Q07655"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07655"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0008361
FT                   regulation of cell size [PMID:11290704]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0061157 mRNA
FT                   destabilization [PMID:24386402]"
FT                   /protein_id="DAA11641.1"
FT                   /translation="MSLVHNQTNLNESKFLIERAFSSSSETVPLSKEATYPMPTAYSFS
FT                   AVRSNSETNIKRENPQGFAKEPIMTSMLHNLTMSTGKGNGNDVNSLAPHDVDVGPYCLL
FT                   LRNLPKDITLRECYCIFSLATGVSSIELKRDDREPFNDNEKVVVVKFGSLSLVTHYANI
FT                   LNSKSEIFGPSFPFRSHIDVVNEQTQLPVSFQEHVSSGTTNSSPKNYQLSSSAQNEIQN
FT                   QSFNTISYGKTSSSPLGPSAAKPRPSLLSERSLRFSFNDPFGLETISQRKESVPFLRNS
FT                   ISQHDLSNVTTTPVPAGMPPQKDAGKSLLLLEKDEINESIWNGDELVNDVGNSSFGASL
FT                   QEPPMSSTPVMEWNASSTANIPLFQLSSQENHQSNLLPPSHHSISQDVPHIQSQPNLNN
FT                   SGVIHSATSLPHYHLLNQINASTKTQSIQQSVSNVPSNLDLNLQTENGHPQSSAPNGSS
FT                   IFNNQKVNQGFLVSEQDTSTISRQKECSSTASASAFSKNNETNVAGSTTISQADLSLLA
FT                   KVPPPANPADQNPPCNTLYVGNLPPDATEQELRQLFSNQQGFRRLSFRNKMNSHGHGNG
FT                   HGHGPICFVEFEDVSFATRALAELYGSQLPHPRPSLNNKGGIRLSFSKNPLGVRGSNSR
FT                   SKSGYSFNGSYGKS"
FT   gene            complement(57265..60405)
FT                   /gene="HBT1"
FT                   /locus_tag="YDL223C"
FT   mRNA            complement(57265..60405)
FT                   /gene="HBT1"
FT                   /locus_tag="YDL223C"
FT                   /product="Hbt1p"
FT   CDS_pept        complement(57265..60405)
FT                   /codon_start=1
FT                   /gene="HBT1"
FT                   /locus_tag="YDL223C"
FT                   /product="Hbt1p"
FT                   /note="Shmoo tip protein, substrate of Hub1p ubiquitin-like
FT                   protein; mutants are defective for mating projection
FT                   formation, thereby implicating Hbt1p in polarized cell
FT                   morphogenesis; HBT1 has a paralog, YNL195C, that arose from
FT                   the whole genome duplication"
FT                   /db_xref="GOA:Q07653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07653"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:16622836]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005937 mating
FT                   projection [PMID:11923536]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000753 cell
FT                   morphogenesis involved in conjugation with cellular fusion
FT                   [PMID:11923536]"
FT                   /protein_id="DAA11642.1"
FT                   /translation="MNMNESISKDGQGEEEQNNFSFGGKPGSYDSNSDSAQRKKSFSTT
FT                   KPTEYNLPKEQPESTSKNLETKAKNILLPWRKKHNKDSETPHEDTEADANRRANVTSDV
FT                   NPVSADTKSSSGPNATITTHGYSYVKTTTPAATSEQSKVKTSPPTSHEHSNIKASPTAH
FT                   RHSKGDAGHPSIATTHNHSTSKAATSPVTHTHGHSSATTSPVTHTHGHASVKTTSPTNT
FT                   HEHSKANTGPSATATTHGHINVKTTHPVSHGHSGSSTGPKSTAAAQDHSSTKTNPSVTH
FT                   GHTSVKDNSSATKGYSNTDSNSDRDVIPGSFRGMTGTDVNPVDPSVYTSTGPKSNVSSG
FT                   MNAVDPSVYTDTSSKSADRRKYSGNTATGPPQDTIKEIAQNVKMDESEQTGLKNDQVSG
FT                   SDAIQQQTMEPEPKAAVGTSGFVSQQPSYHDSNKNIQHPEKNKVDNKNISERAAEKFNI
FT                   ERDDILESADDYQQKNIKSKTDSNWGPIEYSSSAGKNKNLQDVVIPSSMKEKFDSGTSG
FT                   SQNMPKAGTELGHMKYNDNGRDNLQYVAGSQAGSQNTNNNIDMSPRHEAEWSGLSNDAT
FT                   TRNNVVSPAMKDEDMNEDSTKPHQYGLDYLDDVEDYHENDIDDYSNAKKNDLYSKKAYQ
FT                   GKPSDYNYEQREKIPGTFEPDTLSKSVQKQDEDPLSPRQTTNRAGMETARDESLGNYEY
FT                   SNTSGNKKLSDLSKNKSGPTPTRSNFIDQIEPRRAKTTQDIASDAKDFTNNPETGTTGN
FT                   VDTTGRMGAKSKTFSSNPFDDSKNTDTHLENANVAAFDNSRSGDTTYSKSGDAETAAYD
FT                   NIKNADPTYAKSQDITGMTHDQEPSSEQKASYGSGGNSQNQEYSSDDNIDVNKNAKVLE
FT                   EDAPGYKREVDLKNKRRTDLGGADASNAYAAEVGNFPSLIDPHVPTYGFKDTNTSSSQK
FT                   PSEGTYPETTSYSIHNETTSQGRKVSVGSMGSGKSKHHHNHHRHSRQNSSKGSDYDYNN
FT                   STHSAEHTPRHHQYGSDEGEQDYHDDEQGEEQAGKQSFMGRVRKSISGGTFGFRSEI"
FT   gene            complement(60872..61801)
FT                   /gene="FMP45"
FT                   /locus_tag="YDL222C"
FT   mRNA            complement(60872..61801)
FT                   /gene="FMP45"
FT                   /locus_tag="YDL222C"
FT                   /product="Fmp45p"
FT   CDS_pept        complement(60872..61801)
FT                   /codon_start=1
FT                   /gene="FMP45"
FT                   /locus_tag="YDL222C"
FT                   /product="Fmp45p"
FT                   /note="Integral membrane protein localized to mitochondria;
FT                   required for sporulation and maintaining sphingolipid
FT                   content; similar to SUR7; FMP45 has a paralog, YNL194C,
FT                   that arose from the whole genome duplication"
FT                   /db_xref="GOA:Q07651"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07651"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:16622836]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005938 cell cortex
FT                   [PMID:11784867]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030437
FT                   ascospore formation [PMID:11784867]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031505
FT                   fungal-type cell wall organization [PMID:11784867]"
FT                   /protein_id="DAA11643.1"
FT                   /translation="MIFKRFVNLLVFLFLLGAGLLTFFLILSGGRESGTLKNFYWLQAD
FT                   TNGFNSAPSTTRWYNYNWCGYEDGQLANCSSRAPAKPFSPRDNFGNSVNLPSSFRNNRD
FT                   TYYYLSRVGWAMLLISLFFIVLALVPGFLATFLPFKAVPVLYCVLSWLAFFFIILAACL
FT                   YTGCYVKARKTFRNSGRSARLGPKNFAFIWTSVFLMLVNAIWSTIFSATHKAHSTYSDH
FT                   DMYAQYESPSVDTGAQMEKSTYNSGATDGAGPITAAPVVGQPQPTTTTTPAGNGKFFQK
FT                   LKTRKQVPSAELEPAGDGGLAGPVTVRD"
FT   gene            complement(62244..65018)
FT                   /gene="CDC13"
FT                   /gene_synonym="EST4"
FT                   /locus_tag="YDL220C"
FT   mRNA            complement(62244..65018)
FT                   /gene="CDC13"
FT                   /gene_synonym="EST4"
FT                   /locus_tag="YDL220C"
FT                   /product="telomere-binding protein CDC13"
FT   CDS_pept        complement(62244..65018)
FT                   /codon_start=1
FT                   /gene="CDC13"
FT                   /gene_synonym="EST4"
FT                   /locus_tag="YDL220C"
FT                   /product="telomere-binding protein CDC13"
FT                   /note="Single stranded DNA-binding protein found at TG1-3
FT                   telomere G-tails; key roles in regulation of telomerase,
FT                   telomere end protection, conventional telomere replication;
FT                   regulates telomere replication through recruitment of
FT                   specific sub-complexes, essential function is telomere
FT                   capping; forms homodimer via N-terminus; disruption of
FT                   dimerization leads to short telomeres; autophagy and
FT                   proteasome are involved in Cdc13p degradation;
FT                   differentially phosphorylated through cell cycle"
FT                   /db_xref="GOA:P32797"
FT                   /db_xref="InterPro:IPR011564"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR031749"
FT                   /db_xref="InterPro:IPR040650"
FT                   /db_xref="InterPro:IPR041028"
FT                   /db_xref="PDB:1KXL"
FT                   /db_xref="PDB:1S40"
FT                   /db_xref="PDB:3NWS"
FT                   /db_xref="PDB:3NWT"
FT                   /db_xref="PDB:3OIP"
FT                   /db_xref="PDB:3OIQ"
FT                   /db_xref="PDB:4HCE"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32797"
FT                   /experiment="EXISTENCE:direct assay:GO:0000784 nuclear
FT                   chromosome, telomeric region [PMID:9710643]"
FT                   /experiment="EXISTENCE:direct assay:GO:0010521 telomerase
FT                   inhibitor activity [PMID:19043074]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032210 regulation
FT                   of telomere maintenance via telomerase [PMID:27659693]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043047
FT                   single-stranded telomeric DNA binding
FT                   [PMID:17166094|PMID:8824190|PMID:8943008]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051974 negative
FT                   regulation of telomerase activity [PMID:19043074]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0007004
FT                   telomere maintenance via telomerase [PMID:11239396]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0032210
FT                   regulation of telomere maintenance via telomerase
FT                   [PMID:11046137]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000723 telomere
FT                   maintenance [PMID:11390652]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007004 telomere
FT                   maintenance via telomerase [PMID:8978029]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016233 telomere
FT                   capping [PMID:7565765]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043047
FT                   single-stranded telomeric DNA binding [PMID:17166094]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0071166
FT                   ribonucleoprotein complex localization [PMID:25387524]"
FT                   /experiment="EXISTENCE:physical interaction:GO:1990879 CST
FT                   complex [PMID:11230140]"
FT                   /protein_id="DAA11644.1"
FT                   /translation="MDTLEEPECPPHKNRIFVSSSKDFEGYPSKAIVPVQFVALLTSIH
FT                   LTETKCLLGFSNFERRGDQSQEDQYLIKLKFKDRGSERLARITISLLCQYFDIELPDLD
FT                   SDSGASPTVILRDIHLERLCFSSCKALYVSKHGNYTLFLEDIKPLDLVSVISTISTKST
FT                   NSSKHSSSELISECDLNNSLVDIFNNLIEMNRDEKNRFKFVKLIHYDIELKKFVQDQQK
FT                   VLSQKSKAAAINPFFVPNRLGIPYIESQNEFNSQLMTLNVDEPTTDISNMGEEMHDSAD
FT                   PIEDSDSSTTSSTGKYFSSKSYIQSQTPERKTSVPNNWHDDDSGSKRKRKLSFHSPNAS
FT                   SIRKAISYEQLSLASVGSVERLEGKIVGMNPPQFASINEFKYCTLKLYFTQLLPNVPDK
FT                   VLVPGVNCIEIVIPTRERICELFGVLNCQSDKISDILLLEKPDRISVEVERILWDNDKT
FT                   ASPGMAVWSLKNISTDTQAQAQVQVPAQSSASIDPSRTRMSKMARKDPTIEFCQLGLDT
FT                   FETKYITMFGMLVSCSFDKPAFISFVFSDFTKNDIVQNYLYDRYLIDYENKLELNEGFK
FT                   AIMYKNQFETFDSKLRKIFNNGLRDLQNGRDENLSQYGIVCKMNIKVKMYNGKLNAIVR
FT                   ECEPVPHSQISSIASPSQCEHLRLFYQRAFKRIGESAISRYFEEYRRFFPIHRNGSHLA
FT                   KLRFDEVKHEPKKSPTTPALAEHIPDLNADVSSFDVKFTDISSLLDSSARLPRPQQTHK
FT                   SNTLYSCEGRIIAIEYHASDLCFHITNELPLLQTRGLAPERVLQLHIITSKNFAYFFNR
FT                   SSAYLQRQPLEEKYTQLAQFLGHSFKFNITSSLTLFPDTTVALQIWCPIECTFRELQQQ
FT                   LAHPKVAAAPDSGSLDCAINATVNPLRLLAAQNGVTVKKEEDNDDDAGAVPTS"
FT   gene            65242..65765
FT                   /gene="DTD1"
FT                   /locus_tag="YDL219W"
FT   mRNA            join(65242..65306,65378..65765)
FT                   /gene="DTD1"
FT                   /locus_tag="YDL219W"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT   CDS_pept        join(65242..65306,65378..65765)
FT                   /codon_start=1
FT                   /gene="DTD1"
FT                   /locus_tag="YDL219W"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.1.96"
FT                   /note="D-Tyr-tRNA(Tyr) deacylase; functions in protein
FT                   translation, may affect nonsense suppression via alteration
FT                   of the protein synthesis machinery; ubiquitous among
FT                   eukaryotes"
FT                   /db_xref="GOA:Q07648"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07648"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006399 tRNA
FT                   metabolic process [PMID:10918062]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0051500
FT                   D-tyrosyl-tRNA(Tyr) deacylase activity [PMID:10766779]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0097358
FT                   D-leucyl-tRNA(Leu) deacylase activity [PMID:10918062]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1900829
FT                   D-tyrosine catabolic process [PMID:10918062]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1900832
FT                   D-leucine catabolic process [PMID:10918062]"
FT                   /protein_id="DAA11645.1"
FT                   /translation="MKIVLQKVSQASVVVDSKVISSIKHGYMLLVGISIDDSMAEIDKL
FT                   SKKVLSLRIFEDESRNLWKKNIKEANGEILSVSQFTLMAKTKKGTKPDFHLAQKGHIAK
FT                   ELYEEFLKLLRSDLGEEKVKDGEFGAMMSCSLTNEGPVTIILDSDQ"
FT   gene            66493..67446
FT                   /locus_tag="YDL218W"
FT   mRNA            66493..67446
FT                   /locus_tag="YDL218W"
FT                   /product="hypothetical protein"
FT   CDS_pept        66493..67446
FT                   /codon_start=1
FT                   /locus_tag="YDL218W"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; YDL218W transcription is
FT                   regulated by Azf1p and induced by starvation and aerobic
FT                   conditions; expression also induced in cells treated with
FT                   the mycotoxin patulin"
FT                   /db_xref="GOA:Q07629"
FT                   /db_xref="InterPro:IPR008253"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07629"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:11914276]"
FT                   /protein_id="DAA11646.1"
FT                   /translation="MKRVTGVFLTLLRFSQFASSVLVMSLLAYAIHAYGNRGNKKTNFT
FT                   LATGVISVFYLIALGILCLALPTLIYIGMYFCAELIVCMLWLAAFVVLAKAQGERSCSN
FT                   TNADGLYYNPYSGQYTADSHRRACNSSQAAIAFSGLCFVLFLISVILLGINVLTPIRKR
FT                   YQTQGMWRSGASMGTKLHRWSGLALSEPFEETAAYDNTNVRTGDVEAGAGDNAAYTSEP
FT                   NGDARYATNDPNGQYHTTTTNTRYTTTTADPKTRYTTNDRNPGSANVANSAVDQHAYST
FT                   DESGDRSYQEKVTEGAHSGAMSGSTAEPNRNVNQMP"
FT   gene            complement(67983..68606)
FT                   /gene="TIM22"
FT                   /locus_tag="YDL217C"
FT   mRNA            complement(67983..68606)
FT                   /gene="TIM22"
FT                   /locus_tag="YDL217C"
FT                   /product="translocation channel protein TIM22"
FT   CDS_pept        complement(67983..68606)
FT                   /codon_start=1
FT                   /gene="TIM22"
FT                   /locus_tag="YDL217C"
FT                   /product="translocation channel protein TIM22"
FT                   /note="Essential core component of the mitochondrial TIM22
FT                   complex; involved in insertion of polytopic proteins into
FT                   the inner membrane; forms the channel through which
FT                   proteins are imported"
FT                   /db_xref="GOA:Q12328"
FT                   /db_xref="InterPro:IPR039175"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12328"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008320 protein
FT                   transmembrane transporter activity [PMID:11864609]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030943
FT                   mitochondrion targeting sequence binding [PMID:11864609]"
FT                   /experiment="EXISTENCE:direct assay:GO:0042721 TIM22
FT                   mitochondrial import inner membrane insertion complex
FT                   [PMID:10637294|PMID:10648604]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045039 protein
FT                   insertion into mitochondrial inner membrane
FT                   [PMID:10648604|PMID:8955274]"
FT                   /protein_id="DAA11647.1"
FT                   /translation="MVYTGFGLEQISPAQKKPYNELTPEEQGERGAEMIMNFMTSCPGK
FT                   SVVSGVTGFALGGVLGLFMASMAYDTPLHTPTPANTAATATAGNIGVGGISRTVQQISD
FT                   LPFRQQMKLQFTDMGKKSYSSAKNFGYIGMIYAGVECVIESLRAKNDIYNGVTAGFFTG
FT                   AGLAYKAGPQAALMGGAGFAAFSAAIDLYMKSEDGRPPQNDFKE"
FT   gene            complement(68997..70319)
FT                   /gene="RRI1"
FT                   /gene_synonym="CSN5"
FT                   /gene_synonym="JAB1"
FT                   /locus_tag="YDL216C"
FT   mRNA            complement(68997..70319)
FT                   /gene="RRI1"
FT                   /gene_synonym="CSN5"
FT                   /gene_synonym="JAB1"
FT                   /locus_tag="YDL216C"
FT                   /product="COP9 signalosome catalytic subunit RRI1"
FT   CDS_pept        complement(68997..70319)
FT                   /codon_start=1
FT                   /gene="RRI1"
FT                   /gene_synonym="CSN5"
FT                   /gene_synonym="JAB1"
FT                   /locus_tag="YDL216C"
FT                   /product="COP9 signalosome catalytic subunit RRI1"
FT                   /note="Catalytic subunit of the COP9 signalosome (CSN)
FT                   complex; acts as an isopeptidase in cleaving the
FT                   ubiquitin-like protein Nedd8 from SCF ubiquitin ligases;
FT                   metalloendopeptidase involved in the adaptation to
FT                   pheromone signaling; involved in modulation of genes
FT                   controlling amino acid and lipid metabolism, and ergosterol
FT                   biosynthesis"
FT                   /db_xref="GOA:Q12468"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR037740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12468"
FT                   /experiment="EXISTENCE:direct assay:GO:0008180 COP9
FT                   signalosome [PMID:12446563]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000338 protein
FT                   deneddylation [PMID:12186635|PMID:12446563|PMID:24164706]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000754
FT                   adaptation of signaling pathway by response to pheromone
FT                   involved in conjugation with cellular fusion
FT                   [PMID:12446563]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004222
FT                   metalloendopeptidase activity [PMID:12183637]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0070452 positive
FT                   regulation of ergosterol biosynthetic process
FT                   [PMID:24164706]"
FT                   /protein_id="DAA11648.1"
FT                   /translation="MSLSNKTVKELRQLLKERYTVEDELTESIALSSMRFKPSQEPEFH
FT                   ALSQSSLLKTKLKQQSSTDIPSYTHVLISKLSCEKITHYAVRGGNIEIMGILMGFTLKD
FT                   NIVVMDCFNLPVVGTETRVNAQLESYEYMVQYIDEMYNHNDGGDGRDYKGAKLNVVGWF
FT                   HSHPGYDCWLSNIDIQTQDLNQRFQDPYVAIVVDPLKSLEDKILRMGAFRTIESKSDDN
FT                   SATSYYELETIIFDSELNRALFETKLNLHCVIEDDESEQISLNRLIDSMKQYSYLMDSK
FT                   NVRTRIKLATTSERVSNENKKNIDYQNRSTRSQFCLNTQRGDSTETSSFGSMFSGDNTS
FT                   DVDMEDRNLTEFDSTDTSLCINGEPSIHVNRVERSSRSTDNFHNSKKRMNSNQERCHDE
FT                   GNDMLQRNVLETDYARAKNRILASKIKQYERLRFYKDTFTL"
FT   gene            complement(70640..73918)
FT                   /gene="GDH2"
FT                   /locus_tag="YDL215C"
FT   mRNA            complement(70640..73918)
FT                   /gene="GDH2"
FT                   /locus_tag="YDL215C"
FT                   /product="glutamate dehydrogenase (NAD(+))"
FT   CDS_pept        complement(70640..73918)
FT                   /codon_start=1
FT                   /gene="GDH2"
FT                   /locus_tag="YDL215C"
FT                   /product="glutamate dehydrogenase (NAD(+))"
FT                   /EC_number="1.4.1.2"
FT                   /note="NAD(+)-dependent glutamate dehydrogenase; degrades
FT                   glutamate to ammonia and alpha-ketoglutarate; expression
FT                   sensitive to nitrogen catabolite repression and
FT                   intracellular ammonia levels; genetically interacts with
FT                   GDH3 by suppressing stress-induced apoptosis"
FT                   /db_xref="GOA:P33327"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR016210"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P33327"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004352
FT                   glutamate dehydrogenase (NAD+) activity [PMID:1975578]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006807 nitrogen
FT                   compound metabolic process [PMID:1975578]"
FT                   /protein_id="DAA11649.1"
FT                   /translation="MLFDNKNRGALNSLNTPDIASLSISSMSDYHVFDFPGKDLQREEV
FT                   IDLLDQQGFIPDDLIEQEVDWFYNSLGIDDLFFSRESPQLISNIIHSLYASKLDFFAKS
FT                   KFNGIQPRLFSIKNKIITNDNHAIFMESNTGVSISDSQQKNFKFASDAVGNDTLEHGKD
FT                   TIKKNRIEMDDSCPPYELDSEIDDLFLDNKSQKNCRLVSFWAPESELKLTFVYESVYPN
FT                   DDPAGVDISSQDLLKGDIESISDKTMYKVSSNENKKLYGLLLKLVKEREGPVIKTTRSV
FT                   ENKDEIRLLVAYKRFTTKRYYSALNSLFHYYKLKPSKFYLESFNVKDDDIIIFSVYLNE
FT                   NQQLEDVLLHDVEAALKQVEREASLLYAIPNNSFHEVYQRRQFSPKEAIYAHIGAIFIN
FT                   HFVNRLGSDYQNLLSQITIKRNDTTLLEIVENLKRKLRNETLTQQTIINIMSKHYTIIS
FT                   KLYKNFAQIHYYHNSTKDMEKTLSFQRLEKVEPFKNDQEFEAYLNKFIPNDSPDLLILK
FT                   TLNIFNKSILKTNFFITRKVAISFRLDPSLVMTKFEYPETPYGIFFVVGNTFKGFHIRF
FT                   RDIARGGIRIVCSRNQDIYDLNSKNVIDENYQLASTQQRKNKDIPEGGSKGVILLNPGL
FT                   VEHDQTFVAFSQYVDAMIDILINDPLKENYVNLLPKEEILFFGPDEGTAGFVDWATNHA
FT                   RVRNCPWWKSFLTGKSPSLGGIPHDEYGMTSLGVRAYVNKIYETLNLTNSTVYKFQTGG
FT                   PDGDLGSNEILLSSPNECYLAILDGSGVLCDPKGLDKDELCRLAHERKMISDFDTSKLS
FT                   NNGFFVSVDAMDIMLPNGTIVANGTTFRNTFHTQIFKFVDHVDIFVPCGGRPNSITLNN
FT                   LHYFVDEKTGKCKIPYIVEGANLFITQPAKNALEEHGCILFKDASANKGGVTSSSMEVL
FT                   ASLALNDNDFVHKFIGDVSGERSALYKSYVVEVQSRIQKNAELEFGQLWNLNQLNGTHI
FT                   SEISNQLSFTINKLNDDLVASQELWLNDLKLRNYLLLDKIIPKILIDVAGPQSVLENIP
FT                   ESYLKVLLSSYLSSTFVYQNGIDVNIGKFLEFIGGLKREAEASA"
FT   gene            complement(74446..76545)
FT                   /gene="PRR2"
FT                   /locus_tag="YDL214C"
FT   mRNA            complement(74446..76545)
FT                   /gene="PRR2"
FT                   /locus_tag="YDL214C"
FT                   /product="serine/threonine protein kinase PRR2"
FT   CDS_pept        complement(74446..76545)
FT                   /codon_start=1
FT                   /gene="PRR2"
FT                   /locus_tag="YDL214C"
FT                   /product="serine/threonine protein kinase PRR2"
FT                   /EC_number="2.7.11.1"
FT                   /note="Serine/threonine protein kinase; inhibits pheromone
FT                   induced signalling downstream of MAPK, possibly at the
FT                   level of the Ste12p transcription factor; mutant has
FT                   increased aneuploidy tolerance; PRR2 has a paralog, NPR1,
FT                   that arose from the whole genome duplication"
FT                   /db_xref="GOA:Q12310"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12310"
FT                   /experiment="EXISTENCE:direct assay:GO:0004672 protein
FT                   kinase activity [PMID:16319894]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006468 protein
FT                   phosphorylation [PMID:16319894]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0031138
FT                   negative regulation of conjugation with cellular fusion
FT                   [PMID:11337509]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0046020
FT                   negative regulation of transcription from RNA polymerase II
FT                   promoter by pheromones [PMID:11337509]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031138 negative
FT                   regulation of conjugation with cellular fusion
FT                   [PMID:11337509]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0046020 negative
FT                   regulation of transcription from RNA polymerase II promoter
FT                   by pheromones [PMID:11337509]"
FT                   /protein_id="DAA11650.1"
FT                   /translation="MSLSRILRYNQRNNKTTASLTAEHAYSDNWAYSVSLGDPTSVGVN
FT                   MAAKTGEALNKSYDSVFSSLPVADSVPRTDFTASSRDDENTDVQKLTTSWMEKIDTKMP
FT                   ENISKIDSNIISSPMVSKVEARFIVPKGRLRKNSTDFTSSFSNSLSLPKSYGKLIFFTS
FT                   KKNSSSTKKNLANDISDNKHNNNSSNTIGHNIPVTTATATCDEIACTSTEHEYNVYEEE
FT                   RMFTTRVYSLEDSVSSLSTNPLDDTYSEAVQVNTRHIEDTESTAHIRKHSYTTSLSSIK
FT                   RLFKITSFSNNNSNSCDHQESTVADDCAISSSLKETTSSPVSTGSFSLMIENEDSDRDQ
FT                   IIQALYSNIEASTDLVSRKYRDLDVVLGEGSGGKVKLVQRVLDNKVFALKEYRSKKKRE
FT                   SERKYIKNIISEYCIASTLKNPNICETLEILYEKGKIFQILEYCEYDLFSLVMSEKMHY
FT                   EEICCLFKQLINGVKYLHDIGLSHRDLKLDNCVVTRRGILKLIDFGASSVFHYPLSSQM
FT                   IEANGIVGSDPYLSPEVFYFNEYDPRALDVWSVGIIFFCMITRRFPWKYPKVKDVQFKA
FT                   FCSGRGVSSFKDLVTRPATDDSNNYDNDGYEEGVIDMGPNFILHRLPEETHKIMRRILE
FT                   VSPFRRITINGILQDGWIKEIETCQVVGAASPNEASLRIINKGNHIHTNIDQRYAHIGG
FT                   LHQRT"
FT   gene            complement(77289..77966)
FT                   /gene="NOP6"
FT                   /locus_tag="YDL213C"
FT   mRNA            complement(77289..77966)
FT                   /gene="NOP6"
FT                   /locus_tag="YDL213C"
FT                   /product="Nop6p"
FT   CDS_pept        complement(77289..77966)
FT                   /codon_start=1
FT                   /gene="NOP6"
FT                   /locus_tag="YDL213C"
FT                   /product="Nop6p"
FT                   /note="rRNA-binding protein required for 40S ribosomal
FT                   subunit biogenesis; contains an RNA recognition motif
FT                   (RRM); hydrophilin essential to overcome the stress of the
FT                   desiccation-rehydration process; NOP6 may be a
FT                   fungal-specific gene as no homologs have been yet
FT                   identified in higher eukaryotes"
FT                   /db_xref="GOA:Q07623"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034228"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="PDB:2MZJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07623"
FT                   /experiment="EXISTENCE:direct assay:GO:0005730 nucleolus
FT                   [PMID:17425675|PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0019843 rRNA binding
FT                   [PMID:21282979]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030515 snoRNA
FT                   binding [PMID:21893585]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030686 90S
FT                   preribosome [PMID:22588997|PMID:21282979]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0042274
FT                   ribosomal small subunit biogenesis [PMID:17425675]"
FT                   /protein_id="DAA11651.1"
FT                   /translation="MGSEEDKKLTKKQLKAQQFRKSKEEKDQEKDVKKEQAPEGKRPNS
FT                   AAGNDGEEPVKKKRKTRRGRGGKGKNGKKGNRFIVFVGSLPRDITAVELQNHFKNSSPD
FT                   QIRLRADKGIAFLEFDADKDRTGIQRRMDIALLQHGTLLKEKKINVELTVGGGGNSQER
FT                   LEKLKNKNIKLDEERKERLTKMINDGNQKKIAKTTATAAQTSGTDNKPVPAGIHPDRAK
FT                   LLK"
FT   gene            78426..79058
FT                   /gene="SHR3"
FT                   /gene_synonym="APF1"
FT                   /locus_tag="YDL212W"
FT   mRNA            78426..79058
FT                   /gene="SHR3"
FT                   /gene_synonym="APF1"
FT                   /locus_tag="YDL212W"
FT                   /product="Shr3p"
FT   CDS_pept        78426..79058
FT                   /codon_start=1
FT                   /gene="SHR3"
FT                   /gene_synonym="APF1"
FT                   /locus_tag="YDL212W"
FT                   /product="Shr3p"
FT                   /note="Endoplasmic reticulum packaging chaperone; required
FT                   for incorporation of amino acid permeases into COPII coated
FT                   vesicles for transport to the cell surface"
FT                   /db_xref="GOA:Q02774"
FT                   /db_xref="InterPro:IPR013248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02774"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030176 integral
FT                   component of endoplasmic reticulum membrane
FT                   [PMID:1423607|PMID:15623581]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043332 mating
FT                   projection tip [PMID:19053807]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0090114
FT                   COPII-coated vesicle budding [PMID:10564255]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006457 protein
FT                   folding [PMID:15623581]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0051082 unfolded
FT                   protein binding [PMID:10564255|PMID:15623581]"
FT                   /protein_id="DAA11652.1"
FT                   /translation="MFSYSDFCSIGTAMILSATTFLMGVFFSNMPYDYHLLFNPNSTQE
FT                   HFDLALRHYQILHETPLPVIVTLCVVAGIGLVGGTIKVFKPNPELQMFEYCSLGLYVLA
FT                   ICVFLTNVKTGIDCSVSHNWGEVTENQGLAVIASSNIILLVMFAGVIILQIGLWYSNWD
FT                   LQKRLKEFYAQEEREAANAGKKTEKVDNAKKNDNKSKGAQKRKNAKK"
FT   gene            complement(79294..80412)
FT                   /locus_tag="YDL211C"
FT   mRNA            complement(79294..80412)
FT                   /locus_tag="YDL211C"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(79294..80412)
FT                   /codon_start=1
FT                   /locus_tag="YDL211C"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; green fluorescent protein
FT                   (GFP)-fusion protein localizes to the vacuole; YDL211C has
FT                   a paralog, TDA7, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:Q12121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12121"
FT                   /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
FT                   vacuole [PMID:14562095]"
FT                   /protein_id="DAA11653.1"
FT                   /translation="MLLNVTSSQYISTPQSRSLSEIDTSETASLSSATDHIFALSTEVV
FT                   SSITTNLIEGLESSIQVPISTAYGTTSFRNNTSSPQYLVSNCTSSVQSNITIDRGLLST
FT                   LKTFTTSQVPTIEPSTTKLTTPLSTTFTSTSTSEIYSVFTSENSVYIIYDQEYKFTERS
FT                   TTFNTHFPQTTVLQESNPPLTFTIPSNTITGDAKLYQYLSGALNTQDTSDANNRRTGVI
FT                   VGSTVGVVIGVVIVIFIGFIIIRNRRNVKNHSKKGFSHDIGKRVSCDEVTETEAPSNPF
FT                   LNVLNYKVTTNGEGKRDSFENGRDLHRASSSDGIYIAHPYYGMADHESGRFSYVSSYNE
FT                   SAESSIEETSSSASTITRPNIQQTNSFLREII"
FT   gene            83548..83618
FT                   /locus_tag="tG(GCC)D1"
FT   tRNA            83548..83618
FT                   /locus_tag="tG(GCC)D1"
FT                   /product="tRNA-Gly"
FT                   /note="tG(GCC)D1; Glycine tRNA (tRNA-Gly), predicted by
FT                   tRNAscan-SE analysis"
FT                   /experiment="EXISTENCE:curator inference:GO:0005829 cytosol
FT                   [PMID:9023104]"
FT                   /experiment="EXISTENCE:curator inference:GO:0006414
FT                   translational elongation [PMID:9023104]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030371 translation
FT                   repressor activity [PMID:27609601]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043022 ribosome
FT                   binding [PMID:27609601]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043555 regulation
FT                   of translation in response to stress [PMID:27609601]"
FT   gene            84270..85985
FT                   /gene="UGA4"
FT                   /locus_tag="YDL210W"
FT   mRNA            84270..85985
FT                   /gene="UGA4"
FT                   /locus_tag="YDL210W"
FT                   /product="Uga4p"
FT   CDS_pept        84270..85985
FT                   /codon_start=1
FT                   /gene="UGA4"
FT                   /locus_tag="YDL210W"
FT                   /product="Uga4p"
FT                   /note="GABA (gamma-aminobutyrate) permease; serves as a
FT                   GABA transport protein involved in the utilization of GABA
FT                   as a nitrogen source; catalyzes the transport of putrescine
FT                   and delta-aminolevulinic acid (ALA); localized to the
FT                   vacuolar membrane"
FT                   /db_xref="GOA:P32837"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32837"
FT                   /experiment="EXISTENCE:direct assay:GO:0000329 fungal-type
FT                   vacuole membrane [PMID:14985124|PMID:26928762]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0015495
FT                   gamma-aminobutyric acid:proton symporter activity
FT                   [PMID:8455553]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0015812
FT                   gamma-aminobutyric acid transport [PMID:8455553]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0055085
FT                   transmembrane transport [PMID:8455553]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0015489
FT                   putrescine transmembrane transporter activity
FT                   [PMID:14985124]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0015812
FT                   gamma-aminobutyric acid transport [PMID:14985124]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0015847
FT                   putrescine transport [PMID:14985124]"
FT                   /protein_id="DAA11654.1"
FT                   /translation="MSMSSKNENKISVEQRISTDIGQAYQLQGLGSNLRSIRSKTGAGE
FT                   VNYIDAAKSVNDNQLLAEIGYKQELKRQFSTLQVFGIAFSIMGLLPSIASVMGGGLGGG
FT                   PATLVWGWFVAAFFILLVGITMAEHASSIPTAGGLYYWTYYYAPEGYKEIISFIIGCSN
FT                   SLALAAGVCSIDYGLAEEIAAAVTLTKDGNFEVTSGKLYGIFAGAVVVMCICTCVASGA
FT                   IARLQTLSIFANLFIIVLLFIALPIGTKHRMGGFNDGDFIFGKYENLSDWNNGWQFCLA
FT                   GFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIISSIAVCWILGWLIIICLMACINPDI
FT                   DSVLDSKYGFALAQIIYDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNG
FT                   LPLSKYIKRVDSKYSVPFFAILAACVGSLILGLLCLIDDAATDALFSLAVAGNNLAWST
FT                   PTVFRLTSGRDLFRPGPFYLGKIWSPIVAWTGVAFQLFIIILVMFPSQQHGITKSTMNY
FT                   ACVIGPGIWILAGIYYKVYKKKYYHGPATNLSDDDYTEAVGADVIDTIMSKQEP"
FT   rep_origin      85945..86176
FT                   /note="ARS405; Autonomously Replicating Sequence"
FT   gene            complement(86207..87226)
FT                   /gene="CWC2"
FT                   /gene_synonym="NTC40"
FT                   /locus_tag="YDL209C"
FT   mRNA            complement(86207..87226)
FT                   /gene="CWC2"
FT                   /gene_synonym="NTC40"
FT                   /locus_tag="YDL209C"
FT                   /product="Cwc2p"
FT   CDS_pept        complement(86207..87226)
FT                   /codon_start=1
FT                   /gene="CWC2"
FT                   /gene_synonym="NTC40"
FT                   /locus_tag="YDL209C"
FT                   /product="Cwc2p"
FT                   /note="Member of the NineTeen Complex (NTC); this complex
FT                   contains Prp19p and stabilizes U6 snRNA in catalytic forms
FT                   of the spliceosome containing U2, U5, and U6 snRNAs; binds
FT                   directly to U6 snRNA; similar to S. pombe Cwf2"
FT                   /db_xref="GOA:Q12046"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR032297"
FT                   /db_xref="InterPro:IPR034181"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039171"
FT                   /db_xref="InterPro:IPR039173"
FT                   /db_xref="PDB:3TP2"
FT                   /db_xref="PDB:3U1L"
FT                   /db_xref="PDB:3U1M"
FT                   /db_xref="PDB:5GM6"
FT                   /db_xref="PDB:5GMK"
FT                   /db_xref="PDB:5LJ3"
FT                   /db_xref="PDB:5LJ5"
FT                   /db_xref="PDB:5LQW"
FT                   /db_xref="PDB:5MPS"
FT                   /db_xref="PDB:5MQ0"
FT                   /db_xref="PDB:5WSG"
FT                   /db_xref="PDB:5Y88"
FT                   /db_xref="PDB:5YLZ"
FT                   /db_xref="PDB:6BK8"
FT                   /db_xref="PDB:6EXN"
FT                   /db_xref="PDB:6J6G"
FT                   /db_xref="PDB:6J6H"
FT                   /db_xref="PDB:6J6N"
FT                   /db_xref="PDB:6J6Q"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12046"
FT                   /experiment="EXISTENCE:curator inference:GO:0000384 first
FT                   spliceosomal transesterification activity [PMID:19435883]"
FT                   /experiment="EXISTENCE:curator inference:GO:0000386 second
FT                   spliceosomal transesterification activity [PMID:19435883]"
FT                   /experiment="EXISTENCE:direct assay:GO:0017070 U6 snRNA
FT                   binding [PMID:19435883]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071006 U2-type
FT                   catalytic step 1 spliceosome [PMID:19435883]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071007 U2-type
FT                   catalytic step 2 spliceosome [PMID:19435883]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000398 mRNA
FT                   splicing, via spliceosome [PMID:12088152]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0000974
FT                   Prp19 complex [PMID:12088152]"
FT                   /protein_id="DAA11655.1"
FT                   /translation="MTSWRDKSAKVQVKESELPSSIPAQTGLTFNIWYNKWSQGFAGNT
FT                   RFVSPFALQPQLHSGKTRGDNDGQLFFCLFFAKGMCCLGPKCEYLHHIPDEEDIGKLAL
FT                   RTEVLDCFGREKFADYREDMGGIGSFRKKNKTLYVGGIDGALNSKHLKPAQIESRIRFV
FT                   FSRLGDIDRIRYVESKNCGFVKFKYQANAEFAKEAMSNQTLLLPSDKEWDDRREGTGLL
FT                   VKWANEDPDPAAQKRLQEELKLESLNMMVHLINNNTNSAGTEVNNKNNERLDRTFPEAS
FT                   VDNVKKRLLPLDNGMESDDFIEKLKKVKKNISRENISSKPSVGKLGGPLLDYLSSDED"
FT   gene            87512..87982
FT                   /gene="NHP2"
FT                   /locus_tag="YDL208W"
FT   mRNA            87512..87982
FT                   /gene="NHP2"
FT                   /locus_tag="YDL208W"
FT                   /product="snoRNA-binding protein NHP2"
FT   CDS_pept        87512..87982
FT                   /codon_start=1
FT                   /gene="NHP2"
FT                   /locus_tag="YDL208W"
FT                   /product="snoRNA-binding protein NHP2"
FT                   /note="Protein related to mammalian high mobility group
FT                   (HMG) proteins; nuclear protein; essential for function of
FT                   H/ACA-type snoRNPs, which are involved in 18S rRNA
FT                   processing"
FT                   /db_xref="GOA:P32495"
FT                   /db_xref="InterPro:IPR002415"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="PDB:2LBW"
FT                   /db_xref="PDB:2LBX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32495"
FT                   /experiment="EXISTENCE:direct assay:GO:0005730 nucleolus
FT                   [PMID:11433018|PMID:9843512]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031120 snRNA
FT                   pseudouridine synthesis [PMID:15962000]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000469 cleavage
FT                   involved in rRNA processing [PMID:9843512]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031118 rRNA
FT                   pseudouridine synthesis [PMID:9843512]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031120 snRNA
FT                   pseudouridine synthesis [PMID:15962000]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0031429 box
FT                   H/ACA snoRNP complex [PMID:9843512]"
FT                   /protein_id="DAA11656.1"
FT                   /translation="MGKDNKEHKESKESKTVDNYEARMPAVLPFAKPLASKKLNKKVLK
FT                   TVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFI
FT                   PSKQDLGAAGATKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQAL"
FT   gene            88248..89864
FT                   /gene="GLE1"
FT                   /gene_synonym="BRR3"
FT                   /gene_synonym="NLE2"
FT                   /gene_synonym="RSS1"
FT                   /locus_tag="YDL207W"
FT   mRNA            88248..89864
FT                   /gene="GLE1"
FT                   /gene_synonym="BRR3"
FT                   /gene_synonym="NLE2"
FT                   /gene_synonym="RSS1"
FT                   /locus_tag="YDL207W"
FT                   /product="nucleoporin GLE1"
FT   CDS_pept        88248..89864
FT                   /codon_start=1
FT                   /gene="GLE1"
FT                   /gene_synonym="BRR3"
FT                   /gene_synonym="RSS1"
FT                   /gene_synonym="NLE2"
FT                   /locus_tag="YDL207W"
FT                   /product="nucleoporin GLE1"
FT                   /note="Cytoplasmic nucleoporin required for polyadenylated
FT                   mRNA export; contains a nuclear export signal; when bound
FT                   to inositol hexakisphosphate (IP6), functions as an
FT                   activator for the Dbp5p ATPase activity at the nuclear pore
FT                   complex during mRNA export; mediates translation
FT                   initiation; required for efficient translation termination"
FT                   /db_xref="GOA:Q12315"
FT                   /db_xref="InterPro:IPR012476"
FT                   /db_xref="InterPro:IPR038506"
FT                   /db_xref="PDB:3PEU"
FT                   /db_xref="PDB:3PEV"
FT                   /db_xref="PDB:3RRM"
FT                   /db_xref="PDB:3RRN"
FT                   /db_xref="PDB:6B4E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12315"
FT                   /experiment="EXISTENCE:direct assay:GO:0000822 inositol
FT                   hexakisphosphate binding [PMID:16783363]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005543 phospholipid
FT                   binding [PMID:17897934]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005643 nuclear pore
FT                   [PMID:10684247|PMID:15459192]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:10610322]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006409 tRNA export
FT                   from nucleus [PMID:31453808]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008047 enzyme
FT                   activator activity [PMID:16783364]"
FT                   /experiment="EXISTENCE:direct assay:GO:0044614 nuclear pore
FT                   cytoplasmic filaments [PMID:10610322]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0008047
FT                   enzyme activator activity [PMID:16783364]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006406 mRNA
FT                   export from nucleus [PMID:20371601]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006446
FT                   regulation of translational initiation [PMID:18724935]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006449
FT                   regulation of translational termination [PMID:20371601]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0008047 enzyme
FT                   activator activity [PMID:16783364]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016973 poly(A)+
FT                   mRNA export from nucleus [PMID:27385342|PMID:8898365]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0031369
FT                   translation initiation factor binding [PMID:18724935]"
FT                   /protein_id="DAA11657.1"
FT                   /translation="MRFVFDEVFNSDTDSPEFEETCSTTSSTSSQCPTPEPSPAIKLPS
FT                   FTKVGTKKLVNESVVILDPALENALRDLNLQSKLIPINEPIVAASSIIVPHSTNMPLPR
FT                   ASHSSLLDNAKNSNATAPLLEAIEESFQRKMQNLVLANQKEIQSIRENKRRVEEQRKRK
FT                   EEEERKRKEAEEKAKREQELLRQKKDEEERKRKEAEAKLAQQKQEEERKKIEEQNEKER
FT                   QLKKEHEAKLLQQKDKLGKAVTNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNL
FT                   LSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVHQAE
FT                   TEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMG
FT                   WKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARIC
FT                   NTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAAR
FT                   LRILLEAWQNNNMESFPEMSP"
FT   gene            90176..92464
FT                   /locus_tag="YDL206W"
FT   mRNA            90176..92464
FT                   /locus_tag="YDL206W"
FT                   /product="hypothetical protein"
FT   CDS_pept        90176..92464
FT                   /codon_start=1
FT                   /locus_tag="YDL206W"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; YDL206W is not an essential
FT                   protein"
FT                   /db_xref="GOA:Q12424"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12424"
FT                   /experiment="EXISTENCE:direct assay:GO:0000329 fungal-type
FT                   vacuole membrane [PMID:26928762]"
FT                   /protein_id="DAA11658.1"
FT                   /translation="MHKPLRWLITIAFYVSNVILIGYSLSSNGSISEFYLHSVVLIECF
FT                   SLLGVVTSDCLTPSLSYISSNIFHISDRVSGMTLLALGNALPDITSTYQSMKSGVTSLA
FT                   IGELFGGIFFLLTVVIGLMGCVATIQFQHDKSIETYTEESFDQNLSYDRSNYILDVGIF
FT                   TFMLLVSGTFLADGRLYFWECIVMVLTYCCCAVYLIKSYKYPCEINDALEREVEIKKTV
FT                   LANNHITVPNRFTLTTTSDITSTDDGIRYVRPLGDTQIDEDNAISLDPTRLPSKSLDNI
FT                   SRFNQGIPERRDLIRRRIRGYLRSHYHGWVRMTLQDLLNIWEKQNLFNNTVKSLSLPSD
FT                   DTHLFTKASLDEEGRPLIRKRMNSLQPKDFYKYLSLRNGENSNALDTAISAPQNEYQTY
FT                   YNEPTSLFLTVPQKKTSKKSLSCDRIPNLVRSNNIILNDEATRTQESTNALNSISDVID
FT                   NSLLQYERDDIILDRTLSLCSTKSRTAWHSFQLYNYLTDVSLEIGFFEFLSLLVTTPVS
FT                   IILYLSIPSEISQTDHDLPLSYLQNIQLIASPIILNQLITNNFSFWLLILSLVIAILLY
FT                   FKTRTIPNKFNSDIIFTVAFLLSLACLSKAVHIIVVTLTHWINVFNISETILGLTIFTW
FT                   GNSIGDLVSNITFVKIGVLEIAIGACFGSPLLYFLFGVGFDGIMIMLGDKTGKIVSGRD
FT                   SNILMHHIDFKVDKNLINTGVGILIAFLIFTVLIPLNDWKIDKKISIALLTLYIVVTCI
FT                   SVFLEVHQV"
FT   gene            complement(92762..93745)
FT                   /gene="HEM3"
FT                   /gene_synonym="OLE2"
FT                   /locus_tag="YDL205C"
FT   mRNA            complement(92762..93745)
FT                   /gene="HEM3"
FT                   /gene_synonym="OLE2"
FT                   /locus_tag="YDL205C"
FT                   /product="hydroxymethylbilane synthase"
FT   CDS_pept        complement(92762..93745)
FT                   /codon_start=1
FT                   /gene="HEM3"
FT                   /gene_synonym="OLE2"
FT                   /locus_tag="YDL205C"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="Porphobilinogen deaminase; catalyzes the conversion
FT                   of 4-porphobilinogen to hydroxymethylbilane, the third step
FT                   in heme biosynthesis; localizes to the cytoplasm and
FT                   nucleus; expression is regulated by Hap2p-Hap3p, but not by
FT                   levels of heme; human homolog HMBS can complement yeast
FT                   mutant and allow growth of haploid null after sporulation
FT                   of a heterozygous diploid"
FT                   /db_xref="GOA:P28789"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28789"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004418
FT                   hydroxymethylbilane synthase activity
FT                   [PMID:1508149|PMID:323256]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006783 heme
FT                   biosynthetic process [PMID:14559249|PMID:323256]"
FT                   /protein_id="DAA11659.1"
FT                   /translation="MGPETLHIGGRKSKLAVIQSNHVLKLIEEKYPDYDCKVFTLQTLG
FT                   DQIQFKPLYSFGGKALWTKELEDHLYHDDPSKKLDLIVHSLKDMPTLLPEGFELGGITK
FT                   RVDPTDCLVMPFYSAYKSLDDLPDGGIVGTSSVRRSAQLKRKYPHLKFESVRGNIQTRL
FT                   QKLDDPKSPYQCIILASAGLMRMGLENRITQRFHSDTMYHAVGQGALGIEIRKGDTKMM
FT                   KILDEICDLNATICCLSERALMRTLEGGCSVPIGVESKYNEETKKLLLKAIVVDVEGTE
FT                   AVEDEIEMLIENVKEDSMACGKILAERMIADGAKKILDEINLDRIK"
FT   gene            94605..95786
FT                   /gene="RTN2"
FT                   /locus_tag="YDL204W"
FT   mRNA            94605..95786
FT                   /gene="RTN2"
FT                   /locus_tag="YDL204W"
FT                   /product="Rtn2p"
FT   CDS_pept        94605..95786
FT                   /codon_start=1
FT                   /gene="RTN2"
FT                   /locus_tag="YDL204W"
FT                   /product="Rtn2p"
FT                   /note="Reticulon protein; involved in nuclear pore assembly
FT                   and maintenance of tubular ER morphology; promotes membrane
FT                   curvature; regulates the ER asymmetry-induced inheritance
FT                   block during ER stress; role in ER-derived peroxisomal
FT                   biogenesis; interacts with Sec6p, Yip3p, and Sbh1p; less
FT                   abundant than RTN1; member of RTNLA (reticulon-like A)
FT                   subfamily; protein increases in abundance and relocalizes
FT                   to plasma membrane upon DNA replication stress"
FT                   /db_xref="GOA:Q12443"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12443"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032541 cortical
FT                   endoplasmic reticulum [PMID:17905927]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071782 endoplasmic
FT                   reticulum tubular network [PMID:16469703]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0032581
FT                   ER-dependent peroxisome organization [PMID:27129769]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0034976
FT                   response to endoplasmic reticulum stress [PMID:27117666]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0048309
FT                   endoplasmic reticulum inheritance [PMID:27117666]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0071786
FT                   endoplasmic reticulum tubular network organization
FT                   [PMID:16469703|PMID:18309084|PMID:18442980]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0071788
FT                   endoplasmic reticulum tubular network maintenance
FT                   [PMID:21502358]"
FT                   /protein_id="DAA11660.1"
FT                   /translation="MNRNTTTNKNANLNNSRNANAPGEAGHQNKTGLIYWTNPSKSGAS
FT                   FAATLVSLLILRNVNVISVLLKIGYMVLFTSFAVELSTKVLFDKGVVSRFGMQESPDLV
FT                   GVLKPHIDRELDRLPALEDRIRKLVFAHRTRNNFTIGVSLYFLHGLFAIFSMNTVLIMT
FT                   TIFLYTVPLIYDRKQARIDRAIDRMKDLVIHRFHKNYNKVVEKTEPYIDKIIPPQTDEG
FT                   SYSTSISNENKSSTSQRNKSGLSSSEFDNMNDTSASKSGKDSYSTSQYNRAEYPVSQNE
FT                   NIGTLKSGKQEIPTEKDFNNRHENFSKPDVKTYDPRTVDIEEELAAHQRELEQNLKDGD
FT                   YNLVGSKEIPDPITVPAPTRHTTKPAESQSIPIKNNETLHKTTHGLKQKLQHA"
FT   gene            complement(96082..97953)
FT                   /gene="ACK1"
FT                   /locus_tag="YDL203C"
FT   mRNA            complement(96082..97953)
FT                   /gene="ACK1"
FT                   /locus_tag="YDL203C"
FT                   /product="Ack1p"
FT   CDS_pept        complement(96082..97953)
FT                   /codon_start=1
FT                   /gene="ACK1"
FT                   /locus_tag="YDL203C"
FT                   /product="Ack1p"
FT                   /note="Protein that functions in the cell wall integrity
FT                   pathway; functions upstream of Pkc1p; GFP-fusion protein
FT                   expression is induced in response to the DNA-damaging agent
FT                   MMS; non-tagged Ack1p is detected in purified mitochondria"
FT                   /db_xref="GOA:Q07622"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07622"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0009967 positive
FT                   regulation of signal transduction [PMID:18806213]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031505
FT                   fungal-type cell wall organization [PMID:18806213]"
FT                   /protein_id="DAA11661.1"
FT                   /translation="MVNQGQPQPNLYDKHINMFPPARARESSHKLGNANSDRHGLPAQN
FT                   IVPAPYPVDDSIVELTPAIPFTSPSSSSSLSLPLSALNFTDGNADGGQLGTPVTINSNN
FT                   GMDIFNSKPTGEIGYANNGTNSTGSRYELPFNFSSTKESLGSPAVQDASISSGNRISES
FT                   VRDNSAPPPYEESESRILQEKVYRTEEKAPIRPLNNNPVPPQKINQPPTGSAKTDDNGS
FT                   SGGEDKLSSYSPEALAFYQVYKKTITDSSKFTPEIQMQWCETLLTYAFNEDFISQYNIN
FT                   AEKLKRSLKPEEMLKNQKVILEHSFKVLTKLITLKWPPAMYLMGTLYSHQPYLPIKNKN
FT                   IVIKNDEKALEYYCKAAKLNNSDACYRAGVCFEYQRGTSSLDPSPTKEQCIKKAFQYYQ
FT                   HGAEVCSNSACMYKLGMSHLYGLNMQKTDVLLAIKWFDKAAQKGDSPQTLYELGKIYEF
FT                   SVLPPEIQNLLFANGIRKDSQLAIKYYQQCAKDFEYPLAQWKLGNCYEFGDLGLPVVAK
FT                   KSIYWYSKAAAAQPKGNPMAMLSLSGWYLTGAPNILKPNNKEAFNWALKSSKCSDGKLA
FT                   RTEFALGFYYEKGVGCEVDLDLAKQYYQRAARMGFRKAVDALRSLTN"
FT   gene            98475..99224
FT                   /gene="MRPL11"
FT                   /gene_synonym="uL10m"
FT                   /locus_tag="YDL202W"
FT   mRNA            98475..99224
FT                   /gene="MRPL11"
FT                   /gene_synonym="uL10m"
FT                   /locus_tag="YDL202W"
FT                   /product="mitochondrial 54S ribosomal protein YmL11"
FT   CDS_pept        98475..99224
FT                   /codon_start=1
FT                   /gene="MRPL11"
FT                   /gene_synonym="uL10m"
FT                   /locus_tag="YDL202W"
FT                   /product="mitochondrial 54S ribosomal protein YmL11"
FT                   /note="Mitochondrial ribosomal protein of the large
FT                   subunit; localizes to vacuole in response to H2O2"
FT                   /db_xref="GOA:P36521"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniProtKB/Swiss-Prot:P36521"
FT                   /experiment="EXISTENCE:curator inference:GO:0032543
FT                   mitochondrial translation [PMID:9151978]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003735 structural
FT                   constituent of ribosome [PMID:9151978]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005762
FT                   mitochondrial large ribosomal subunit [PMID:9151978]"
FT                   /protein_id="DAA11662.1"
FT                   /translation="MLQLRFMPGWVPRNGFFGLKETIGTVHKRFYALASEQPSRKTVKP
FT                   LDSRKTFLIDTYKHLMENSSMIFFVHYNNLSKTEDHHFRFKIKQTGGKLTKVRNNLFEV
FT                   YLRNSHLPDPCGFVKRKEQNWKHPLLPLLKGPTATITYEDTNPQQVAKLLKVLQSAQDK
FT                   LMVIGAKVENEVLNVEKINTFKTLPTKPEMQSQLVSVLQMLSGLGLVRTLENSSNALYL
FT                   TLKSHNDNQKPKEDVESTTDAESKGSK"
FT   gene            99561..100421
FT                   /gene="TRM8"
FT                   /locus_tag="YDL201W"
FT   mRNA            99561..100421
FT                   /gene="TRM8"
FT                   /locus_tag="YDL201W"
FT                   /product="tRNA (guanine46-N7)-methyltransferase"
FT   CDS_pept        99561..100421
FT                   /codon_start=1
FT                   /gene="TRM8"
FT                   /locus_tag="YDL201W"
FT                   /product="tRNA (guanine46-N7)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="Catalytic subunit of a tRNA methyltransferase
FT                   complex; Trm8p and Trm82p comprise an enzyme that catalyzes
FT                   a methyl-transfer from S-adenosyl-l-methionine to the N(7)
FT                   atom of guanine at position 46 in tRNA; Trm8 lacks
FT                   catalytic activity if not bound to Trm82p"
FT                   /db_xref="GOA:Q12009"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR025763"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:2VDU"
FT                   /db_xref="PDB:2VDV"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12009"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008176 tRNA
FT                   (guanine-N7-)-methyltransferase activity [PMID:17382321]"
FT                   /experiment="EXISTENCE:direct assay:GO:0106004 tRNA
FT                   (guanine-N7)-methylation [PMID:17382321]"
FT                   /experiment="EXISTENCE:direct assay:GO:0106143 tRNA (m7G46)
FT                   methyltransferase complex
FT                   [PMID:12403464|PMID:17382321|PMID:18184583]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0008176 tRNA
FT                   (guanine-N7-)-methyltransferase activity [PMID:12403464]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0106004 tRNA
FT                   (guanine-N7)-methylation [PMID:12403464]"
FT                   /protein_id="DAA11663.1"
FT                   /translation="MKAKPLSQDPGSKRYAYRINKEENRKELKHVKINESSLVQEGQKI
FT                   DLPKKRYYRQRAHSNPFSDHQLEYPVSPQDMDWSKLYPYYKNAENGQMTKKVTIADIGC
FT                   GFGGLMIDLSPAFPEDLILGMEIRVQVTNYVEDRIIALRNNTASKHGFQNINVLRGNAM
FT                   KFLPNFFEKGQLSKMFFCFPDPHFKQRKHKARIITNTLLSEYAYVLKEGGVVYTITDVK
FT                   DLHEWMVKHLEEHPLFERLSKEWEENDECVKIMRNATEEGKKVERKKGDKFVACFTRLP
FT                   TPAIL"
FT   gene            complement(100501..101067)
FT                   /gene="MGT1"
FT                   /locus_tag="YDL200C"
FT   mRNA            complement(100501..101067)
FT                   /gene="MGT1"
FT                   /locus_tag="YDL200C"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT   CDS_pept        complement(100501..101067)
FT                   /codon_start=1
FT                   /gene="MGT1"
FT                   /locus_tag="YDL200C"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="DNA repair methyltransferase (6-O-methylguanine-DNA
FT                   methylase); involved in protection against DNA alkylation
FT                   damage"
FT                   /db_xref="GOA:P26188"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26188"
FT                   /experiment="EXISTENCE:curator inference:GO:0005634 nucleus
FT                   [PMID:1641326]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003908
FT                   methylated-DNA-[protein]-cysteine S-methyltransferase
FT                   activity [PMID:2065659|PMID:2403555]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006307 DNA
FT                   dealkylation involved in DNA repair [PMID:1641326]"
FT                   /protein_id="DAA11664.1"
FT                   /translation="MKELLYYTFIETEVTGAFLVFREKTQNLVFASLGNDKLFLLGKVE
FT                   GFLKKHEKQDTMYDLQELKEAETYKKSIENYTICLENKMPLPSGAIPFEFLFGTDFQRK
FT                   VWNELLNVEHGHVVTYGDIAKRIGKPTAARSVGRACGSNNLALLVPCHRIVGSNRKLTG
FT                   YKWSCKLKEQLLNNEKENSLSLSRL"
FT   gene            complement(101290..103353)
FT                   /locus_tag="YDL199C"
FT   mRNA            complement(101290..103353)
FT                   /locus_tag="YDL199C"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(101290..103353)
FT                   /codon_start=1
FT                   /locus_tag="YDL199C"
FT                   /product="hypothetical protein"
FT                   /note="Putative transporter; member of the sugar porter
FT                   family"
FT                   /db_xref="GOA:Q12407"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12407"
FT                   /experiment="EXISTENCE:direct assay:GO:0000329 fungal-type
FT                   vacuole membrane [PMID:26928762]"
FT                   /protein_id="DAA11665.1"
FT                   /translation="MKPPLNMSRSNKPLTQEANSSAHIDRAHQLAQDFNSKQDDTALTS
FT                   LPHKNPDIFRFENNITAHSSRRGSLYRDSDATVVLPLSEHTPRLSMDDPYRQLLQQAEI
FT                   SQLRSKKKRHSSRVLRTSFISFVVLVSSLSGLDQGLISGNVMTLSFQKYFHYPLTSPLG
FT                   NIVSIVNLGAFMASLFVYSGILEPCSRKKMLQISTMIYSLGAIVQVLALNQWCLLLGRF
FT                   LLGVGMGFAFSMVIIYQFEFPLPCIRKRTLISIQCVSSVIAYSFGIWINCAFRYLGFAW
FT                   RYPLSTHVALGIILNLMSFYLILESPSWLLKQKNDVEALVLISNVFDDGNFEENQTQLK
FT                   FRVLKRDILLKSHLQKNSYPYAYILKDFSSIIKLLIGFQLLTRTNGVDAFLYYSPLILQ
FT                   QMGRGERKSIYLTGLNALIYSIVILAYVPLVLRKRKEKTNVLLGSIVMCALLFTISFTD
FT                   WFPKSTTRYISILFAVFLFTHFISWDSIGWVMTIELLPHLSQAPVILLVSNFYWIFKWF
FT                   VSLITPILIDRLSWKFYLIPSLSSFISIIFVLKIFPIETRDERLDSDDDSTGNGSGNHD
FT                   DVFDDTGSEFSSSPSFSAYQINTLGSSIKQNNQAYSSIQNEQILPKNGNLSNQTHGSAQ
FT                   NVYFITSDSGPSRTGEFFSFHNRTDPNISDNIAANKPSSGGGQNSPGDMAVA"
FT   gene            complement(103649..104551)
FT                   /gene="GGC1"
FT                   /gene_synonym="SHM1"
FT                   /gene_synonym="YHM1"
FT                   /locus_tag="YDL198C"
FT   mRNA            complement(103649..104551)
FT                   /gene="GGC1"
FT                   /gene_synonym="SHM1"
FT                   /gene_synonym="YHM1"
FT                   /locus_tag="YDL198C"
FT                   /product="Ggc1p"
FT   CDS_pept        complement(103649..104551)
FT                   /codon_start=1
FT                   /gene="GGC1"
FT                   /gene_synonym="YHM1"
FT                   /gene_synonym="SHM1"
FT                   /locus_tag="YDL198C"
FT                   /product="Ggc1p"
FT                   /note="Mitochondrial GTP/GDP transporter; essential for
FT                   mitochondrial genome maintenance; has a role in
FT                   mitochondrial iron transport; member of the mitochondrial
FT                   carrier family"
FT                   /db_xref="GOA:P38988"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38988"
FT                   /experiment="EXISTENCE:direct assay:GO:0001408 guanine
FT                   nucleotide transport [PMID:14998997]"
FT                   /experiment="EXISTENCE:direct assay:GO:0001409 guanine
FT                   nucleotide transmembrane transporter activity
FT                   [PMID:14998997]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0055085
FT                   transmembrane transport [PMID:14998997]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000002
FT                   mitochondrial genome maintenance [PMID:14998997]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006879 cellular
FT                   iron ion homeostasis [PMID:14629196]"
FT                   /protein_id="DAA11666.1"
FT                   /translation="MPHTDKKQSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKI
FT                   TSGQELNRVIFRDHFSEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHY
FT                   KKDFDNLFGEKTGKAMRSAAAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGRGFIKILR
FT                   DEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGAC
FT                   SSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLV
FT                   FSFALAQSLIPRFDNLLSK"
FT   gene            complement(104917..106494)
FT                   /gene="ASF2"
FT                   /locus_tag="YDL197C"
FT   mRNA            complement(104917..106494)
FT                   /gene="ASF2"
FT                   /locus_tag="YDL197C"
FT                   /product="Asf2p"
FT   CDS_pept        complement(104917..106494)
FT                   /codon_start=1
FT                   /gene="ASF2"
FT                   /locus_tag="YDL197C"
FT                   /product="Asf2p"
FT                   /note="Anti-silencing protein; causes derepression of
FT                   silent loci when overexpressed"
FT                   /db_xref="GOA:P32448"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32448"
FT                   /experiment="EXISTENCE:direct assay:GO:0000784 nuclear
FT                   chromosome, telomeric region [PMID:15282802]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:15282802|PMID:14562095]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030466
FT                   chromatin silencing at silent mating-type cassette
FT                   [PMID:9290207]"
FT                   /protein_id="DAA11667.1"
FT                   /translation="MPKNRGVLDAITRSVIDGSDQESSSSFNSDKEYAAVTKGLSSSRV
FT                   QKKSSLRQMKSKVKELQSLVNHYRENEAALVSSAKLLSGEIIGYEIKMASLHGKMKSIL
FT                   DENNALKETHKSSAEKRIELVRLPSSKEERNYDEYTLLVNLKKEICAKLQDYKNVQNTV
FT                   NTKLDEIHTFHEKYYEGLELSLDSKVFDAESSKELAKVRRELNNVRKNSEIKVNNLKMQ
FT                   LLQATKSLEHLKKQAKAKDDYLKCIPELVDKANLTMLSYKKSIANQRETIEALQAELSQ
FT                   QSETKGQIETETQNQVQIPTNVTLVDPFEENNPEDLFAIQEQELQDLRLHKKMADERSR
FT                   TTHLHLERKNNTIKLLQSYVQSLIQRLPPAQRKHHLGIFQKLGSEKSCPLAPAVASTYA
FT                   PLLLLSQHSNHQEIDNTPQRLLLAAPDGQSYSEKSTTLNLDYSSRKSYLSRLQPPHIAN
FT                   LKSLTLKTLPRVPTDSPQLPSKDKSQETAKKDDRPKLVANEPVTLDTSTPPVAQSLADS
FT                   KHCSGLHK"
FT   gene            107208..111029
FT                   /gene="SEC31"
FT                   /gene_synonym="WEB1"
FT                   /locus_tag="YDL195W"
FT   mRNA            107208..111029
FT                   /gene="SEC31"
FT                   /gene_synonym="WEB1"
FT                   /locus_tag="YDL195W"
FT                   /product="Sec31p"
FT   CDS_pept        107208..111029
FT                   /codon_start=1
FT                   /gene="SEC31"
FT                   /gene_synonym="WEB1"
FT                   /locus_tag="YDL195W"
FT                   /product="Sec31p"
FT                   /note="Component of the Sec13p-Sec31p complex of the COPII
FT                   vesicle coat; COPII coat is required for vesicle formation
FT                   in ER to Golgi transport; mutant has increased aneuploidy
FT                   tolerance"
FT                   /db_xref="GOA:P38968"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR009917"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR021614"
FT                   /db_xref="InterPro:IPR024298"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040251"
FT                   /db_xref="PDB:2PM6"
FT                   /db_xref="PDB:2PM7"
FT                   /db_xref="PDB:2PM9"
FT                   /db_xref="PDB:2QTV"
FT                   /db_xref="PDB:3MZL"
FT                   /db_xref="PDB:4BZJ"
FT                   /db_xref="PDB:4BZK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38968"
FT                   /experiment="EXISTENCE:direct assay:GO:0005198 structural
FT                   molecule activity [PMID:17604721]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030127 COPII
FT                   vesicle coat [PMID:8004676]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043332 mating
FT                   projection tip [PMID:19053807]"
FT                   /experiment="EXISTENCE:direct assay:GO:0090114 COPII-coated
FT                   vesicle budding [PMID:8223424]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0090114
FT                   COPII-coated vesicle budding [PMID:12475940]"
FT                   /protein_id="DAA11668.2"
FT                   /translation="MVKLAEFSRTATFAWSHDKIPLLVSGTVSGTVDANFSTDSSLELW
FT                   SLLAADSEKPIASLQVDSKFNDLDWSHNNKIIAGALDNGSLELYSTNEANNAINSMARF
FT                   SNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPSNYTPLTPGQSMSSVDEV
FT                   ISLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNS
FT                   TRVATATGSDNDPSILIWDLRNANTPLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNT
FT                   VLLWNPESAEQLSQFPARGNWCFKTKFAPEAPDLFACASFDNKIEVQTLQNLTNTLDEQ
FT                   ETETKQQESETDFWNNVSREESKEKPTVFHLQAPTWYGEPSPAAHWAFGGKLVQITPDG
FT                   KGVSITNPKISGLESNTTLSEALKTKDFKPLINQRLVKVIDDVNEEDWNLLEKLSMDGT
FT                   EEFLKEALAFDNDESDAQDDANNEKEDDGEEFFQQIETNFQPEGDFSLSGNIEQTISKN
FT                   LVSGNIKSAVKNSLENDLLMEAMVIALDSNNERLKESVKNAYFAKYGSKSSLSRILYSI
FT                   SKREVDDLVENLDVSQWKFISKAIQNLYPNDIAQRNEMLIKLGDRLKENGHRQDSLTLY
FT                   LAAGSLDKVASIWLSEFPDLEDKLKKDNKTIYEAHSECLTEFIERFTVFSNFINGSSTI
FT                   NNEQLIAKFLEFINLTTSTGNFELATEFLNSLPSDNEEVKTEKARVLIASGKSLPAQNP
FT                   ATATTSKAKYTNAKTNKNVPVLPTPGMPSTTSIPSMQAPFYGMTPGASANALPPKPYVP
FT                   ATTTSAPVHTEGKYAPPSQPSMASPFVNKTNSSTRLNSFAPPPNPYATATVPATNVSTT
FT                   SIPQNTFAPIQPGMPIMGDYNAQSSSIPSQPPINAVSGQTPHLNRKANDGWNDLPLKVK
FT                   EKPSRAKAVSVAPPNILSTPTPLNGIPANAASTMPPPPLSRAPSSVSMVSPPPLHKNSR
FT                   VPSLVATSESPRASISNPYAPPQSSQQFPIGTISTANQTSNTAQVASSNPYAPPPQQRV
FT                   ATPLSGGVPPAPLPKASNPYAPTATTQPNGSSYPPTGPYTNNHTMTSPPPVFNKPPTGP
FT                   PPISMKKRSNKLASIEQNPSQGATYPPTLSSSASPLQPSQPPTLASQVNTSAENVSHEI
FT                   PADQQPIVDFLKEELARVTPLTPKEYSKQLKDCDKRLKILFYHLEKQDLLTQPTIDCLH
FT                   DLVALMKEKKYKEAMVIHANIATNHAQEGGNWLTGVKRLIGIAEATLN"
FT   gene            111580..114234
FT                   /gene="SNF3"
FT                   /locus_tag="YDL194W"
FT   mRNA            111580..114234
FT                   /gene="SNF3"
FT                   /locus_tag="YDL194W"
FT                   /product="glucose sensor"
FT   CDS_pept        111580..114234
FT                   /codon_start=1
FT                   /gene="SNF3"
FT                   /locus_tag="YDL194W"
FT                   /product="glucose sensor"
FT                   /note="Plasma membrane low glucose sensor, regulates
FT                   glucose transport; high affinity sensor that contains 12
FT                   predicted transmembrane segments and a long C-terminal tail
FT                   required for induction of hexose transporters; also senses
FT                   fructose and mannose; SNF3 has a paralog, RGT2, that arose
FT                   from the whole genome duplication"
FT                   /db_xref="GOA:P10870"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR037792"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10870"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:2406560|PMID:24124599]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0051594
FT                   detection of glucose [PMID:8901598]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0010255 glucose
FT                   mediated signaling pathway [PMID:9564039]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0015755 fructose
FT                   transmembrane transport [PMID:2046678]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0015761 mannose
FT                   transmembrane transport [PMID:2046678]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045835 negative
FT                   regulation of meiotic nuclear division [PMID:18616605]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0051594
FT                   detection of glucose [PMID:8901598]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1904659 glucose
FT                   transmembrane transport [PMID:2046678]"
FT                   /protein_id="DAA11669.1"
FT                   /translation="MDPNSNSSSETLRQEKQGFLDKALQRVKGIALRRNNSNKDHTTDD
FT                   TTGSIRTPTSLQRQNSDRQSNMTSVFTDDISTIDDNSILFSEPPQKQSMMMSICVGVFV
FT                   AVGGFLFGYDTGLINSITSMNYVKSHVAPNHDSFTAQQMSILVSFLSLGTFFGALTAPF
FT                   ISDSYGRKPTIIFSTIFIFSIGNSLQVGAGGITLLIVGRVISGIGIGAISAVVPLYQAE
FT                   ATHKSLRGAIISTYQWAITWGLLVSSAVSQGTHARNDASSYRIPIGLQYVWSSFLAIGM
FT                   FFLPESPRYYVLKDKLDEAAKSLSFLRGVPVHDSGLLEELVEIKATYDYEASFGSSNFI
FT                   DCFISSKSRPKQTLRMFTGIALQAFQQFSGINFIFYYGVNFFNKTGVSNSYLVSFITYA
FT                   VNVVFNVPGLFFVEFFGRRKVLVVGGVIMTIANFIVAIVGCSLKTVAAAKVMIAFICLF
FT                   IAAFSATWGGVVWVISAELYPLGVRSKCTAICAAANWLVNFICALITPYIVDTGSHTSS
FT                   LGAKIFFIWGSLNAMGVIVVYLTVYETKGLTLEEIDELYIKSSTGVVSPKFNKDIRERA
FT                   LKFQYDPLQRLEDGKNTFVAKRNNFDDETPRNDFRNTISGEIDHSPNQKEVHSIPERVD
FT                   IPTSTEILESPNKSSGMTVPVSPSLQDVPIPQTTEPAEIRTKYVDLGNGLGLNTYNRGP
FT                   PSLSSDSSEDYTEDEIGGPSSQGDQSNRSTMNDINDYMARLIHSTSTASNTTDKFSGNQ
FT                   STLRYHTASSHSDTTEEDSNLMDLGNGLALNAYNRGPPSILMNSSDEEANGGETSDNLN
FT                   TAQDLAGMKERMAQFAQSYIDKRGGLEPETQSNILSTSLSVMADTNEHNNEILHSSEEN
FT                   ATNQPVNENNDLK"
FT   gene            114672..115799
FT                   /gene="NUS1"
FT                   /locus_tag="YDL193W"
FT   mRNA            114672..115799
FT                   /gene="NUS1"
FT                   /locus_tag="YDL193W"
FT                   /product="ditrans,polycis-polyprenyl diphosphate synthase"
FT   CDS_pept        114672..115799
FT                   /codon_start=1
FT                   /gene="NUS1"
FT                   /locus_tag="YDL193W"
FT                   /product="ditrans,polycis-polyprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.87"
FT                   /note="Forms dehydrodolichyl diphosphate syntase complex
FT                   with RER2 or SRT1; tet-repressible mutant shows
FT                   accumulation of hypoglycosylated forms of CPY, suggesting
FT                   that Nus1p may be involved in protein trafficking;
FT                   mutations in human homolog NUS1 have been implicated in
FT                   congenital scoliosis, neurological impairment, refractory
FT                   epilepsy, hearing deficit, and visual impairment; human
FT                   cis-prenyltransferase complex complements yeast null
FT                   mutant"
FT                   /db_xref="GOA:Q12063"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="InterPro:IPR038887"
FT                   /db_xref="PDB:6JCN"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12063"
FT                   /experiment="EXISTENCE:direct assay:GO:0005635 nuclear
FT                   envelope [PMID:14690591]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:11086160]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005811 lipid
FT                   droplet
FT                   [PMID:10515935|PMID:24868093|PMID:14690591|PMID:24390141]"
FT                   /experiment="EXISTENCE:direct assay:GO:0019408 dolichol
FT                   biosynthetic process [PMID:25066056]"
FT                   /experiment="EXISTENCE:direct assay:GO:0045547
FT                   dehydrodolichyl diphosphate synthase activity
FT                   [PMID:25066056]"
FT                   /experiment="EXISTENCE:direct assay:GO:1904423
FT                   dehydrodolichyl diphosphate synthase complex
FT                   [PMID:25066056]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006486 protein
FT                   glycosylation [PMID:16943325]"
FT                   /protein_id="DAA11670.1"
FT                   /translation="MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKG
FT                   GKVNSKTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFYKFLL
FT                   VLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLKKIPKRLAAILEVK
FT                   PVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYDGILQRNVPELRMEIHSNLAKYF
FT                   GPAHVPNYAVKIPHSNKIFYNLDGIETETDVGNEIEANQEKDKIAIEISLLSNRDGRET
FT                   IVDLTKTMAELCAVNELSVSDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHI
FT                   RLTEFYWEKDNNEVIYSVFIRGLRQYAGCKVNVGK"
FT   gene            116321..116866
FT                   /gene="ARF1"
FT                   /locus_tag="YDL192W"
FT   mRNA            116321..116866
FT                   /gene="ARF1"
FT                   /locus_tag="YDL192W"
FT                   /product="Arf family GTPase ARF1"
FT   CDS_pept        116321..116866
FT                   /codon_start=1
FT                   /gene="ARF1"
FT                   /locus_tag="YDL192W"
FT                   /product="Arf family GTPase ARF1"
FT                   /note="ADP-ribosylation factor; GTPase of the Ras
FT                   superfamily involved in regulation of coated vesicle
FT                   formation in intracellular trafficking within the Golgi;
FT                   ARF1 has a paralog, ARF2, that arose from the whole genome
FT                   duplication; arf1 arf2 double null mutation is complemented
FT                   by human ARF1, ARF4, ARF5, or ARF6"
FT                   /db_xref="GOA:P11076"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2K5U"
FT                   /db_xref="PDB:2KSQ"
FT                   /db_xref="PDB:3TJZ"
FT                   /db_xref="PDB:4Q66"
FT                   /db_xref="PDB:5A1U"
FT                   /db_xref="PDB:5A1V"
FT                   /db_xref="PDB:5A1W"
FT                   /db_xref="PDB:5A1X"
FT                   /db_xref="PDB:5A1Y"
FT                   /db_xref="PDB:5NZR"
FT                   /db_xref="PDB:5NZS"
FT                   /db_xref="PDB:5NZT"
FT                   /db_xref="PDB:5NZU"
FT                   /db_xref="PDB:5NZV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P11076"
FT                   /experiment="EXISTENCE:direct assay:GO:0003924 GTPase
FT                   activity [PMID:8816753]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005794 Golgi
FT                   apparatus [PMID:20841378|PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006888 endoplasmic
FT                   reticulum to Golgi vesicle-mediated transport
FT                   [PMID:9736713|PMID:9813082]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006893 Golgi
FT                   to plasma membrane transport [PMID:16498409]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016236
FT                   macroautophagy [PMID:20444982]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0006893
FT                   Golgi to plasma membrane transport [PMID:16498409]"
FT                   /protein_id="DAA11671.1"
FT                   /translation="MGLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITT
FT                   IPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAR
FT                   EVMQRMLNEDELRNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSG
FT                   EGLYEGLEWLSNSLKNST"
FT   gene            117664..118517
FT                   /gene="RPL35A"
FT                   /gene_synonym="SOS1"
FT                   /locus_tag="YDL191W"
FT   mRNA            join(117664..117666,118158..118517)
FT                   /gene="RPL35A"
FT                   /gene_synonym="SOS1"
FT                   /locus_tag="YDL191W"
FT                   /product="ribosomal 60S subunit protein L35A"
FT   CDS_pept        join(117664..117666,118158..118517)
FT                   /codon_start=1
FT                   /gene="RPL35A"
FT                   /gene_synonym="SOS1"
FT                   /locus_tag="YDL191W"
FT                   /product="ribosomal 60S subunit protein L35A"
FT                   /note="Ribosomal 60S subunit protein L35A; homologous to
FT                   mammalian ribosomal protein L35 and bacterial L29; RPL35A
FT                   has a paralog, RPL35B, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:P0CX84"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="PDB:1K5Y"
FT                   /db_xref="PDB:2WW9"
FT                   /db_xref="PDB:2WWA"
FT                   /db_xref="PDB:2WWB"
FT                   /db_xref="PDB:3J6X"
FT                   /db_xref="PDB:3J6Y"
FT                   /db_xref="PDB:3J77"
FT                   /db_xref="PDB:3J78"
FT                   /db_xref="PDB:3JCT"
FT                   /db_xref="PDB:4U3M"
FT                   /db_xref="PDB:4U3N"
FT                   /db_xref="PDB:4U3U"
FT                   /db_xref="PDB:4U4N"
FT                   /db_xref="PDB:4U4O"
FT                   /db_xref="PDB:4U4Q"
FT                   /db_xref="PDB:4U4R"
FT                   /db_xref="PDB:4U4U"
FT                   /db_xref="PDB:4U4Y"
FT                   /db_xref="PDB:4U4Z"
FT                   /db_xref="PDB:4U50"
FT                   /db_xref="PDB:4U51"
FT                   /db_xref="PDB:4U52"
FT                   /db_xref="PDB:4U53"
FT                   /db_xref="PDB:4U55"
FT                   /db_xref="PDB:4U56"
FT                   /db_xref="PDB:4U6F"
FT                   /db_xref="PDB:4V4B"
FT                   /db_xref="PDB:4V6I"
FT                   /db_xref="PDB:4V7F"
FT                   /db_xref="PDB:4V7R"
FT                   /db_xref="PDB:4V88"
FT                   /db_xref="PDB:4V8T"
FT                   /db_xref="PDB:4V91"
FT                   /db_xref="PDB:5APN"
FT                   /db_xref="PDB:5APO"
FT                   /db_xref="PDB:5DAT"
FT                   /db_xref="PDB:5DC3"
FT                   /db_xref="PDB:5DGE"
FT                   /db_xref="PDB:5DGF"
FT                   /db_xref="PDB:5DGV"
FT                   /db_xref="PDB:5FCI"
FT                   /db_xref="PDB:5FCJ"
FT                   /db_xref="PDB:5FL8"
FT                   /db_xref="PDB:5GAK"
FT                   /db_xref="PDB:5H4P"
FT                   /db_xref="PDB:5I4L"
FT                   /db_xref="PDB:5JCS"
FT                   /db_xref="PDB:5JUO"
FT                   /db_xref="PDB:5JUP"
FT                   /db_xref="PDB:5JUS"
FT                   /db_xref="PDB:5JUT"
FT                   /db_xref="PDB:5JUU"
FT                   /db_xref="PDB:5LYB"
FT                   /db_xref="PDB:5M1J"
FT                   /db_xref="PDB:5MC6"
FT                   /db_xref="PDB:5MEI"
FT                   /db_xref="PDB:5NDG"
FT                   /db_xref="PDB:5NDV"
FT                   /db_xref="PDB:5NDW"
FT                   /db_xref="PDB:5OBM"
FT                   /db_xref="PDB:5ON6"
FT                   /db_xref="PDB:5T62"
FT                   /db_xref="PDB:5T6R"
FT                   /db_xref="PDB:5TBW"
FT                   /db_xref="PDB:5TGA"
FT                   /db_xref="PDB:5TGM"
FT                   /db_xref="PDB:5Z3G"
FT                   /db_xref="PDB:6C0F"
FT                   /db_xref="PDB:6CB1"
FT                   /db_xref="PDB:6ELZ"
FT                   /db_xref="PDB:6EM1"
FT                   /db_xref="PDB:6EM3"
FT                   /db_xref="PDB:6EM4"
FT                   /db_xref="PDB:6EM5"
FT                   /db_xref="PDB:6FT6"
FT                   /db_xref="PDB:6GQ1"
FT                   /db_xref="PDB:6GQB"
FT                   /db_xref="PDB:6GQV"
FT                   /db_xref="PDB:6HD7"
FT                   /db_xref="PDB:6HHQ"
FT                   /db_xref="PDB:6I7O"
FT                   /db_xref="PDB:6N8J"
FT                   /db_xref="PDB:6N8K"
FT                   /db_xref="PDB:6N8L"
FT                   /db_xref="PDB:6N8M"
FT                   /db_xref="PDB:6N8N"
FT                   /db_xref="PDB:6N8O"
FT                   /db_xref="PDB:6Q8Y"
FT                   /db_xref="PDB:6QIK"
FT                   /db_xref="PDB:6QT0"
FT                   /db_xref="PDB:6QTZ"
FT                   /db_xref="PDB:6R84"
FT                   /db_xref="PDB:6R87"
FT                   /db_xref="PDB:6RI5"
FT                   /db_xref="PDB:6RZZ"
FT                   /db_xref="PDB:6S05"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CX84"
FT                   /experiment="EXISTENCE:curator inference:GO:0002181
FT                   cytoplasmic translation [PMID:11983894]"
FT                   /experiment="EXISTENCE:curator inference:GO:0003735
FT                   structural constituent of ribosome [PMID:11983894]"
FT                   /experiment="EXISTENCE:direct assay:GO:0022625 cytosolic
FT                   large ribosomal subunit [PMID:11983894]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030687 preribosome,
FT                   large subunit precursor [PMID:20392820]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000463
FT                   maturation of LSU-rRNA from tricistronic rRNA transcript
FT                   (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:20392820]"
FT                   /protein_id="DAA11722.1"
FT                   /translation="MAGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIK
FT                   TVRKSIACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVTEKQ
FT                   RKKQIAFPQRKYAIKA"
FT   gene            complement(118707..121592)
FT                   /gene="UFD2"
FT                   /locus_tag="YDL190C"
FT   mRNA            complement(118707..121592)
FT                   /gene="UFD2"
FT                   /locus_tag="YDL190C"
FT                   /product="ubiquitin-ubiquitin ligase UFD2"
FT   CDS_pept        complement(118707..121592)
FT                   /codon_start=1
FT                   /gene="UFD2"
FT                   /locus_tag="YDL190C"
FT                   /product="ubiquitin-ubiquitin ligase UFD2"
FT                   /EC_number="2.3.2.27"
FT                   /note="Ubiquitin chain assembly factor (E4); cooperates
FT                   with a ubiquitin-activating enzyme (E1), a
FT                   ubiquitin-conjugating enzyme (E2), and a ubiquitin protein
FT                   ligase (E3) to conjugate ubiquitin to substrates; also
FT                   functions as an E3"
FT                   /db_xref="GOA:P54860"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019474"
FT                   /db_xref="PDB:2QIZ"
FT                   /db_xref="PDB:2QJ0"
FT                   /db_xref="PDB:3M62"
FT                   /db_xref="PDB:3M63"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54860"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016567 protein
FT                   ubiquitination [PMID:10089879]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034450
FT                   ubiquitin-ubiquitin ligase activity [PMID:10089879]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006511
FT                   ubiquitin-dependent protein catabolic process
FT                   [PMID:10089879|PMID:7615550]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030433
FT                   ubiquitin-dependent ERAD pathway [PMID:21148305]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031398 positive
FT                   regulation of protein ubiquitination [PMID:27226596]"
FT                   /protein_id="DAA11673.2"
FT                   /translation="MTAIEDILQITTDPSDTRGYSLLKSEEVPQGSTLGVDFIDTLLLY
FT                   QLTENEKLDKPFEYLNDCFRRNQQQKRITKNKPNAESLHSTFQEIDRLVIGYGVVALQI
FT                   ENFCMNGAFINYITGIVSNVNSYTDFLSQIIQRAILEGTALDLLNAVFPTLLEYCNKHV
FT                   SHFDLNESVIYNNVLTIFELFVTFKPIAEIFTKIDGFFADYSCKPQDFERKTILGPILS
FT                   LSPIEAAVAIRNYGDNLLRSKQQTAMIHESLQAEHKVVIDRLFFIVDKLVRGSLNSRTD
FT                   MISYFAHIANKNHLRRADHPPFKELSSNGFMSNITLLLVRFSQPFLDISYKKIDKIDAN
FT                   YFNNPSLFIDLSGETRLNSDFKEADAFYDKNRKTADSKPNFISDCFFLTLTYLHYGLGG
FT                   TLSFEEKMGSEIKALKEEIEKVKKIAANHDVFARFITAQLSKMEKALKTTESLRFALQG
FT                   FFAHRSLQLEVFDFICGASTFLIRVVDPEHEFPFKQIKLPLIPDQIGVENVDNADFLRA
FT                   HAPVPFKYYPEFVVEGPVNYSLYISKYQTSPIFRNPRLGSFVEFTTMVLRCPELVSNPH
FT                   LKGKLVQLLSVGAMPLTDNSPGFMMDIFEHDELVNKNLLYALLDFYVIVEKTGSSSQFY
FT                   DKFNSRYSISIILEELYYKIPSYKNQLIWQSQNNADFFVRFVARMLNDLTFLLDEGLSN
FT                   LAEVHNIQNELDNRARGAPPTREEEDKELQTRLASASRQAKSSCGLADKSMKLFEIYSK
FT                   DIPAAFVTPEIVYRLASMLNYNLESLVGPKCGELKVKDPQSYSFNPKDLLKALTTVYIN
FT                   LSEQSEFISAVAKDERSFNRNLFVRAVDILGRKTGLASPEFIEKLLNFANKAEEQRKAD
FT                   EEEDLEYGDVPDEFLDPLMYTIMKDPVILPASKMNIDRSTIKAHLLSDSTDPFNRMPLK
FT                   LEDVTPNEELRQKILCFKKQKKEEAKHKASE"
FT   gene            122216..123589
FT                   /gene="RBS1"
FT                   /locus_tag="YDL189W"
FT   mRNA            122216..123589
FT                   /gene="RBS1"
FT                   /locus_tag="YDL189W"
FT                   /product="Rbs1p"
FT   CDS_pept        122216..123589
FT                   /codon_start=1
FT                   /gene="RBS1"
FT                   /locus_tag="YDL189W"
FT                   /product="Rbs1p"
FT                   /note="Protein involved in assembly of the RNA polymerase
FT                   III (Pol III) complex; high copy suppressor of Pol III
FT                   assembly mutation and psk1 psk2 mutations that confer
FT                   temperature-sensitivity for galactose utilization;
FT                   physically interacts with Pol III; proposed to bind
FT                   single-stranded nucleic acids via its R3H domain"
FT                   /db_xref="GOA:Q05672"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05672"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:25605335]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006012
FT                   galactose metabolic process [PMID:12372297]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1990115 RNA
FT                   polymerase III assembly [PMID:25605335]"
FT                   /protein_id="DAA11674.1"
FT                   /translation="MTALDSRNWGLTPAMETGLFQKPQDRIFIIELENSIVSFINSNTE
FT                   SFQLRPMNSYYRLLSHQIAEYHNLNHVLARTQDSCVILFKGENFQKIEGKPLLQELQLN
FT                   KKPEECASSSESIEKSNNNRIFRILKRKEVGNECDYKIDGNTRTPNSNLTANSNKDQKI
FT                   EIDDKSSTDLEQERIEKERLYEQRKQEIFDKLNKSEDDVKSTNSSGSSDSDNEWSDWLN
FT                   GDDSNTQTSNGSVSSSSPFNSSVTTIQVNKPQQQFYDSRRGRGGRRRGTNNYKDAYRGQ
FT                   SRRNKENGGYQSGYSSPYLVYPPPQMGGNSLPTYPLMYNPAGPAPGPAPSPMVMGNNTV
FT                   FMNPYMYNMNPQGSCSFGTPIPMYPPYQYQYQYQYNTQYHSGPYSNTPSYNSNNYTRSS
FT                   ANKYHHFQGKNSYSGAIPKRSDDSNSNKNEGIRRASVEGSPSSRDTDSVEMKFDKLNI"
FT   rep_origin      123617..123901
FT                   /note="ARS406; Autonomously Replicating Sequence"
FT   gene            complement(123865..124998)
FT                   /gene="PPH22"
FT                   /gene_synonym="PPH2"
FT                   /locus_tag="YDL188C"
FT   mRNA            complement(123865..124998)
FT                   /gene="PPH22"
FT                   /gene_synonym="PPH2"
FT                   /locus_tag="YDL188C"
FT                   /product="phosphoprotein phosphatase 2A catalytic subunit
FT                   PPH22"
FT   CDS_pept        complement(123865..124998)
FT                   /codon_start=1
FT                   /gene="PPH22"
FT                   /gene_synonym="PPH2"
FT                   /locus_tag="YDL188C"
FT                   /product="phosphoprotein phosphatase 2A catalytic subunit
FT                   PPH22"
FT                   /EC_number="3.1.3.16"
FT                   /note="Catalytic subunit of protein phosphatase 2A, PP2A;
FT                   functionally redundant with Pph21p; C-terminally
FT                   methylated; forms alternate complexes with several
FT                   regulatory subunits; involved in signal transduction and
FT                   regulation of mitosis; protein abundance increases in
FT                   response to DNA replication stress; dephosphorylates
FT                   Tel1p/Mec1p-phosphorylated Cdc13p to promote telomerase
FT                   release from telomeres at G2/M; PPH22 has a paralog, PPH21,
FT                   that arose from the whole genome duplication"
FT                   /db_xref="GOA:P23595"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23595"
FT                   /experiment="EXISTENCE:direct assay:GO:0000780 condensed
FT                   nuclear chromosome, centromeric region [PMID:16541024]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004722 protein
FT                   serine/threonine phosphatase activity
FT                   [PMID:12135475|PMID:25387524]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006470 protein
FT                   dephosphorylation [PMID:12135475]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034399 nuclear
FT                   periphery [PMID:25817432]"
FT                   /experiment="EXISTENCE:direct assay:GO:0070262
FT                   peptidyl-serine dephosphorylation [PMID:25387524]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000082 G1/S
FT                   transition of mitotic cell cycle [PMID:12518319]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0070262
FT                   peptidyl-serine dephosphorylation [PMID:27163342]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:2000786
FT                   positive regulation of autophagosome assembly
FT                   [PMID:27973551]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0070262
FT                   peptidyl-serine dephosphorylation [PMID:25387524]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:2000198 negative
FT                   regulation of ribonucleoprotein complex localization
FT                   [PMID:25387524]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0006417
FT                   regulation of translation [PMID:10329624]"
FT                   /protein_id="DAA11675.1"
FT                   /translation="MDMEIDDPMHGSDEDQLSPTLDEDMNSDDGKNNTKARSNDEDTDE
FT                   ELEDFNFKPGSSGIADHKSSKPLKLTNTNINQLDQWIEHLSKCEPLSEDDVARLCKMAV
FT                   DVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVE
FT                   TVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFP
FT                   VTALVDNKIFCLHGGLSPMIETIDQVRDLNRIQEVPHEGPMCDLLWSDPDDRGGWGISP
FT                   RGAGFTFGQDISEQFNHTNDLSLIARAHQLVMEGYSWSHQQNVVTIFSAPNYCYRCGNQ
FT                   AAIMEVDENHNRQFLQYDPSVRPGEPTVTRKTPDYFL"
FT   gene            125616..126449
FT                   /locus_tag="YDL186W"
FT   mRNA            125616..126449
FT                   /locus_tag="YDL186W"
FT                   /product="hypothetical protein"
FT   CDS_pept        125616..126449
FT                   /codon_start=1
FT                   /locus_tag="YDL186W"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; YDL186W is not an essential
FT                   gene"
FT                   /db_xref="GOA:P48568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48568"
FT                   /protein_id="DAA11676.1"
FT                   /translation="MQCNTSIEDGLDGGDITFPSYSPEAEAQNRFLPRSEFPSVRQLVI
FT                   SKQKSRRRREENVFVGKMEDVLVKWRPPASSHRGAIEAINGTHPYQLSTAQFNSRRSDP
FT                   FGSTKRDESVRSIVESFTDWWKRNSKMFFRDEEEGVRTEHSASQDDQELQLFEEDLFSF
FT                   HLSPNDMSTRNSEHQVQTPVLFPYEAPTRTKQNPAERKVIEIGDGEELSIYRDVYSNPI
FT                   PVSYLDTLNLNHSMSVRQTQQQQQQRQQQQYVDSSSAFQCCTDSNWARIFFCHHD"
FT   gene            126787..130002
FT                   /gene="VMA1"
FT                   /gene_synonym="CLS8"
FT                   /gene_synonym="TFP1"
FT                   /locus_tag="YDL185W"
FT   mRNA            126787..130002
FT                   /gene="VMA1"
FT                   /gene_synonym="CLS8"
FT                   /gene_synonym="TFP1"
FT                   /locus_tag="YDL185W"
FT                   /product="H(+)-transporting V1 sector ATPase subunit A"
FT   CDS_pept        126787..130002
FT                   /codon_start=1
FT                   /gene="VMA1"
FT                   /gene_synonym="CLS8"
FT                   /gene_synonym="TFP1"
FT                   /locus_tag="YDL185W"
FT                   /product="H(+)-transporting V1 sector ATPase subunit A"
FT                   /EC_number="7.1.2.2"
FT                   /note="Subunit A of the V1 peripheral membrane domain of
FT                   V-ATPase; protein precursor undergoes self-catalyzed
FT                   splicing to yield the extein Tfp1p and the intein Vde
FT                   (PI-SceI), which is a site-specific endonuclease; the V1
FT                   peripheral membrane domain of the vacuolar H+-ATPase
FT                   (V-ATPase) has eight subunits; involved in methionine
FT                   restriction extension of chronological lifespan in an
FT                   autophagy-dependent manner"
FT                   /db_xref="GOA:P17255"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR007868"
FT                   /db_xref="InterPro:IPR007869"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="PDB:1DFA"
FT                   /db_xref="PDB:1EF0"
FT                   /db_xref="PDB:1GPP"
FT                   /db_xref="PDB:1JVA"
FT                   /db_xref="PDB:1LWS"
FT                   /db_xref="PDB:1LWT"
FT                   /db_xref="PDB:1UM2"
FT                   /db_xref="PDB:1VDE"
FT                   /db_xref="PDB:3J9T"
FT                   /db_xref="PDB:3J9U"
FT                   /db_xref="PDB:3J9V"
FT                   /db_xref="PDB:5BW9"
FT                   /db_xref="PDB:5D80"
FT                   /db_xref="PDB:5VOX"
FT                   /db_xref="PDB:5VOY"
FT                   /db_xref="PDB:5VOZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17255"
FT                   /experiment="EXISTENCE:direct assay:GO:0000221 vacuolar
FT                   proton-transporting V-type ATPase, V1 domain
FT                   [PMID:1530931|PMID:2478556|PMID:8626613]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000329 fungal-type
FT                   vacuole membrane [PMID:7775427|PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003729 mRNA binding
FT                   [PMID:23222640]"
FT                   /experiment="EXISTENCE:direct assay:GO:0044267 cellular
FT                   protein metabolic process [PMID:8508780]"
FT                   /experiment="EXISTENCE:direct assay:GO:0046961
FT                   proton-transporting ATPase activity, rotational mechanism
FT                   [PMID:8718887]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007035 vacuolar
FT                   acidification [PMID:29519938|PMID:18048916]"
FT                   /protein_id="DAA11677.1"
FT                   /translation="MAGAIENARKEIKRISLEDHAESEYGAIYSVSGPVVIAENMIGCA
FT                   MYELVKVGHDNLVGEVIRIDGDKATIQVYEETAGLTVGDPVLRTGKPLSVELGPGLMET
FT                   IYDGIQRPLKAIKEESQSIYIPRGIDTPALDRTIKWQFTPGKFQVGDHISGGDIYGSVF
FT                   ENSLISSHKILLPPRSRGTITWIAPAGEYTLDEKILEVEFDGKKSDFTLYHTWPVRVPR
FT                   PVTEKLSADYPLLTGQRVLDALFPCVQGGTTCIPGAFGCGKTVISQSLSKYSNSDAIIY
FT                   VGCFAKGTNVLMADGSIECIENIEVGNKVMGKDGRPREVIKLPRGRETMYSVVQKSQHR
FT                   AHKSDSSREVPELLKFTCNATHELVVRTPRSVRRLSRTIKGVEYFEVITFEMGQKKAPD
FT                   GRIVELVKEVSKSYPISEGPERANELVESYRKASNKAYFEWTIEARDLSLLGSHVRKAT
FT                   YQTYAPILYENDHFFDYMQKSKFHLTIEGPKVLAYLLGLWIGDGLSDRATFSVDSRDTS
FT                   LMERVTEYAEKLNLCAEYKDRKEPQVAKTVNLYSKVVRGNGIRNNLNTENPLWDAIVGL
FT                   GFLKDGVKNIPSFLSTDNIGTRETFLAGLIDSDGYVTDEHGIKATIKTIHTSVRDGLVS
FT                   LARSLGLVVSVNAEPAKVDMNGTKHKISYAIYMSGGDVLLNVLSKCAGSKKFRPAPAAA
FT                   FARECRGFYFELQELKEDDYYGITLSDDSDHQFLLANQVVVHNCGERGNEMAEVLMEFP
FT                   ELYTEMSGTKEPIMKRTTLVANTSNMPVAAREASIYTGITLAEYFRDQGKNVSMIADSS
FT                   SRWAEALREISGRLGEMPADQGFPAYLGAKLASFYERAGKAVALGSPDRTGSVSIVAAV
FT                   SPAGGDFSDPVTTATLGITQVFWGLDKKLAQRKHFPSINTSVSYSKYTNVLNKFYDSNY
FT                   PEFPVLRDRMKEILSNAEELEQVVQLVGKSALSDSDKITLDVATLIKEDFLQQNGYSTY
FT                   DAFCPIWKTFDMMRAFISYHDEAQKAVANGANWSKLADSTGDVKHAVSSSKFFEPSRGE
FT                   KEVHGEFEKLLSTMQERFAESTD"
FT   gene            complement(130407..130484)
FT                   /gene="RPL41A"
FT                   /gene_synonym="RPL47A"
FT                   /locus_tag="YDL184C"
FT   mRNA            complement(130407..130484)
FT                   /gene="RPL41A"
FT                   /gene_synonym="RPL47A"
FT                   /locus_tag="YDL184C"
FT                   /product="ribosomal 60S subunit protein L41A"
FT   CDS_pept        complement(130407..130484)
FT                   /codon_start=1
FT                   /gene="RPL41A"
FT                   /gene_synonym="RPL47A"
FT                   /locus_tag="YDL184C"
FT                   /product="ribosomal 60S subunit protein L41A"
FT                   /note="Ribosomal 60S subunit protein L41A; comprises only
FT                   25 amino acids; rpl41a rpl41b double null mutant is viable;
FT                   homologous to mammalian ribosomal protein L41, no bacterial
FT                   homolog; RPL41A has a paralog, RPL41B, that arose from the
FT                   whole genome duplication"
FT                   /db_xref="GOA:P0CX86"
FT                   /db_xref="InterPro:IPR007836"
FT                   /db_xref="PDB:3J6X"
FT                   /db_xref="PDB:3J6Y"
FT                   /db_xref="PDB:3J77"
FT                   /db_xref="PDB:3J78"
FT                   /db_xref="PDB:3J80"
FT                   /db_xref="PDB:3J81"
FT                   /db_xref="PDB:3JAM"
FT                   /db_xref="PDB:3JAP"
FT                   /db_xref="PDB:3JAQ"
FT                   /db_xref="PDB:4U3M"
FT                   /db_xref="PDB:4U3N"
FT                   /db_xref="PDB:4U3U"
FT                   /db_xref="PDB:4U4N"
FT                   /db_xref="PDB:4U4O"
FT                   /db_xref="PDB:4U4Q"
FT                   /db_xref="PDB:4U4R"
FT                   /db_xref="PDB:4U4U"
FT                   /db_xref="PDB:4U4Y"
FT                   /db_xref="PDB:4U4Z"
FT                   /db_xref="PDB:4U53"
FT                   /db_xref="PDB:4U55"
FT                   /db_xref="PDB:4U56"
FT                   /db_xref="PDB:4V6I"
FT                   /db_xref="PDB:4V88"
FT                   /db_xref="PDB:4V8T"
FT                   /db_xref="PDB:4V91"
FT                   /db_xref="PDB:5DAT"
FT                   /db_xref="PDB:5DC3"
FT                   /db_xref="PDB:5DGE"
FT                   /db_xref="PDB:5DGF"
FT                   /db_xref="PDB:5DGV"
FT                   /db_xref="PDB:5FCI"
FT                   /db_xref="PDB:5FCJ"
FT                   /db_xref="PDB:5GAK"
FT                   /db_xref="PDB:5I4L"
FT                   /db_xref="PDB:5IT7"
FT                   /db_xref="PDB:5JUO"
FT                   /db_xref="PDB:5JUP"
FT                   /db_xref="PDB:5JUS"
FT                   /db_xref="PDB:5JUT"
FT                   /db_xref="PDB:5JUU"
FT                   /db_xref="PDB:5LYB"
FT                   /db_xref="PDB:5MC6"
FT                   /db_xref="PDB:5NDG"
FT                   /db_xref="PDB:5NDW"
FT                   /db_xref="PDB:5OBM"
FT                   /db_xref="PDB:5TBW"
FT                   /db_xref="PDB:5TGA"
FT                   /db_xref="PDB:5TGM"
FT                   /db_xref="PDB:5XYI"
FT                   /db_xref="PDB:6FYX"
FT                   /db_xref="PDB:6FYY"
FT                   /db_xref="PDB:6GSN"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CX86"
FT                   /experiment="EXISTENCE:direct assay:GO:0002181 cytoplasmic
FT                   translation [PMID:18782943]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003735 structural
FT                   constituent of ribosome [PMID:18782943]"
FT                   /experiment="EXISTENCE:direct assay:GO:0022625 cytosolic
FT                   large ribosomal subunit [PMID:18782943]"
FT                   /protein_id="DAA11678.1"
FT                   /translation="MRAKWRKKRTRRLKRKRRKVRARSK"
FT   gene            complement(130871..131833)
FT                   /locus_tag="YDL183C"
FT   mRNA            complement(130871..131833)
FT                   /locus_tag="YDL183C"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(130871..131833)
FT                   /codon_start=1
FT                   /locus_tag="YDL183C"
FT                   /product="hypothetical protein"
FT                   /note="Protein that may form an active mitochondrial KHE
FT                   system; mitochondrial inner-membrane protein; non-essential
FT                   gene; KHE system stands for K+/H+ exchanger system"
FT                   /db_xref="GOA:P48569"
FT                   /db_xref="InterPro:IPR018786"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48569"
FT                   /experiment="EXISTENCE:direct assay:GO:0031305 integral
FT                   component of mitochondrial inner membrane [PMID:20197279]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006813
FT                   potassium ion transport [PMID:20197279]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:1902600
FT                   proton transmembrane transport [PMID:20197279]"
FT                   /protein_id="DAA11679.1"
FT                   /translation="MIRSIFIPPTSITATSRLFYGMRAYSTKLEKASLQKYLHDPVKVT
FT                   VIPITDKESFIYYKHTDNLFNSQSRILKAEKWIVEKSAKLWRKLKKSPKSYNKKIVSMV
FT                   QSLLNSTPWSENSLLTIPSESYILKRIKGEKDKTQEIRLTLKDYTVKAEQVDTQPLHVY
FT                   YPPGISSPDECLRQMKKLYQEGLIYHKKWTLYCLLGLPLTIPLILIPLIPNVPGFYLSY
FT                   RAYVNIKAYLGAKHLKSLLESSKQNLEFRELLGYTEVYKRGTSSRTQGNQKESKGAPEL
FT                   LLNKKTLPLILDFLEVHELESDLNKVILQESKSQEKNKI"
FT   gene            133437..134723
FT                   /gene="LYS20"
FT                   /locus_tag="YDL182W"
FT   mRNA            133437..134723
FT                   /gene="LYS20"
FT                   /locus_tag="YDL182W"
FT                   /product="homocitrate synthase LYS20"
FT   CDS_pept        133437..134723
FT                   /codon_start=1
FT                   /gene="LYS20"
FT                   /locus_tag="YDL182W"
FT                   /product="homocitrate synthase LYS20"
FT                   /EC_number="2.3.3.14"
FT                   /note="Homocitrate synthase isozyme and functions in DNA
FT                   repair; catalyzes the condensation of acetyl-CoA and
FT                   alpha-ketoglutarate to form homocitrate, which is the first
FT                   step in the lysine biosynthesis pathway; LYS20 has a
FT                   paralog, LYS21, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:P48570"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011872"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48570"
FT                   /experiment="EXISTENCE:direct assay:GO:0004410 homocitrate
FT                   synthase activity [PMID:14984204]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:9099739|PMID:11914276]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0001207
FT                   histone displacement [PMID:25628362]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006281 DNA
FT                   repair [PMID:25628362]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0019878
FT                   lysine biosynthetic process via aminoadipic acid
FT                   [PMID:18524920]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004410
FT                   homocitrate synthase activity [PMID:8923736]"
FT                   /protein_id="DAA11680.1"
FT                   /translation="MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEK
FT                   KIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAKVAVE
FT                   TGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEIRFSSEDSFRSDLV
FT                   DLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIA
FT                   NAYTALEGGARLIDVSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENL
FT                   VADAVEVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRL
FT                   TGWNAIKARVDQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQV
FT                   LSAKKNKKNDSDVPELATIPAAKRTKPSA"
FT   gene            135179..135436
FT                   /gene="INH1"
FT                   /locus_tag="YDL181W"
FT   mRNA            135179..135436
FT                   /gene="INH1"
FT                   /locus_tag="YDL181W"
FT                   /product="ATPase inhibitor"
FT   CDS_pept        135179..135436
FT                   /codon_start=1
FT                   /gene="INH1"
FT                   /locus_tag="YDL181W"
FT                   /product="ATPase inhibitor"
FT                   /note="Protein that inhibits ATP hydrolysis by the F1F0-ATP
FT                   synthase; inhibitory function is enhanced by stabilizing
FT                   proteins Stf1p and Stf2p; has a calmodulin-binding motif
FT                   and binds calmodulin in vitro; INH1 has a paralog, STF1,
FT                   that arose from the whole genome duplication"
FT                   /db_xref="GOA:P01097"
FT                   /db_xref="InterPro:IPR007648"
FT                   /db_xref="PDB:3ZIA"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01097"
FT                   /experiment="EXISTENCE:direct assay:GO:0004857 enzyme
FT                   inhibitor activity [PMID:12167646]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:12809520|PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032780 negative
FT                   regulation of ATPase activity [PMID:12809520]"
FT                   /experiment="EXISTENCE:direct assay:GO:0042030 ATPase
FT                   inhibitor activity [PMID:15294286]"
FT                   /protein_id="DAA11681.1"
FT                   /translation="MLPRSALARSLQLQRGVAARFYSEGSTGTPRGSGSEDSFVKRERA
FT                   TEDFFVRQREKEQLRHLKEQLEKQRKKIDSLENKIDSMTK"
FT   gene            135896..137539
FT                   /locus_tag="YDL180W"
FT   mRNA            135896..137539
FT                   /locus_tag="YDL180W"
FT                   /product="hypothetical protein"
FT   CDS_pept        135896..137539
FT                   /codon_start=1
FT                   /locus_tag="YDL180W"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; green fluorescent protein
FT                   (GFP)-fusion protein localizes to the vacuole"
FT                   /db_xref="GOA:Q12301"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12301"
FT                   /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
FT                   vacuole [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000329 fungal-type
FT                   vacuole membrane [PMID:26928762]"
FT                   /protein_id="DAA11682.1"
FT                   /translation="MVRLNHAASYFMPIFCSTRPHIVILSALFSISLFSLFYASSELLL
FT                   HQYDDPLMFKPNSQDYFRTFLLGLFSPFLYYFLKTFLFNINQRFLILNLIVDFPINDVF
FT                   MLLILIGLAYPQVQDHEGGTIKHKECSWHIIPRQAYIFGISWALGEFTICIIGNLFNYQ
FT                   EIADPNINSGFTHQESANTYCNNNDMSHNDDCGCSTEYRPNVVDRSDITLSKCIEVRND
FT                   SSSISNNVYSSEYHPIKPLRSSSSTYGSIRQQPHENKKQLHVPDNSQDDTIIMMNPIDN
FT                   SLKLTTLDTGDLSFPIDEEQPILKKSFGYTWAVPNENTQNTTKSFTPIKRFIAFSTAYQ
FT                   LVTGLLLMILVVGSNIMLTIGESLILSMYFVYVRGHEGLFTPVVNYFGSRTISNFILCV
FT                   IIPFISLNFLINTSIYLRRELDDWFNNSQGEFEDDDENTISKRVATNQEYQHPLSANYI
FT                   SMDSPDVINSSPGHFGMNSGQLLGNTTLYYGSLNGDDDDMTNDSALLRFCKKLVKNWRA
FT                   LARNDSFVLGVMVSWSLLVFVTGILSTVYI"
FT   gene            138291..139205
FT                   /gene="PCL9"
FT                   /locus_tag="YDL179W"
FT   mRNA            138291..139205
FT                   /gene="PCL9"
FT                   /locus_tag="YDL179W"
FT                   /product="Pcl9p"
FT   CDS_pept        138291..139205
FT                   /codon_start=1
FT                   /gene="PCL9"
FT                   /locus_tag="YDL179W"
FT                   /product="Pcl9p"
FT                   /note="Cyclin; forms a functional kinase complex with
FT                   Pho85p cyclin-dependent kinase (Cdk), expressed in late
FT                   M/early G1 phase, activated by Swi5p; PCL9 has a paralog,
FT                   PCL2, that arose from the whole genome duplication"
FT                   /db_xref="GOA:Q12477"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12477"
FT                   /experiment="EXISTENCE:direct assay:GO:0000131 incipient
FT                   cellular bud site [PMID:17853895]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005935 cellular bud
FT                   neck [PMID:17853895]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0032878
FT                   regulation of establishment or maintenance of cell polarity
FT                   [PMID:17853895]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016538
FT                   cyclin-dependent protein serine/threonine kinase regulator
FT                   activity [PMID:9593297]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0000083
FT                   regulation of transcription involved in G1/S transition of
FT                   mitotic cell cycle [PMID:19823668]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0000307
FT                   cyclin-dependent protein kinase holoenzyme complex
FT                   [PMID:9593297]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0032878
FT                   regulation of establishment or maintenance of cell polarity
FT                   [PMID:17853895]"
FT                   /protein_id="DAA11683.1"
FT                   /translation="MISDYDALLQFNKKPVSQEMIQFLATSTASIIKIRENNNPIQGCR
FT                   PPDLSIFIKNVVIQSNVQTPTLMATSVYLNKLKSVIPKNVYGINTTRHRIFLGCLILAA
FT                   KTLNDSSPWNKHWTTYTEGLLRIREVNTIERELLEYLNWDVRITTPDLIDSLSYFLGPI
FT                   KEQLFLQRRQEMLLFNAPSPGQLKEYINHRRPVSHSRTSSAISVPSLTSMATVSTTDSR
FT                   SSLLAKYQPSLPLVESDNFNKKNHVPLRNNNDICNNFRAEENIHSVNHIDVTMGSSPVM
FT                   SHKPTIHQRLNFTRRGWSSFFKQ"
FT   gene            139522..141114
FT                   /gene="DLD2"
FT                   /gene_synonym="AIP2"
FT                   /locus_tag="YDL178W"
FT   mRNA            139522..141114
FT                   /gene="DLD2"
FT                   /gene_synonym="AIP2"
FT                   /locus_tag="YDL178W"
FT                   /product="D-lactate dehydrogenase"
FT   CDS_pept        139522..141114
FT                   /codon_start=1
FT                   /gene="DLD2"
FT                   /gene_synonym="AIP2"
FT                   /locus_tag="YDL178W"
FT                   /product="D-lactate dehydrogenase"
FT                   /EC_number="1.1.2.4"
FT                   /EC_number="1.1.99.40"
FT                   /note="D-2-hydroxyglutarate dehydrogenase, and minor
FT                   D-lactate dehydrogenase; mitochondrial matrix protein that
FT                   oxidizes D-2-hydroxyglutarate (D-2HG), an oncometabolite,
FT                   to alpha-ketoglutarate with a minor role in lactate
FT                   catabolism; located in the mitochondrial matrix"
FT                   /db_xref="GOA:P46681"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46681"
FT                   /experiment="EXISTENCE:direct assay:GO:0004458 D-lactate
FT                   dehydrogenase (cytochrome) activity [PMID:10509019]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005759
FT                   mitochondrial matrix [PMID:10509019]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051990
FT                   (R)-2-hydroxyglutarate dehydrogenase activity
FT                   [PMID:26774271]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071949 FAD binding
FT                   [PMID:26774271]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0003779 actin
FT                   binding [PMID:15158445]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1903457 lactate
FT                   catabolic process [PMID:26774271]"
FT                   /protein_id="DAA11684.1"
FT                   /translation="MLRNILVRSTGSNFKFAGRYMKSSALLGYYRRVNYYSTKIQTRLT
FT                   SENYPDVHRDPRFKKLTSDDLNYFKSILSEQEILRASESEDLSFYNEDWMRKYKGQSKL
FT                   VLRPKSVEKVSLILNYCNDEKIAVVPQGGNTGLVGGSVPIFDELILSLANLNKIRDFDP
FT                   VSGILKCDAGVILENANNYVMEQNYMFPLDLGAKGSCHVGGVVATNAGGLRLLRYGSLH
FT                   GSVLGLEVVMPNGQIVNSMHSMRKDNTGYDLKQLFIGSEGTIGIITGVSILTVPKPKAF
FT                   NVSYLSVESFEDVQKVFVRARQELSEILSAFEFMDAKSQVLAKSQLKDAAFPLEDEHPF
FT                   YILIETSGSNKDHDDSKLETFLENVMEEGIVTDGVVAQDETELQNLWKWREMIPEASQA
FT                   NGGVYKYDVSLPLKDLYSLVEATNARLSEAELVGDSPKPVVGAIGYGHVGDGNLHLNVA
FT                   VREYNKNIEKTLEPFVYEFVSSKHGSVSAEHGLGFQKKNYIGYSKSPEEVKMMKDLKVH
FT                   YDPNGILNPYKYI"
FT   gene            complement(141209..141721)
FT                   /locus_tag="YDL177C"
FT   mRNA            complement(141209..141721)
FT                   /locus_tag="YDL177C"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(141209..141721)
FT                   /codon_start=1
FT                   /locus_tag="YDL177C"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; similar to the mouse IMPACT
FT                   gene; YDL177C is not an essential gene"
FT                   /db_xref="GOA:Q12257"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12257"
FT                   /protein_id="DAA11685.1"
FT                   /translation="MSKNVGKLVKIWNESEVLVDRKSKFQARCCPLQNQKDIPSILQEL
FT                   TQNNKSVSKASHMHMYAWRTAEVSNNLHLQQEQKKKGNKANKSNNSHVNKSRNITVQPK
FT                   NIEQGCADCGEAGAGQRLLTLLERANIFNVLVIVTRWYGGTPLGSSRFRHISTCAVETL
FT                   KKGGFLP"
FT   gene            142097..144223
FT                   /locus_tag="YDL176W"
FT   mRNA            142097..144223
FT                   /locus_tag="YDL176W"
FT                   /product="hypothetical protein"
FT   CDS_pept        142097..144223
FT                   /codon_start=1
FT                   /locus_tag="YDL176W"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; predicted by computational
FT                   methods to be involved in fructose-1,6-bisphosphatase
FT                   (Fbp1p) degradation; interacts with components of the GID
FT                   complex; YDL176W is not an essential gene"
FT                   /db_xref="GOA:Q12027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12027"
FT                   /protein_id="DAA11686.1"
FT                   /translation="MATGRIQFAVSTPCNTKGKPSGYRLFEFKNDRLALVPSERGCTKV
FT                   DVNANIQAFCYLRPNGRDTSISPDATHILDSCDYMVLAKSNGFIEIISNYQYKIKNGLR
FT                   LAPSYILRCTPEDFESNFFSDYMIAGLEYSQGLLYCCMCSGRIYVFVMNLPTDYIQYKN
FT                   MYNPMFPDCFFKVHHDNNTTHSSEEEKLFEGSTRYTGRSCSKHICYFLLPIEPSHLRSS
FT                   PVVSSFCNMYQGLPIYRPSMYLHIERGISTFHINPLDRFCFMTVSPRSPLFIRKIILPL
FT                   TYVTFLSTFISLKNSIQGDTCGEILSWDNVAQQNGFGSLFSWISNKFTFDTDIINSTIW
FT                   DDIVKYSGTGMLDSGIVWKQRQGHAKDDIYELFHTQDMLGSSRRNSSFSTASSEPRPLS
FT                   RRRRESFQALTRDAFRERMDVPCSTKWELDSFIRGLRRNTFMVDFEIVEKISHRNGNDG
FT                   VNEDDNTTDESDETMTSFLTDNYKKMDIVCIDHFVTLSAFRPRYYDEPIIKIDSLSNKN
FT                   GSENGTNEEEWAESQMKVDGQVIDDETAQFKQALGNLCSFKKLFMLDDSLCFILDTHGV
FT                   LLINRFEIKNTKNLLRNSKDTIRIIPHDFGLINDTIVIINDIDVGTDNVCALTFHLVVT
FT                   SMAGEITVLKGEFFKNCRLGRIKLCDSLKLNRKDRFVDKLALIDYDGLNAQKRRLDYDE
FT                   KDLYTFIVKKVKRD"
FT   gene            complement(144484..145518)
FT                   /gene="AIR2"
FT                   /locus_tag="YDL175C"
FT   mRNA            complement(144484..145518)
FT                   /gene="AIR2"
FT                   /locus_tag="YDL175C"
FT                   /product="TRAMP complex RNA-binding subunit"
FT   CDS_pept        complement(144484..145518)
FT                   /codon_start=1
FT                   /gene="AIR2"
FT                   /locus_tag="YDL175C"
FT                   /product="TRAMP complex RNA-binding subunit"
FT                   /note="RNA-binding subunit of the TRAMP nuclear RNA
FT                   surveillance complex; involved in nuclear RNA processing
FT                   and degradation; involved in TRAMP complex assembly as a
FT                   bridge between Mtr4p and Trf4p; stimulates the poly(A)
FT                   polymerase activity of Pap2p in vitro; has 5 zinc knuckle
FT                   motifs; AIR2 has a paralog, AIR1, that arose from the whole
FT                   genome duplication; Air2p and Air1p have nonredundant roles
FT                   in regulation of substrate specificity of the exosome"
FT                   /db_xref="GOA:Q12476"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR016713"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="PDB:2LLI"
FT                   /db_xref="PDB:3NYB"
FT                   /db_xref="PDB:4U4C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12476"
FT                   /experiment="EXISTENCE:direct assay:GO:0003723 RNA binding
FT                   [PMID:22402490]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004652
FT                   polynucleotide adenylyltransferase activity
FT                   [PMID:15935758|PMID:15935759]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005730 nucleolus
FT                   [PMID:16541108]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031499 TRAMP
FT                   complex [PMID:15828860|PMID:15935758|PMID:15935759]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034458 3'-5' RNA
FT                   helicase activity [PMID:22532666]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043629 ncRNA
FT                   polyadenylation [PMID:15828860|PMID:15935758]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071038 nuclear
FT                   polyadenylation-dependent tRNA catabolic process
FT                   [PMID:15828860|PMID:15935758|PMID:17643380]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0004652
FT                   polynucleotide adenylyltransferase activity
FT                   [PMID:15935759]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0071031
FT                   nuclear mRNA surveillance of mRNA 3'-end processing
FT                   [PMID:17410208]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0071035
FT                   nuclear polyadenylation-dependent rRNA catabolic process
FT                   [PMID:15935758|PMID:18007593]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0071036
FT                   nuclear polyadenylation-dependent snoRNA catabolic process
FT                   [PMID:15935758]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0071037
FT                   nuclear polyadenylation-dependent snRNA catabolic process
FT                   [PMID:15935758]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0071039
FT                   nuclear polyadenylation-dependent CUT catabolic process
FT                   [PMID:18591258]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006400 tRNA
FT                   modification [PMID:22319136]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030674 protein
FT                   binding, bridging [PMID:22402490]"
FT                   /protein_id="DAA11687.1"
FT                   /translation="MEKNTAPFVVDTAPTTPPDKLVAPSIEEVNSNPNELRALRGQGRY
FT                   FGVSDDDKDAIKEAAPKCNNCSQRGHLKKDCPHIICSYCGATDDHYSRHCPKAIQCSKC
FT                   DEVGHYRSQCPHKWKKVQCTLCKSKKHSKERCPSIWRAYILVDDNEKAKPKVLPFHTIY
FT                   CYNCGGKGHFGDDCKEKRSSRVPNEDGSAFTGSNLSVELKQEYYRHMNRNSDENEDYQF
FT                   SESIYDEDPLPRPSHKRHSQNDHSHSGRNKRRASNFHPPPYQKSNVIQPTIRGETLSLN
FT                   NNISKNSRYQNTKVNVSSISENMYGSRYNPSTYVDNNSISNSSNYRNYNSYQPYRSGTL
FT                   GKRR"
FT   gene            complement(145826..147589)
FT                   /gene="DLD1"
FT                   /locus_tag="YDL174C"
FT   mRNA            complement(145826..147589)
FT                   /gene="DLD1"
FT                   /locus_tag="YDL174C"
FT                   /product="D-lactate dehydrogenase"
FT   CDS_pept        complement(145826..147589)
FT                   /codon_start=1
FT                   /gene="DLD1"
FT                   /locus_tag="YDL174C"
FT                   /product="D-lactate dehydrogenase"
FT                   /EC_number="1.1.2.4"
FT                   /note="Major mitochondrial D-lactate dehydrogenase;
FT                   oxidizes D-lactate to pyruvate, transcription is
FT                   heme-dependent, repressed by glucose, and derepressed in
FT                   ethanol or lactate; located in the mitochondrial inner
FT                   membrane"
FT                   /db_xref="GOA:P32891"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32891"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:11502169|PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005743
FT                   mitochondrial inner membrane [PMID:9525904]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004458
FT                   D-lactate dehydrogenase (cytochrome) activity
FT                   [PMID:8492799]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1903457 lactate
FT                   catabolic process [PMID:26774271|PMID:8492799]"
FT                   /protein_id="DAA11688.1"
FT                   /translation="MLWKRTCTRLIKPIAQPRGRLVRRSCYRYASTGTGSTDSSSQWLK
FT                   YSVIASSATLFGYLFAKNLYSRETKEDLIEKLEMVKKIDPVNSTLKLSSLDSPDYLHDP
FT                   VKIDKVVEDLKQVLGNKPENYSDAKSDLDAHSDTYFNTHHPSPEQRPRIILFPHTTEEV
FT                   SKILKICHDNNMPVVPFSGGTSLEGHFLPTRIGDTITVDLSKFMNNVVKFDKLDLDITV
FT                   QAGLPWEDLNDYLSDHGLMFGCDPGPGAQIGGCIANSCSGTNAYRYGTMKENIINMTIV
FT                   LPDGTIVKTKKRPRKSSAGYNLNGLFVGSEGTLGIVTEATVKCHVKPKAETVAVVSFDT
FT                   IKDAAACASNLTQSGIHLNAMELLDENMMKLINASESTDRCDWVEKPTMFFKIGGRSPN
FT                   IVNALVDEVKAVAQLNHCNSFQFAKDDDEKLELWEARKVALWSVLDADKSKDKSAKIWT
FT                   TDVAVPVSQFDKVIHETKKDMQASKLINAIVGHAGDGNFHAFIVYRTPEEHETCSQLVD
FT                   RMVKRALNAEGTCTGEHGVGIGKREYLLEELGEAPVDLMRKIKLAIDPKRIMNPDKIFK
FT                   TDPNEPANDYR"
FT   gene            148191..149078
FT                   /gene="PAR32"
FT                   /gene_synonym="AMU1"
FT                   /locus_tag="YDL173W"
FT   mRNA            148191..149078
FT                   /gene="PAR32"
FT                   /gene_synonym="AMU1"
FT                   /locus_tag="YDL173W"
FT                   /product="Par32p"
FT   CDS_pept        148191..149078
FT                   /codon_start=1
FT                   /gene="PAR32"
FT                   /gene_synonym="AMU1"
FT                   /locus_tag="YDL173W"
FT                   /product="Par32p"
FT                   /note="Low complexity protein; mediates inhibition of Mep1p
FT                   and Mep3p activity; hyperphosphorylated upon rapamycin
FT                   treatment in a Tap42p-dependent manner; green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cytoplasm;
FT                   phosphorylation and localization regulated by
FT                   TORC1-effector kinase, Npr1p"
FT                   /db_xref="GOA:Q12515"
FT                   /db_xref="InterPro:IPR022024"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12515"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:26172854|PMID:14562095]"
FT                   /protein_id="DAA11689.1"
FT                   /translation="MATFNPQNEMENQARVQEYKVSTGRGGAGNIHKSMSKPSPVLLPL
FT                   KSNSKTVANNNNNGSNQEKVPRFAIGRGGAGNIFHDPHLTRSAQQLDSNDNINYNDVIN
FT                   DIDDYISPITSDMVDEGGSNPVTNTRSRISATRSHQSLHATTSSPNNNAPIVVGRGGAG
FT                   NIFFNKKKVASNGGNEEDEIRGGNIEDEDTINANEDNLFVVTSNGNALAAIKSTSKKPK
FT                   NKLKGKSAPEKFAIGRGGAGNIISPKSSRNTINHNLNDDDEDKFNLKDDNGKEKKKKKK
FT                   KKSGFFSSLKTMFN"
FT   gene            complement(149203..155640)
FT                   /gene="GLT1"
FT                   /locus_tag="YDL171C"
FT   mRNA            complement(149203..155640)
FT                   /gene="GLT1"
FT                   /locus_tag="YDL171C"
FT                   /product="glutamate synthase (NADH)"
FT   CDS_pept        complement(149203..155640)
FT                   /codon_start=1
FT                   /gene="GLT1"
FT                   /locus_tag="YDL171C"
FT                   /product="glutamate synthase (NADH)"
FT                   /EC_number="1.4.1.14"
FT                   /note="NAD(+)-dependent glutamate synthase (GOGAT);
FT                   synthesizes glutamate from glutamine and
FT                   alpha-ketoglutarate; with Gln1p, forms the secondary
FT                   pathway for glutamate biosynthesis from ammonia; expression
FT                   regulated by nitrogen source; assembles into filaments as
FT                   cells approach stationary phase and under cytosolic
FT                   acidification and starvation conditions"
FT                   /db_xref="GOA:Q12680"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12680"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016040 glutamate
FT                   synthase (NADH) activity [PMID:7836314]"
FT                   /experiment="EXISTENCE:expression pattern:GO:0006537
FT                   glutamate biosynthetic process [PMID:9657994]"
FT                   /experiment="EXISTENCE:expression pattern:GO:0019676
FT                   ammonia assimilation cycle [PMID:11356843]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016040
FT                   glutamate synthase (NADH) activity [PMID:7836314]"
FT                   /protein_id="DAA11690.1"
FT                   /translation="MPVLKSDNFDPLEEAYEGGTIQNYNDEHHLHKSWANVIPDKRGLY
FT                   DPDYEHDACGVGFVANKHGEQSHKIVTDARYLLVNMTHRGAVSSDGNGDGAGILLGIPH
FT                   EFMKREFKLDLDLDIPEMGKYAVGNVFFKKNEKNNKKNLIKCQKIFEDLAASFNLSVLG
FT                   WRNVPVDSTILGDVALSREPTILQPLLVPLYDEKQPEFNETKFRTQLYLLRKEASLQIG
FT                   LENWFYVCSLNNTTIVYKGQLTPAQVYNYYPDLTNAHFKSHMALVHSRFSTNTFPSWDR
FT                   AQPLRWLAHNGEINTLRGNKNWMRSREGVMNSATFKDELDKLYPIIEEGGSDSAALDNV
FT                   LELLTINGTLSLPEAVMMMVPEAYHKDMDSDLKAWYDWAACLMEPWDGPALLTFTDGRY
FT                   CGAILDRNGLRPCRYYITSDDRVICASEVGVIPIENSLVVQKGKLKPGDLFLVDTQLGE
FT                   MVDTKKLKSQISKRQDFKSWLSKVIKLDDLLSKTANLVPKEFISQDSLSLKVQSDPRLL
FT                   ANGYTFEQVTFLLTPMALTGKEALGSMGNDAPLACLNENPVLLYDYFRQLFAQVTNPPI
FT                   DPIREANVMSLECYVGPQGNLLEMHSSQCDRLLLKSPILHWNEFQALKNIEAAYPSWSV
FT                   AEIDITFDKSEGLLGYTDTIDKITKLASEAIDDGKKILIITDRKMGANRVSISSLIAIS
FT                   CIHHHLIRNKQRSQVALILETGEAREIHHFCVLLGYGCDGVYPYLAMETLVRMNREGLL
FT                   RNVNNDNDTLEEGQILENYKHAIDAGILKVMSKMGISTLASYKGAQIFEALGLDNSIVD
FT                   LCFTGTSSRIRGVTFEYLAQDAFSLHERGYPSRQTISKSVNLPESGEYHFRDGGYKHVN
FT                   EPTAIASLQDTVRNKNDVSWQLYVKKEMEAIRDCTLRGLLELDFENSVSIPLEQVEPWT
FT                   EIARRFASGAMSYGSISMEAHSTLAIAMNRLGAKSNCGEGGEDAERSAVQENGDTMRSA
FT                   IKQVASARFGVTSYYLSDADEIQIKIAQGAKPGEGGELPAHKVSKDIAKTRHSTPNVGL
FT                   ISPPPHHDIYSIEDLKQLIYDLKCANPRAGISVKLVSEVGVGIVASGVAKAKADHILVS
FT                   GHDGGTGAARWTSVKYAGLPWELGLAETHQTLVLNDLRRNVVVQTDGQLRTGFDIAVAV
FT                   LLGAESFTLATVPLIAMGCVMLRRCHLNSCAVGIATQDPYLRSKFKGQPEHVINFFYYL
FT                   IQDLRQIMAKLGFRTIDEMVGHSEKLKKRDDVNAKAINIDLSPILTPAHVIRPGVPTKF
FT                   TKKQDHKLHTRLDNKLIDEAEVTLDRGLPVNIDASIINTDRALGSTLSYRVSKKFGEDG
FT                   LPKDTVVVNIEGSAGQSFGAFLASGITFILNGDANDYVGKGLSGGIIVIKPPKDSKFKS
FT                   DENVIVGNTCFYGATSGTAFISGSAGERFGVRNSGATIVVERIKGNNAFEYMTGGRAIV
FT                   LSQMESLNAFSGATGGIAYCLTSDYDDFVGKINKDTVELESLCDPVEIAFVKNLIQEHW
FT                   NYTQSDLAARILGNFNHYLKDFVKVIPTDYKKVLLKEKAEAAKAKAKATSEYLKKFRSN
FT                   QEVDDEVNTLLIANQKAKEQEKKKSITISNKATLKEPKVVDLEDAVPDSKQLEKNSERI
FT                   EKTRGFMIHKRRHETHRDPRTRVNDWKEFTNPITKKDAKYQTARCMDCGTPFCLSDTGC
FT                   PLSNIIPKFNELLFKNQWKLALDKLLETNNFPEFTGRVCPAPCEGACTLGIIEDPVGIK
FT                   SVERIIIDNAFKEGWIKPCPPSTRTGFTVGVIGSGPAGLACADMLNRAGHTVTVYERSD
FT                   RCGGLLMYGIPNMKLDKAIVQRRIDLLSAEGIDFVTNTEIGKTISMDELKNKHNAVVYA
FT                   IGSTIPRDLPIKGRELKNIDFAMQLLESNTKALLNKDLEIIREKIQGKKVIVVGGGDTG
FT                   NDCLGTSVRHGAASVLNFELLPEPPVERAKDNPWPQWPRVMRVDYGHAEVKEHYGRDPR
FT                   EYCILSKEFIGNDEGEVTAIRTVRVEWKKSQSGVWQMVEIPNSEEIFEADIILLSMGFV
FT                   GPELINGNDNEVKKTRRGTIATLDDSSYSIDGGKTFACGDCRRGQSLIVWAIQEGRKCA
FT                   ASVDKFLMDGTTYLPSNGGIVQRDYKLLKELASQV"
FT   gene            156318..157904
FT                   /gene="UGA3"
FT                   /locus_tag="YDL170W"
FT   mRNA            156318..157904
FT                   /gene="UGA3"
FT                   /locus_tag="YDL170W"
FT                   /product="Uga3p"
FT   CDS_pept        156318..157904
FT                   /codon_start=1
FT                   /gene="UGA3"
FT                   /locus_tag="YDL170W"
FT                   /product="Uga3p"
FT                   /note="Transcriptional activator for GABA-dependent
FT                   induction of GABA genes; binds to DNA elements found in the
FT                   promoters of target genes and increases their expression in
FT                   the presence of GABA (gamma-aminobutyrate); zinc finger
FT                   transcription factor of the Zn(2)-Cys(6) binuclear cluster
FT                   domain type; localized to the nucleus; examples of GABA
FT                   genes include UGA1, UGA2, and UGA4"
FT                   /db_xref="GOA:P26370"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26370"
FT                   /experiment="EXISTENCE:direct assay:GO:0000978 RNA
FT                   polymerase II proximal promoter sequence-specific DNA
FT                   binding [PMID:12235130]"
FT                   /experiment="EXISTENCE:direct assay:GO:0001010 RNA
FT                   polymerase II sequence-specific DNA-binding transcription
FT                   factor recruiting activity [PMID:21515579]"
FT                   /experiment="EXISTENCE:direct assay:GO:0001228 DNA-binding
FT                   transcription activator activity, RNA polymerase
FT                   II-specific [PMID:21515579]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:19159085]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0001010 RNA
FT                   polymerase II sequence-specific DNA-binding transcription
FT                   factor recruiting activity [PMID:21515579]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001080 nitrogen
FT                   catabolite activation of transcription from RNA polymerase
FT                   II promoter [PMID:7899074]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0009450
FT                   gamma-aminobutyric acid catabolic process [PMID:3888627]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0019740 nitrogen
FT                   utilization [PMID:7899074]"
FT                   /protein_id="DAA11691.1"
FT                   /translation="MNYGVEKLKLKYSKHGCITCKIRKKRCSEDKPVCRDCRRLSFPCI
FT                   YISESVDKQSLKKIKADIQHQLISKKRKHAPDSAQKAAVATRTRRVGSDEQDNQVYLSK
FT                   PLEDCISQKLDSMGLQLYNYYRSHLANIISIAPMNQNYYLNIFLPMAHENDGILFAILA
FT                   WSANHLSISSSNELRKDEIFVNLANKYTYMSLSHLKTNEGSSACAKLGFLYSLAQILIL
FT                   CGSEICQGDVKFWKILLNIGKNLIENHVGKDVSRILTTTTEEPSLEERIIFPNFNSVVK
FT                   YWLIVNFIYHDILNFNTTSFPIEQYEKFFQRDQNSLPSSANFIESIDSPIEEIDPLIGI
FT                   NKPILLLLGQVTNLTRFLQTMEQEEMLEHGDKILSLQVEIYKLQPSLMALEHLDDEKKF
FT                   YYLELFEIMKISTLMFFQLTLLKIDKDSLELQILRNKLDSKLDKVIGTFLEGSLCFPLF
FT                   IYGVCIQVEDMEKKIDLEAKFDDILKRYKCYNFQNARLLIRKIWQNEADGISEHDLVHM
FT                   IDELDYNINFA"
FT   gene            complement(158064..158735)
FT                   /gene="UGX2"
FT                   /locus_tag="YDL169C"
FT   mRNA            complement(158064..158735)
FT                   /gene="UGX2"
FT                   /locus_tag="YDL169C"
FT                   /product="Ugx2p"
FT   CDS_pept        complement(158064..158735)
FT                   /codon_start=1
FT                   /gene="UGX2"
FT                   /locus_tag="YDL169C"
FT                   /product="Ugx2p"
FT                   /note="hypothetical protein; transcript accumulates in
FT                   response to any combination of stress conditions"
FT                   /db_xref="GOA:P32772"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32772"
FT                   /protein_id="DAA11692.1"
FT                   /translation="MEDKEKLIVYSNTSSVFTYSAEIRPNFKISVSQSQGFAWNQDLFA
FT                   TQYQQSYKVVYDAHEDNFDELILKIKGKLKTKSNKRAKMKSKTKLTRTAKQRRESPVCE
FT                   RDESDEDNDSDHYQRIQVLDGHEFPRANRYKSVWAHDVHSNEDSTSDGESNHDIDMIGG
FT                   TGTSYAGAAIMDRPRRKSERSISFVEDSKTGDYRYQTGQVDVVEVDSDTPENNHLKWLI
FT                   K"
FT   gene            159604..160764
FT                   /gene="SFA1"
FT                   /gene_synonym="ADH5"
FT                   /locus_tag="YDL168W"
FT   mRNA            159604..160764
FT                   /gene="SFA1"
FT                   /gene_synonym="ADH5"
FT                   /locus_tag="YDL168W"
FT                   /product="bifunctional alcohol
FT                   dehydrogenase/S-(hydroxymethyl)glutathione dehydrogenase"
FT   CDS_pept        159604..160764
FT                   /codon_start=1
FT                   /gene="SFA1"
FT                   /gene_synonym="ADH5"
FT                   /locus_tag="YDL168W"
FT                   /product="bifunctional alcohol
FT                   dehydrogenase/S-(hydroxymethyl)glutathione dehydrogenase"
FT                   /EC_number="1.1.1.284"
FT                   /EC_number="1.1.1.1"
FT                   /note="Bifunctional alcohol dehydrogenase and formaldehyde
FT                   dehydrogenase; formaldehyde dehydrogenase activity is
FT                   glutathione-dependent; functions in formaldehyde
FT                   detoxification and formation of long chain and complex
FT                   alcohols, regulated by Hog1p-Sko1p; protein abundance
FT                   increases in response to DNA replication stress"
FT                   /db_xref="GOA:P32771"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32771"
FT                   /experiment="EXISTENCE:direct assay:GO:0004022 alcohol
FT                   dehydrogenase (NAD) activity [PMID:8483449]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0046294 formaldehyde
FT                   catabolic process [PMID:8483449]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051903
FT                   S-(hydroxymethyl)glutathione dehydrogenase activity
FT                   [PMID:8483449]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000947 amino
FT                   acid catabolic process to alcohol via Ehrlich pathway
FT                   [PMID:12499363]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004022 alcohol
FT                   dehydrogenase (NAD) activity [PMID:12499363]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0033833
FT                   hydroxymethylfurfural reductase (NADH) activity
FT                   [PMID:16652391]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0033859
FT                   furaldehyde metabolic process [PMID:16652391]"
FT                   /protein_id="DAA11693.1"
FT                   /translation="MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEY
FT                   TAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKC
FT                   KFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVV
FT                   AIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGAS
FT                   KIIAIDINNKKKQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTK
FT                   IMRDALEACHKGWGQSIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLI
FT                   KDYQKGALKVEEFITHRRPFKEINQAFEDLHNGDCLRTVLKSDEIK"
FT   gene            complement(160995..163154)
FT                   /gene="NRP1"
FT                   /locus_tag="YDL167C"
FT   mRNA            complement(160995..163154)
FT                   /gene="NRP1"
FT                   /locus_tag="YDL167C"
FT                   /product="Nrp1p"
FT   CDS_pept        complement(160995..163154)
FT                   /codon_start=1
FT                   /gene="NRP1"
FT                   /locus_tag="YDL167C"
FT                   /product="Nrp1p"
FT                   /note="Putative RNA binding hypothetical protein; localizes
FT                   to stress granules induced by glucose deprivation;
FT                   predicted to be involved in ribosome biogenesis"
FT                   /db_xref="GOA:P32770"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034351"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036443"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32770"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0010494 cytoplasmic
FT                   stress granule [PMID:18981231|PMID:26777405]"
FT                   /protein_id="DAA11694.1"
FT                   /translation="MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSL
FT                   PSIEVNGTTKSLESAMVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILT
FT                   SYLQHPKVFDLWKEFDRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRI
FT                   LEVSIPTEEAGSVPEIYSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQ
FT                   EKSKILYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYV
FT                   EDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKA
FT                   QEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQIHTANSNNNVNS
FT                   SRNNLNNRVNSGSSSNISNTAANHPYGAPEFNMIANNTPAALTYNRAHFPAITPLSRQN
FT                   SLNMAPSNSGSPIIIADHFSGNNNIAPNYRYNNNINNNNNNINNMTNNRYNINNNINGN
FT                   GNGNGNNSNNNNNHNNNHNNNHHNGSINSNSNTNNNNNNNNGNNSNNCNSNIGMGGCGS
FT                   NMPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPASRTPSN
FT                   NNISVNTNGGSNAGRTDGNDNKGRDISLMEFMSPPLSMATKSMKEGDGNGSSFNEFKSD
FT                   KANVNFSNVGDNSAFGNGFNSSIRW"
FT   gene            complement(163449..164042)
FT                   /gene="FAP7"
FT                   /locus_tag="YDL166C"
FT   mRNA            complement(163449..164042)
FT                   /gene="FAP7"
FT                   /locus_tag="YDL166C"
FT                   /product="nucleoside-triphosphatase"
FT   CDS_pept        complement(163449..164042)
FT                   /codon_start=1
FT                   /gene="FAP7"
FT                   /locus_tag="YDL166C"
FT                   /product="nucleoside-triphosphatase"
FT                   /EC_number="2.7.4.3"
FT                   /note="Essential NTPase required for small ribosome subunit
FT                   synthesis; mediates processing of the 20S pre-rRNA at site
FT                   D in the cytoplasm but associates only transiently with 43S
FT                   preribosomes via Rps14p; complex with Rps14 is conserved
FT                   between humans, yeast, and arches; may be the endonuclease
FT                   for site D; depletion leads to accumulation of pre-40S
FT                   ribosomes in 80S-like ribosomes; human TAF9 functionally
FT                   complements the lethality of the null mutation"
FT                   /db_xref="GOA:Q12055"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12055"
FT                   /experiment="EXISTENCE:direct assay:GO:0004017 adenylate
FT                   kinase activity [PMID:24823650]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:10692169]"
FT                   /experiment="EXISTENCE:direct assay:GO:0010494 cytoplasmic
FT                   stress granule [PMID:26777405]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016887 ATPase
FT                   activity [PMID:24823650]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000462
FT                   maturation of SSU-rRNA from tricistronic rRNA transcript
FT                   (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
FT                   [PMID:12837249|PMID:16287850]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005737
FT                   cytoplasm [PMID:16287850]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034599 cellular
FT                   response to oxidative stress [PMID:10692169]"
FT                   /protein_id="DAA11695.1"
FT                   /translation="MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKD
FT                   NDCFEGYDEGRKSHIVDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDN
FT                   SNLYSRLHARGYHDSKIEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSR
FT                   IVAWEKMWLEQHPDGVTNEYQGPRSDDEDDEDSE"
FT   gene            164290..164865
FT                   /gene="CDC36"
FT                   /gene_synonym="DNA19"
FT                   /gene_synonym="NOT2"
FT                   /locus_tag="YDL165W"
FT   mRNA            164290..164865
FT                   /gene="CDC36"
FT                   /gene_synonym="DNA19"
FT                   /gene_synonym="NOT2"
FT                   /locus_tag="YDL165W"
FT                   /product="CCR4-NOT core subunit CDC36"
FT   CDS_pept        164290..164865
FT                   /codon_start=1
FT                   /gene="CDC36"
FT                   /gene_synonym="DNA19"
FT                   /gene_synonym="NOT2"
FT                   /locus_tag="YDL165W"
FT                   /product="CCR4-NOT core subunit CDC36"
FT                   /note="Component of the CCR4-NOT core complex, involved in
FT                   mRNA decapping; this complex has multiple roles in
FT                   regulating mRNA levels including regulation of
FT                   transcription and destabilizing mRNAs through
FT                   deadenylation; basal transcription factor"
FT                   /db_xref="GOA:P06100"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR038635"
FT                   /db_xref="InterPro:IPR040168"
FT                   /db_xref="PDB:4BY6"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06100"
FT                   /experiment="EXISTENCE:direct assay:GO:0000288
FT                   nuclear-transcribed mRNA catabolic process,
FT                   deadenylation-dependent decay [PMID:11889048]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000289
FT                   nuclear-transcribed mRNA poly(A) tail shortening
FT                   [PMID:11889048]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:7926748]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:11889048]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032968 positive
FT                   regulation of transcription elongation from RNA polymerase
FT                   II promoter [PMID:21406554]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000288
FT                   nuclear-transcribed mRNA catabolic process,
FT                   deadenylation-dependent decay [PMID:11889048]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000290
FT                   deadenylation-dependent decapping of nuclear-transcribed
FT                   mRNA [PMID:26952104]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000749 response
FT                   to pheromone triggering conjugation with cellular fusion
FT                   [PMID:2111445]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004842
FT                   ubiquitin-protein transferase activity [PMID:16926149]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006368
FT                   transcription elongation from RNA polymerase II promoter
FT                   [PMID:11404327]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016567 protein
FT                   ubiquitination [PMID:16926149]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031087
FT                   deadenylation-independent decapping of nuclear-transcribed
FT                   mRNA [PMID:15706350]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0051726
FT                   regulation of cell cycle [PMID:2111445]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0030015
FT                   CCR4-NOT core complex [PMID:10490603]"
FT                   /protein_id="DAA11696.1"
FT                   /translation="MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPR
FT                   DSQDHRVLDTFQSPWAETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRV
FT                   ALFQDETLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLS
FT                   ERGSYVFFDPQRWEKCQRDFLLFYNAIM"
FT   gene            complement(164987..167254)
FT                   /gene="CDC9"
FT                   /gene_synonym="MMS8"
FT                   /locus_tag="YDL164C"
FT   mRNA            complement(164987..167254)
FT                   /gene="CDC9"
FT                   /gene_synonym="MMS8"
FT                   /locus_tag="YDL164C"
FT                   /product="DNA ligase (ATP) CDC9"
FT   CDS_pept        complement(164987..167254)
FT                   /codon_start=1
FT                   /gene="CDC9"
FT                   /gene_synonym="MMS8"
FT                   /locus_tag="YDL164C"
FT                   /product="DNA ligase (ATP) CDC9"
FT                   /EC_number="6.5.1.1"
FT                   /note="DNA ligase I found in nucleus and mitochondria;
FT                   essential enzyme that joins Okazaki fragments during DNA
FT                   replication; also acts in ribonucleotide excision repair,
FT                   base excision repair, and recombination; DNA ligase I
FT                   mutants trigger ubiquitination of PCNA at K107,
FT                   facilitating Rad59p-mediated bypass of unligated Okazaki
FT                   fragments; human homolog LIG1 can complement yeast cdc9
FT                   temperature-sensitive mutant at restrictive temperature"
FT                   /db_xref="GOA:P04819"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="PDB:2OD8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04819"
FT                   /experiment="EXISTENCE:direct assay:GO:0003910 DNA ligase
FT                   (ATP) activity [PMID:1445910|PMID:6347688]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:10531002]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:10531002|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006266 DNA ligation
FT                   [PMID:9759502]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006273 lagging
FT                   strand elongation [PMID:9759502]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000278 mitotic
FT                   cell cycle [PMID:6749599]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005739
FT                   mitochondrion [PMID:10531002]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006266 DNA
FT                   ligation [PMID:9759502]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006273 lagging
FT                   strand elongation [PMID:9759502]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006284
FT                   base-excision repair [PMID:10052932]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006289
FT                   nucleotide-excision repair [PMID:10052932]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006310 DNA
FT                   recombination [PMID:9230305]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0035753
FT                   maintenance of DNA trinucleotide repeats [PMID:16079237]"
FT                   /protein_id="DAA11697.1"
FT                   /translation="MRRLLTGCLLSSARPLKSRLPLLMSSSLPSSAGKKPKQATLARFF
FT                   TSMKNKPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGSNF
FT                   SSIPSSAPSSGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISS
FT                   RLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETC
FT                   GKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQL
FT                   KKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDK
FT                   DVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPT
FT                   KAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFI
FT                   QDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYN
FT                   DERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVK
FT                   MLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCY
FT                   NQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLF
FT                   EVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHM
FT                   QN"
FT   gene            167714..169078
FT                   /gene="ENT1"
FT                   /locus_tag="YDL161W"
FT   mRNA            167714..169078
FT                   /gene="ENT1"
FT                   /locus_tag="YDL161W"
FT                   /product="epsin"
FT   CDS_pept        167714..169078
FT                   /codon_start=1
FT                   /gene="ENT1"
FT                   /locus_tag="YDL161W"
FT                   /product="epsin"
FT                   /note="Epsin-like protein involved in endocytosis and actin
FT                   patch assembly; functionally redundant with Ent2p; binds
FT                   clathrin via a clathrin-binding domain motif at C-terminus;
FT                   relocalizes from bud neck to cytoplasm upon DNA replication
FT                   stress; ENT1 has a paralog, ENT2, that arose from the whole
FT                   genome duplication"
FT                   /db_xref="GOA:Q12518"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="PDB:5AHV"
FT                   /db_xref="PDB:5LOZ"
FT                   /db_xref="PDB:5ONF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12518"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005769 early
FT                   endosome [PMID:10449404]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005934 cellular bud
FT                   tip [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005935 cellular bud
FT                   neck [PMID:22842922|PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030276 clathrin
FT                   binding [PMID:10449404]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043130 ubiquitin
FT                   binding [PMID:12529323]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043332 mating
FT                   projection tip [PMID:19053807]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000147 actin
FT                   cortical patch assembly [PMID:10449404]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005886 plasma
FT                   membrane [PMID:31370222]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006897
FT                   endocytosis [PMID:10449404]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007015 actin
FT                   filament organization [PMID:10449404]"
FT                   /protein_id="DAA11698.1"
FT                   /translation="MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEK
FT                   SYDSADFFEIMDMLDKRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKT
FT                   LKEFRHEDDEGIDQGQIVRVKAKELTALLSDDERLNEERNMNIKGRNRKGRRRRGTGRS
FT                   DENDDDLQRAISASRLTAEEDERRRKQDEDYETALQLSKEEEELKRLQDLQRMQQQQGQ
FT                   QQLQQPMYYDIFGNPITPEEYAQFQLQQQQQQQQQQLQQQPMYYDVFGNPITPEELAQF
FT                   QQQQQLQEQQYLASMQQQQQAMSNNPFAKSEQSSSSPKRNQLVAASSPQQLQQQKQQEP
FT                   LIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQ
FT                   VSDDPNHNPFLNSQYTGLPSTSVVPTQTGYGFGNQSQQQSQNNGSNNRGYTLIDL"
FT   gene            complement(169366..169608)
FT                   /gene="MHF2"
FT                   /locus_tag="YDL160C-A"
FT   mRNA            complement(169366..169608)
FT                   /gene="MHF2"
FT                   /locus_tag="YDL160C-A"
FT                   /product="Mhf2p"
FT   CDS_pept        complement(169366..169608)
FT                   /codon_start=1
FT                   /gene="MHF2"
FT                   /locus_tag="YDL160C-A"
FT                   /product="Mhf2p"
FT                   /note="Component of the heterotetrameric MHF histone-fold
FT                   complex; in humans the MHF complex interacts with both DNA
FT                   and Mph1p ortholog FANCM to stabilize and remodel blocked
FT                   replication forks and repair damaged DNA; mhf2 srs2 double
FT                   mutants are MMS hypersensitive; orthologous to human
FT                   centromere constitutive-associated network (CCAN) subunit
FT                   CENP-X, also known as MHF2"
FT                   /db_xref="EnsemblGenomes-Gn:YDL160C-A"
FT                   /db_xref="EnsemblGenomes-Tr:YDL160C-A"
FT                   /db_xref="GOA:Q3E829"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR018552"
FT                   /db_xref="PDB:3V9R"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3E829"
FT                   /experiment="EXISTENCE:direct assay:GO:0071821 FANCM-MHF
FT                   complex [PMID:22325783]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006974
FT                   cellular response to DNA damage stimulus [PMID:20347428]"
FT                   /protein_id="DAA11699.1"
FT                   /translation="MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRS
FT                   LQSHKDINGERGDKSPLELSHQDLERIVGLLLMDM"
FT   gene            complement(170410..171930)
FT                   /gene="DHH1"
FT                   /locus_tag="YDL160C"
FT   mRNA            complement(170410..171930)
FT                   /gene="DHH1"
FT                   /locus_tag="YDL160C"
FT                   /product="DExD/H-box ATP-dependent RNA helicase DHH1"
FT   CDS_pept        complement(170410..171930)
FT                   /codon_start=1
FT                   /gene="DHH1"
FT                   /locus_tag="YDL160C"
FT                   /product="DExD/H-box ATP-dependent RNA helicase DHH1"
FT                   /EC_number="3.6.4.13"
FT                   /note="Cytoplasmic DEAD-box helicase, stimulates mRNA
FT                   decapping; coordinates distinct steps in mRNA function and
FT                   decay, interacting with both decapping and deadenylase
FT                   complexes; role in translational repression, mRNA decay,
FT                   and possibly mRNA export; interacts and cooperates with
FT                   Ngr1p to promote specific mRNA decay; ATP- and RNA-bound
FT                   form promotes processing body (PB) assembly, while ATPase
FT                   stimulation by Not1p promotes PB disassembly; forms
FT                   cytoplasmic foci on replication stress"
FT                   /db_xref="GOA:P39517"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:1S2M"
FT                   /db_xref="PDB:4BRU"
FT                   /db_xref="PDB:4BRW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39517"
FT                   /experiment="EXISTENCE:direct assay:GO:0000932 P-body
FT                   [PMID:12730603|PMID:18611963|PMID:20368989]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003682 chromatin
FT                   binding [PMID:23706738]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003729 mRNA binding
FT                   [PMID:23222640]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:12032091|PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0010494 cytoplasmic
FT                   stress granule [PMID:20368989|PMID:26777405]"
FT                   /experiment="EXISTENCE:direct assay:GO:0010603 regulation
FT                   of cytoplasmic mRNA processing body assembly
FT                   [PMID:27692063]"
FT                   /experiment="EXISTENCE:direct assay:GO:0098562 cytoplasmic
FT                   side of membrane [PMID:27146487]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0033962
FT                   cytoplasmic mRNA processing body assembly [PMID:18981231]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0045900
FT                   negative regulation of translational elongation
FT                   [PMID:22719226]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000290
FT                   deadenylation-dependent decapping of nuclear-transcribed
FT                   mRNA [PMID:11780629]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0010603
FT                   regulation of cytoplasmic mRNA processing body assembly
FT                   [PMID:27692063]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0017148 negative
FT                   regulation of translation [PMID:21844211]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0033962
FT                   cytoplasmic mRNA processing body assembly [PMID:18182159]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034063 stress
FT                   granule assembly [PMID:18981231|PMID:20368989]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045900 negative
FT                   regulation of translational elongation [PMID:22719226]"
FT                   /protein_id="DAA11700.1"
FT                   /translation="MGSINNNFNTNNNSNTDLDRDWKTALNIPKKDTRPQTDDVLNTKG
FT                   NTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPT
FT                   LEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNE
FT                   TVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQS
FT                   LLFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKL
FT                   QINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCS
FT                   DLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIE
FT                   QELGTEIAAIPATIDKSLYVAENDETVPVPFPIEQQSYHQQAIPQQQLPSQQQFAIPPQ
FT                   QHHPQFMVPPSHQQQQAYPPPQMPSQQGYPPQQEHFMAMPPGQSQPQY"
FT   gene            172182..172313
FT                   /gene_synonym="YDL159W-B"
FT                   /locus_tag="YDL159W-A"
FT   mRNA            172182..172313
FT                   /gene_synonym="YDL159W-B"
FT                   /locus_tag="YDL159W-A"
FT                   /product="hypothetical protein"
FT   CDS_pept        172182..172313
FT                   /codon_start=1
FT                   /gene_synonym="YDL159W-B"
FT                   /locus_tag="YDL159W-A"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; identified by sequence
FT                   comparison with hemiascomycetous yeast species"
FT                   /db_xref="EnsemblGenomes-Gn:YDL159W-A"
FT                   /db_xref="EnsemblGenomes-Tr:YDL159W-A"
FT                   /db_xref="GOA:Q3E774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3E774"
FT                   /protein_id="DAA11701.1"
FT                   /translation="MYNQIINTFIDDCLFLQTPMLQSPISSKIVLSFFLRNFFPSLF"
FT   gene            172481..174028
FT                   /gene="STE7"
FT                   /locus_tag="YDL159W"
FT   mRNA            172481..174028
FT                   /gene="STE7"
FT                   /locus_tag="YDL159W"
FT                   /product="mitogen-activated protein kinase kinase STE7"
FT   CDS_pept        172481..174028
FT                   /codon_start=1
FT                   /gene="STE7"
FT                   /locus_tag="YDL159W"
FT                   /product="mitogen-activated protein kinase kinase STE7"
FT                   /EC_number="2.7.12.2"
FT                   /note="Signal transducing MAP kinase kinase; involved in
FT                   pheromone response where it phosphorylates Fus3p; involved
FT                   in the pseudohyphal/invasive growth pathway where it
FT                   phosphorylates of Kss1p; phosphorylated by Ste11p; degraded
FT                   by ubiquitin pathway"
FT                   /db_xref="GOA:P06784"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06784"
FT                   /experiment="EXISTENCE:direct assay:GO:0000187 activation
FT                   of MAPK activity [PMID:8384702]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004708 MAP kinase
FT                   kinase activity [PMID:8668180|PMID:8384702]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:11781566]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006468 protein
FT                   phosphorylation [PMID:8384702]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043332 mating
FT                   projection tip [PMID:11781566|PMID:17952059]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071507 pheromone
FT                   response MAPK cascade [PMID:8159759|PMID:8455599]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000196 cell
FT                   wall integrity MAPK cascade [PMID:10880465]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0001403
FT                   invasive growth in response to glucose limitation
FT                   [PMID:9363895]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0071507
FT                   pheromone response MAPK cascade [PMID:8455599]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000187
FT                   activation of MAPK activity [PMID:8384702]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001402 signal
FT                   transduction involved in filamentous growth
FT                   [PMID:15456892]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001403 invasive
FT                   growth in response to glucose limitation [PMID:8001818]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006468 protein
FT                   phosphorylation [PMID:15456892]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007124
FT                   pseudohyphal growth [PMID:8643578]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0010525
FT                   regulation of transposition, RNA-mediated [PMID:9566871]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0071507
FT                   pheromone response MAPK cascade [PMID:8159759]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0071507
FT                   pheromone response MAPK cascade [PMID:8668180]"
FT                   /protein_id="DAA11702.1"
FT                   /translation="MFQRKTLQRRNLKGLNLNLHPDVGNNGQLQEKTETHQGQSRIEGH
FT                   VMSNINAIQNNSNLFLRRGIKKKLTLDAFGDDQAISKPNTVVIQQPQNEPVLVLSSLSQ
FT                   SPCVSSSSSLSTPCIIDAYSNNFGLSPSSTNSTPSTIQGLSNIATPVENEHSISLPPLE
FT                   ESLSPAAADLKDTLSGTSNGNYIQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKKTI
FT                   PVEQNNSTIINQLVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDK
FT                   ILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLIN
FT                   SKGQIKLCDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVT
FT                   GEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIH
FT                   ELLHHDLIMKYVSPSKDDKFRHWCRKIKSKIKEDKRIKREALDRAKLEKKQSERSTH"
FT   gene            complement(174232..174588)
FT                   /locus_tag="YDL157C"
FT   mRNA            complement(174232..174588)
FT                   /locus_tag="YDL157C"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(174232..174588)
FT                   /codon_start=1
FT                   /locus_tag="YDL157C"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; the authentic, non-tagged
FT                   protein is detected in highly purified mitochondria in
FT                   high-throughput studies"
FT                   /db_xref="GOA:Q12082"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12082"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14562095|PMID:14576278|PMID:16823961]"
FT                   /protein_id="DAA11703.1"
FT                   /translation="MSNILAVFNPPPQRELEKEETMDCVPCQVMSTMFSVGFGSYLASG
FT                   KPFKYGKKEAKRGISLTEFEKRNPQWWKVTLRSFGGLLIAFGFVRGTEGWLWHKNKEYK
FT                   NYKKLSNDGETQAN"
FT   gene            174918..176486
FT                   /gene="CMR1"
FT                   /locus_tag="YDL156W"
FT   mRNA            174918..176486
FT                   /gene="CMR1"
FT                   /locus_tag="YDL156W"
FT                   /product="Cmr1p"
FT   CDS_pept        174918..176486
FT                   /codon_start=1
FT                   /gene="CMR1"
FT                   /locus_tag="YDL156W"
FT                   /product="Cmr1p"
FT                   /note="Nuclear protein with a role in protein quality
FT                   control; localizes to the intranuclear quality control
FT                   compartment (INQ) in response to proteasome inhibition or
FT                   DNA replication stress; INQ likely sequesters proteins
FT                   involved in DNA metabolism for degradation or re-folding;
FT                   DNA-binding protein with preference for UV-damaged DNA;
FT                   contains three WD domains (WD-40 repeat); human ortholog
FT                   WDR76 also exhibits perinuclear localization under similar
FT                   stress conditions"
FT                   /db_xref="GOA:Q12510"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR033052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12510"
FT                   /experiment="EXISTENCE:direct assay:GO:0000790 nuclear
FT                   chromatin [PMID:22367945]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003677 DNA binding
FT                   [PMID:22367945]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095|PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:22367945|PMID:14562095|PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034399 nuclear
FT                   periphery [PMID:25817432]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:2000001
FT                   regulation of DNA damage checkpoint [PMID:25817432]"
FT                   /protein_id="DAA11704.1"
FT                   /translation="MPELTEFQKKRLENIKRNNDLLKKLHLSGVASQIKHEAGVLEKSR
FT                   APAKKKQKTTNTRATKSASPTLPTRRSRRLRGESADDVKGIPNVNDNQLLKMGSPDGQD
FT                   KNFIDAIKEKPVIGDVKLSDLIKDEDESALLEKFKRFNNGNFSSGDFFEEIKKRQGDVT
FT                   GMDEFDLDLYDVFQPNEIKITYERISATYFHPAMEKKLIIAGDTSGTVGFWNVRDEPLA
FT                   DSEEDRMEEPDITRVKLFTKNVGRIDCFPADTSKILLTSYDGSIRSVHLNNLQSEEVLT
FT                   LKNEYDDSLGISDCQFSYENPNVLFLTTLGGEFTTFDTRVKKSEYNLRRLADKKIGSMA
FT                   INPMRPYEIATGSLDRTLKIWDTRNLVKKPEWSQYEDYPSHEIVSTYDSRLSVSAVSYS
FT                   PTDGTLVCNGYDDTIRLFDVKSRDHLSAKLEPKLTIQHNCQTGRWTSILKARFKPNKNV
FT                   FAIANMKRAIDIYNSEGQQLAHLPTATVPAVISWHPLRNWIAGGNSSGKIFLFTDDSGT
FT                   IKQEE"
FT   gene            176773..178056
FT                   /gene="CLB3"
FT                   /locus_tag="YDL155W"
FT   mRNA            176773..178056
FT                   /gene="CLB3"
FT                   /locus_tag="YDL155W"
FT                   /product="B-type cyclin CLB3"
FT   CDS_pept        176773..178056
FT                   /codon_start=1
FT                   /gene="CLB3"
FT                   /locus_tag="YDL155W"
FT                   /product="B-type cyclin CLB3"
FT                   /note="B-type cyclin involved in cell cycle progression;
FT                   activates Cdc28p to promote the G2/M transition; may be
FT                   involved in DNA replication and spindle assembly;
FT                   accumulates during S phase and G2, then targeted for
FT                   ubiquitin-mediated degradation; relative distribution to
FT                   the nucleus increases upon DNA replication stress; CLB3 has
FT                   a paralog, CLB4, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:P24870"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="InterPro:IPR039361"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24870"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:12972503|PMID:14562095|PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:12972503|PMID:14562095|PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0007135 meiosis II
FT                   [PMID:18423199]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0010696
FT                   positive regulation of mitotic spindle pole body separation
FT                   [PMID:11438663|PMID:1387566|PMID:16688214]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:1901673
FT                   regulation of mitotic spindle assembly [PMID:8319908]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000079
FT                   regulation of cyclin-dependent protein serine/threonine
FT                   kinase activity [PMID:8388545|PMID:8455600]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000086 G2/M
FT                   transition of mitotic cell cycle [PMID:1427070]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016538
FT                   cyclin-dependent protein serine/threonine kinase regulator
FT                   activity [PMID:8388545|PMID:8455600]"
FT                   /protein_id="DAA11705.1"
FT                   /translation="MHHNSQSLSSGHIRSPEDENVAPIGNLKHRTGSLSHISSAHPRVA
FT                   LSDVTNIVATNSSNNSISKPKVAPIKERLDSAAIIEEERLDANSVAQRKEADHNDLLTD
FT                   REQEEPVEDDGESEEDEEEDQEPLLLQHYASDTLVWEHAFRTYYRTTLDPNDDDVYDVV
FT                   MVAELSNEIFEYMRKLEDLYKPNPYYMDKQPELRWSFRSTLIDWIVQVHEKFQLLPETL
FT                   YLCINIIDRYLCKEVVPVNKFQLVGAASLFIAAKYEEINCPTIKDFVYMSENCYSRNDL
FT                   LDAERTILNGLEFELGWPGPMSFLRRISKADDYEHDTRTLAKYLLESTIMDHRLVSAQP
FT                   SWLAAGAYFLSKIILGQNQWSLAHVYYSNYTQEQILPLATIILENCRYASKRHNAIWRK
FT                   YSSRRYLHSSQIVAKWIALAEHRVERSN"
FT   gene            178334..181039
FT                   /gene="MSH5"
FT                   /locus_tag="YDL154W"
FT   mRNA            178334..181039
FT                   /gene="MSH5"
FT                   /locus_tag="YDL154W"
FT                   /product="MutS family protein MSH5"
FT   CDS_pept        178334..181039
FT                   /codon_start=1
FT                   /gene="MSH5"
FT                   /locus_tag="YDL154W"
FT                   /product="MutS family protein MSH5"
FT                   /note="Protein of the MutS family; forms a dimer with Msh4p
FT                   that facilitates crossovers between homologs during
FT                   meiosis; msh5-Y823H mutation confers tolerance to DNA
FT                   alkylating agents; homologs present in C. elegans and
FT                   humans"
FT                   /db_xref="GOA:Q12175"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR011184"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12175"
FT                   /experiment="EXISTENCE:direct assay:GO:0000228 nuclear
FT                   chromosome [PMID:8001134]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000400 four-way
FT                   junction DNA binding [PMID:30467025]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000403 Y-form DNA
FT                   binding [PMID:30467025]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003690
FT                   double-stranded DNA binding [PMID:30467025]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:11914276]"
FT                   /experiment="EXISTENCE:direct assay:GO:0062037 D-loop DNA
FT                   binding [PMID:30467025]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007131
FT                   reciprocal meiotic recombination
FT                   [PMID:8001134|PMID:15066280|PMID:9374523]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0062128
FT                   MutSgamma complex [PMID:9374523]"
FT                   /protein_id="DAA11706.1"
FT                   /translation="MSHEWLISASETMRSIGNGEGLRDKGAVVANNDGEFNEGDTNREE
FT                   DSSTIFSFDFDEEIVMCIDFSGGKLGCSILDYHTKTLKAFDQDYVVNKTTISSHDLIDD
FT                   ADMSSNDISLLLGLLIMEANPTVCLVPARLEDWIFDYIKTKCDEINCRLELQPIKRFKK
FT                   WDLLQSLQLRGHDNQTILNDILSNSKFTTTVTLGTVGCILANHEQLGEYNDSTASSNMV
FT                   TGRLVQNAFEDVIHGIRYIDIRDRMVLDENTISALHIFPTAHKLGHDKMMRNGFFSVFE
FT                   LFNQVSSDYARRILKSWLINPLTNKKRIETRYSIIRTLLDKQNAIIFSDLSQSIKRCPD
FT                   AFGFINQLRSGKSTLGTWSKVASFLEKGIAIFQLVSSLKLGSDEANILHDIKNKVDISA
FT                   LKECLRKVETVIDFDTSRDTKTLTINTGVDNRLDECRNIYNHLEGILLDVARETQIFLL
FT                   NTMPQEDCKTTKSLEKLVNAVYIPQLGYLVTISVLMEPLLDGIPNLQWEEIFRSSENIY
FT                   FKNGRVLELDETYGDIYGAISDFEIEILFSLQEQILRRKTQLTAYNILLSELEILLSFA
FT                   QVSAERNYAEPQLVEDECILEIINGRHALYETFLDNYIPNSTMIDGGLFSELSWCEQNK
FT                   GRIIVVTGANASGKSVYLTQNGLIVYLAQIGCFVPAERARIGIADKILTRIRTQETVYK
FT                   TQSSFLLDSQQMAKSLSLATEKSLILIDEYGKGTDILDGPSLFGSIMLNMSKSEKCPRI
FT                   IACTHFHELFNENVLTENIKGIKHYCTDILISQKYNLLETAHVGEDHESEGITFLFKVK
FT                   EGISKQSFGIYCAKVCGLSRDIVERAEELSRMINRGDDVVQQCGNLTEKEMREFQKNQE
FT                   IVKKFLSWDLDLETTTTSENLRLKLKNFLR"
FT   gene            complement(181186..183018)
FT                   /gene="SAS10"
FT                   /gene_synonym="UTP3"
FT                   /locus_tag="YDL153C"
FT   mRNA            complement(181186..183018)
FT                   /gene="SAS10"
FT                   /gene_synonym="UTP3"
FT                   /locus_tag="YDL153C"
FT                   /product="rRNA-processing protein SAS10"
FT   CDS_pept        complement(181186..183018)
FT                   /codon_start=1
FT                   /gene="SAS10"
FT                   /gene_synonym="UTP3"
FT                   /locus_tag="YDL153C"
FT                   /product="rRNA-processing protein SAS10"
FT                   /note="Subunit of U3-containing Small Subunit (SSU)
FT                   processome complex; involved in production of 18S rRNA and
FT                   assembly of small ribosomal subunit; disrupts silencing
FT                   when overproduced; mutant has increased aneuploidy
FT                   tolerance; essential gene"
FT                   /db_xref="GOA:Q12136"
FT                   /db_xref="InterPro:IPR018972"
FT                   /db_xref="PDB:5WLC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12136"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:9611201]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005730 nucleolus
FT                   [PMID:12068309]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032040
FT                   small-subunit processome [PMID:12068309]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000447
FT                   endonucleolytic cleavage in ITS1 to separate SSU-rRNA from
FT                   5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript
FT                   (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:15489292]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000462
FT                   maturation of SSU-rRNA from tricistronic rRNA transcript
FT                   (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
FT                   [PMID:12068309|PMID:12837249]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000472
FT                   endonucleolytic cleavage to generate mature 5'-end of
FT                   SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
FT                   [PMID:15489292]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000480
FT                   endonucleolytic cleavage in 5'-ETS of tricistronic rRNA
FT                   transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:15489292]"
FT                   /protein_id="DAA11707.1"
FT                   /translation="MVRKGSNRTKTSEVGDEINPYGLNEVDDFASKREKVLLGQSTFGD
FT                   SNKDDDHSLLEDEDEEEVLAMDEDDESIDEREDEEEEEEEELDGAAAYKKIFGRNLETD
FT                   QLPEEDEENGMLDNENAWGSTKGEYYGADDLDDDEAAKEIEKEALRQQKKHLEELNMND
FT                   YLDEEEEEEWVKSAKEFDMGEFKNSTKQADTKTSITDILNMDDEARDNYLRTMFPEFAP
FT                   LSKEFTELAPKFDELKKSEENEFNKLKLIALGSYLGTISCYYSILLHELHNNEDFTSMK
FT                   GHPVMEKILTTKEIWRQASELPSSFDVNEGDGSESEETANIEAFNEKKLNELQNSEDSD
FT                   AEDGGKQKQEIDEEERESDEEEEEEDVDIDDFEEYVAQSRLHSKPKTSSMPEADDFIES
FT                   EIADVDAQDKKARRRTLRFYTSKIDQQENKKTDRFKGDDDIPYKERLFERQQRLLDEAR
FT                   KRGMHDNNGADLDDKDYGSEDEAVSRSINTQGENDYYQQVQRGKQDKKISRKEAHKNAV
FT                   IAAREGKLAELAENVSGDGKRAINYQILKNKGLTPKRNKDNRNSRVKKRKKYQKAQKKL
FT                   KSVRAVYSGGQSGVYEGEKTGIKKGLTRSVKFKN"
FT   gene            183343..184611
FT                   /gene="RPC53"
FT                   /gene_synonym="RPC4"
FT                   /locus_tag="YDL150W"
FT   mRNA            183343..184611
FT                   /gene="RPC53"
FT                   /gene_synonym="RPC4"
FT                   /locus_tag="YDL150W"
FT                   /product="DNA-directed RNA polymerase III subunit C53"
FT   CDS_pept        183343..184611
FT                   /codon_start=1
FT                   /gene="RPC53"
FT                   /gene_synonym="RPC4"
FT                   /locus_tag="YDL150W"
FT                   /product="DNA-directed RNA polymerase III subunit C53"
FT                   /note="RNA polymerase III subunit C53"
FT                   /db_xref="GOA:P25441"
FT                   /db_xref="InterPro:IPR007811"
FT                   /db_xref="PDB:5FJ8"
FT                   /db_xref="PDB:5FJ9"
FT                   /db_xref="PDB:5FJA"
FT                   /db_xref="PDB:6CNB"
FT                   /db_xref="PDB:6CNC"
FT                   /db_xref="PDB:6CND"
FT                   /db_xref="PDB:6CNF"
FT                   /db_xref="PDB:6EU0"
FT                   /db_xref="PDB:6EU1"
FT                   /db_xref="PDB:6EU2"
FT                   /db_xref="PDB:6EU3"
FT                   /db_xref="PDB:6F40"
FT                   /db_xref="PDB:6F41"
FT                   /db_xref="PDB:6F42"
FT                   /db_xref="PDB:6F44"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25441"
FT                   /experiment="EXISTENCE:direct assay:GO:0001056 RNA
FT                   polymerase III activity [PMID:3905793]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005666 RNA
FT                   polymerase III complex [PMID:10611227|PMID:3905793]"
FT                   /experiment="EXISTENCE:direct assay:GO:0042797 tRNA
FT                   transcription by RNA polymerase III [PMID:3905793]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0042797 tRNA
FT                   transcription by RNA polymerase III [PMID:1406624]"
FT                   /protein_id="DAA11708.1"
FT                   /translation="MSSNKGNGRLPSLKDSSSNGGGSAKPSLKFKPKAVARKSKEEREA
FT                   AASKVKLEEESKRGNDKKHFNNKNKRVTGAGGQQRRMAKYLNNTHVISSGPLAAGNFVS
FT                   EKGDLRRGFIKSEGSGSSLVQKGLETIDNGAESSENEAEDDDNEGVASKSKKKFNMGKE
FT                   FEARNLIEDEDDGESEKSSDVDMDDEEWRSKRIEQLFPVRPVRVRHEDVETVKREIQEA
FT                   LSEKPTREPTPSVKTEPVGTGLQSYLEERERQVNEKLADLGLEKEFQSVDGKEAAAELE
FT                   LLNADHQHILRKLKKMNNKPERFMVFQLPTRLPAFERPAVKEEKEDMETQASDPSKKKK
FT                   NIKKKDTKDALSTRELAGKVGSIRVHKSGKLSVKIGNVVMDIGKGAETTFLQDVIALSI
FT                   ADDASSAELLGRVDGKIVVTPQI"
FT   gene            184925..187918
FT                   /gene="ATG9"
FT                   /gene_synonym="APG9"
FT                   /gene_synonym="AUT9"
FT                   /gene_synonym="CVT6"
FT                   /gene_synonym="CVT7"
FT                   /locus_tag="YDL149W"
FT   mRNA            184925..187918
FT                   /gene="ATG9"
FT                   /gene_synonym="APG9"
FT                   /gene_synonym="AUT9"
FT                   /gene_synonym="CVT6"
FT                   /gene_synonym="CVT7"
FT                   /locus_tag="YDL149W"
FT                   /product="autophagy protein ATG9"
FT   CDS_pept        184925..187918
FT                   /codon_start=1
FT                   /gene="ATG9"
FT                   /gene_synonym="APG9"
FT                   /gene_synonym="AUT9"
FT                   /gene_synonym="CVT7"
FT                   /gene_synonym="CVT6"
FT                   /locus_tag="YDL149W"
FT                   /product="autophagy protein ATG9"
FT                   /note="Transmembrane protein involved in forming Cvt and
FT                   autophagic vesicles; cycles between the phagophore assembly
FT                   site (PAS) and other cytosolic punctate structures, not
FT                   found in autophagosomes; may be involved in membrane
FT                   delivery to the PAS"
FT                   /db_xref="GOA:Q12142"
FT                   /db_xref="InterPro:IPR007241"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12142"
FT                   /experiment="EXISTENCE:direct assay:GO:0000407 phagophore
FT                   assembly site [PMID:16874040|PMID:18497569|PMID:23129774]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:16874040]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030659 cytoplasmic
FT                   vesicle membrane [PMID:23129774]"
FT                   /experiment="EXISTENCE:direct assay:GO:0061908 phagophore
FT                   [PMID:23549786]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000045
FT                   autophagosome assembly
FT                   [PMID:10662773|PMID:23129774|PMID:24881874]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000422
FT                   autophagy of mitochondrion [PMID:19793921]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0032258 protein
FT                   localization by the Cvt pathway [PMID:10662773]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034497 protein
FT                   localization to phagophore assembly site [PMID:23129774]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034727
FT                   piecemeal microautophagy of the nucleus [PMID:18701704]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0044805 late
FT                   nucleophagy [PMID:22768199]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0061709
FT                   reticulophagy [PMID:26181331]"
FT                   /protein_id="DAA11709.1"
FT                   /translation="MERDEYQLPNSHGKNTFLSRIFGLQSDEVNPSLNSQEMSNFPLPD
FT                   IERGSSLLHSTNDSREDVDENDLRVPESDQGTSTEEEDEVDEEQVQAYAPQISDGLDGD
FT                   HQLNSVTSKENVLETEKSNLERLVEGSTDDSVPKVGQLSSEEEEDNEFINNDGFDDDTP
FT                   LFQKSKIHEFSSKKSNTIEDGKRPLFFRHILQNNRPQRDTQKLFTSSNAIHHDKDKSAN
FT                   NGPRNINGNQKHGTKYFGSATQPRFTGSPLNNTNRFTKLFPLRKPNLLSNISVLNNTPE
FT                   DRINTLSVKERALWKWANVENLDIFLQDVYNYYLGNGFYCIILEKILNICTLLFVVFVS
FT                   TYMGHCVDYSKLPTSHRVSDIIIDKCYSNSITGFTKFFLWMFYFFVILKIVQLYFDVQK
FT                   LSELQNFYKYLLNISDDELQTLPWQNVIQQLMYLKDQNAMTANVVEVKAKNRIDAHDVA
FT                   NRIMRRENYLIALYNSDILNLSLPIPLFRTNVLTKTLEWNINLCVMGFVFNESGFIKQS
FT                   ILKPSQREFTREELQKRFMLAGFLNIILAPFLVTYFVLLYFFRYFNEYKTSPGSIGARQ
FT                   YTPIAEWKFREYNELYHIFKKRISLSTTLANKYVDQFPKEKTNLFLKFVSFICGSFVAI
FT                   LAFLTVFDPENFLNFEITSDRSVIFYITILGAIWSVSRNTITQEYHVFDPEETLKELYE
FT                   YTHYLPKEWEGRYHKEEIKLEFCKLYNLRIVILLRELTSLMITPFVLWFSLPSSAGRIV
FT                   DFFRENSEYVDGLGYVCKYAMFNMKNIDGEDTHSMDEDSLTKKIAVNGSHTLNSKRRSK
FT                   FTAEDHSDKDLANNKMLQSYVYFMDDYSNSENLTGKYQLPAKKGYPNNEGDSFLNNKYS
FT                   WRKQFQPGQKPELFRIGKHALGPGHNISPAIYSTRNPGKNWDNNNNGDDIKNGTNNATA
FT                   KNDDNNGNNDHEYVLTESFLDSGAFPNHDVIDHNKMLNSNYNGNGILNKGGVLGLVKEY
FT                   YKKSDVGR"
FT   gene            complement(188154..190586)
FT                   /gene="NOP14"
FT                   /gene_synonym="UTP2"
FT                   /locus_tag="YDL148C"
FT   mRNA            complement(188154..190586)
FT                   /gene="NOP14"
FT                   /gene_synonym="UTP2"
FT                   /locus_tag="YDL148C"
FT                   /product="snoRNA-binding rRNA-processing protein NOP14"
FT   CDS_pept        complement(188154..190586)
FT                   /codon_start=1
FT                   /gene="NOP14"
FT                   /gene_synonym="UTP2"
FT                   /locus_tag="YDL148C"
FT                   /product="snoRNA-binding rRNA-processing protein NOP14"
FT                   /note="Nucleolar protein; forms a complex with Noc4p that
FT                   mediates maturation and nuclear export of 40S ribosomal
FT                   subunits; also present in the small subunit processome
FT                   complex, which is required for processing of pre-18S rRNA"
FT                   /db_xref="GOA:Q99207"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="PDB:5WLC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99207"
FT                   /experiment="EXISTENCE:direct assay:GO:0005730 nucleolus
FT                   [PMID:10684247|PMID:12068309|PMID:12150911]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030686 90S
FT                   preribosome [PMID:12150911]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030688 preribosome,
FT                   small subunit precursor [PMID:15167894]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032040
FT                   small-subunit processome [PMID:12068309]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034511 U3 snoRNA
FT                   binding [PMID:12068309]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000447
FT                   endonucleolytic cleavage in ITS1 to separate SSU-rRNA from
FT                   5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript
FT                   (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:15489292]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000462
FT                   maturation of SSU-rRNA from tricistronic rRNA transcript
FT                   (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:12068309]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000472
FT                   endonucleolytic cleavage to generate mature 5'-end of
FT                   SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
FT                   [PMID:15489292]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000480
FT                   endonucleolytic cleavage in 5'-ETS of tricistronic rRNA
FT                   transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:15489292]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006364 rRNA
FT                   processing [PMID:11694595]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0042274
FT                   ribosomal small subunit biogenesis [PMID:11694595]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0030692
FT                   Noc4p-Nop14p complex [PMID:12446671]"
FT                   /protein_id="DAA11710.1"
FT                   /translation="MAGSQLKNLKAALKARGLTGQTNVKSKNKKNSKRQAKEYDREEKK
FT                   KAIAEIREEFNPFEIKAARNKRRDGLPSKTADRIAVGKPGISKQIGEEQRKRAFEARKM
FT                   MKNKRGGVIDKRFGERDKLLTEEEKMLERFTRERQSQSKRNANLFNLEDDEDDGDMFGD
FT                   GLTHLGQSLSLEDELANDEEDFLASKRFNEDDAELQQPQRKKTKAEVMKEVIAKSKFYK
FT                   QERQKAQGIMEDQIDNLDDNFEDVMSELMMTQPKKNPMEPKTDLDKEYDIKVKELQLDK
FT                   RAAPSDRTKTEEEKNAEAEEKKRELEQQRLDRMNGMIELEEGEERGVEDLDDGFWENEE
FT                   DYEDDNDGIADSDDDIKFEDQGRDEGFSQILKKKNISISCPRTHDALLDQVKKLDLDDH
FT                   PKIVKNIIKAYQPKLAEGNKEKLGKFTAVLLRHIIFLSNQNYLKNVQSFKRTQNALISI
FT                   LKSLSEKYNRELSEECRDYINEMQARYKKNHFDALSNGDLVFFSIIGILFSTSDQYHLV
FT                   ITPALILMSQFLEQIKFNSLKRIAFGAVLVRIVSQYQRISKRYIPEVVYFFQKILLTFI
FT                   VEKENQEKPLDFENIRLDSYELGLPLDVDFTKKRSTIIPLHTLSTMDTEAHPVDQCVSV
FT                   LLNVMESLDATISTVWKSLPAFNEIILPIQQLLSAYTSKYSDFEKPRNILNKVEKLTKF
FT                   TEHIPLALQNHKPVSIPTHAPKYEENFNPDKKSYDPDRTRSEINKMKAQLKKERKFTMK
FT                   EIRKDAKFEARQRIEEKNKESSDYHAKMAHIVNTINTEEGAEKNKYERERKLRGGKK"
FT   gene            190924..192261
FT                   /gene="RPN5"
FT                   /gene_synonym="NAS5"
FT                   /locus_tag="YDL147W"
FT   mRNA            190924..192261
FT                   /gene="RPN5"
FT                   /gene_synonym="NAS5"
FT                   /locus_tag="YDL147W"
FT                   /product="proteasome regulatory particle lid subunit RPN5"
FT   CDS_pept        190924..192261
FT                   /codon_start=1
FT                   /gene="RPN5"
FT                   /gene_synonym="NAS5"
FT                   /locus_tag="YDL147W"
FT                   /product="proteasome regulatory particle lid subunit RPN5"
FT                   /note="Subunit of the CSN and 26S proteasome lid complexes;
FT                   similar to mammalian p55 subunit and to another S.
FT                   cerevisiae regulatory subunit, Rpn7p; Rpn5p is an essential
FT                   protein; the COP9 signalosome is also known as the CSN"
FT                   /db_xref="GOA:Q12250"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR035297"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040134"
FT                   /db_xref="InterPro:IPR040896"
FT                   /db_xref="PDB:3J47"
FT                   /db_xref="PDB:3JCK"
FT                   /db_xref="PDB:3JCO"
FT                   /db_xref="PDB:3JCP"
FT                   /db_xref="PDB:4CR2"
FT                   /db_xref="PDB:4CR3"
FT                   /db_xref="PDB:4CR4"
FT                   /db_xref="PDB:5A5B"
FT                   /db_xref="PDB:5MPB"
FT                   /db_xref="PDB:5MPC"
FT                   /db_xref="PDB:5MPD"
FT                   /db_xref="PDB:5MPE"
FT                   /db_xref="PDB:5WVI"
FT                   /db_xref="PDB:5WVK"
FT                   /db_xref="PDB:5ZMR"
FT                   /db_xref="PDB:6FVT"
FT                   /db_xref="PDB:6FVU"
FT                   /db_xref="PDB:6FVV"
FT                   /db_xref="PDB:6FVW"
FT                   /db_xref="PDB:6FVX"
FT                   /db_xref="PDB:6FVY"
FT                   /db_xref="PDB:6J2C"
FT                   /db_xref="PDB:6J2N"
FT                   /db_xref="PDB:6J2Q"
FT                   /db_xref="PDB:6J2X"
FT                   /db_xref="PDB:6J30"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12250"
FT                   /experiment="EXISTENCE:direct assay:GO:0000502 proteasome
FT                   complex [PMID:21289098]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008180 COP9
FT                   signalosome [PMID:21289098]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008541 proteasome
FT                   regulatory particle, lid subcomplex
FT                   [PMID:11742986|PMID:9741626]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034515 proteasome
FT                   storage granule [PMID:18504300]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000338 protein
FT                   deneddylation [PMID:21289098]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0005515
FT                   protein binding [PMID:27226596]"
FT                   /protein_id="DAA11711.1"
FT                   /translation="MSRDAPIKADKDYSQILKEEFPKIDSLAQNDCNSALDQLLVLEKK
FT                   TRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKVMEYL
FT                   KSSKSLDLNTRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCEL
FT                   QVETYGSMEMSEKIQFILEQMELSILKGDYSQATVLSRKILKKTFKNPKYESLKLEYYN
FT                   LLVKISLHKREYLEVAQYLQEIYQTDAIKSDEAKWKPVLSHIVYFLVLSPYGNLQNDLI
FT                   HKIQNDNNLKKLESQESLVKLFTTNELMRWPIVQKTYEPVLNEDDLAFGGEANKHHWED
FT                   LQKRVIEHNLRVISEYYSRITLLRLNELLDLTESQTETYISDLVNQGIIYAKVNRPAKI
FT                   VNFEKPKNSSQLLNEWSHNVDELLEHIETIGHLITKEEIMHGLQAK"
FT   gene            192750..194225
FT                   /gene="LDB17"
FT                   /locus_tag="YDL146W"
FT   mRNA            192750..194225
FT                   /gene="LDB17"
FT                   /locus_tag="YDL146W"
FT                   /product="Ldb17p"
FT   CDS_pept        192750..194225
FT                   /codon_start=1
FT                   /gene="LDB17"
FT                   /locus_tag="YDL146W"
FT                   /product="Ldb17p"
FT                   /note="Protein involved in the regulation of endocytosis;
FT                   transiently recruited to actin cortical patches in a
FT                   SLA1-dependent manner after late coat component assembly;
FT                   GFP-fusion protein localizes to the periphery, cytoplasm,
FT                   bud, and bud neck"
FT                   /db_xref="GOA:Q12342"
FT                   /db_xref="InterPro:IPR018556"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12342"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005933 cellular bud
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005935 cellular bud
FT                   neck [PMID:14562095|PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030479 actin
FT                   cortical patch [PMID:19506040]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006897
FT                   endocytosis [PMID:19506040]"
FT                   /protein_id="DAA11712.1"
FT                   /translation="MILDPLSPNIENHTQDEIIEFWEKTESIANIPKENLDESHVNSSL
FT                   VAYLKFATDSYKVFINTDRDLYRMSLILLESSLFEFKKEFCLSKLQSLLNIDLLEMNMK
FT                   FIIVYILLCEAKKNVYSLEIMLKFQGFTVFYNTLYTQFAYLSKYGKERTVASKHQYNSN
FT                   NSSTGTSLDSLDRSLTDIDLGIIDEMKQISTVLMDLLFQIMKYCKCVIANLQIVDDFFV
FT                   YYMMESMRSDTMDDMFNNAEFKLLLALNEQYMMFAKEYDIENKVYKYLINGSVSRCFTE
FT                   LLLLKFNRASDPPLQIMMCKIIYLILTPRGDYSPMNFFYTNDLRVLIDVLIRELQNISE
FT                   DEEVLRNTLLRVLIPLLKNTQLSKTHYRKDDLNKLLNYLSTLDNICVDSPALHEHQVTV
FT                   ALSRKCLQQIPWLETPSTPSDGGSSVSSNNTSRNSSIVALGTPDNQNILARKGHLYSNR
FT                   ELDVSAESLTKRKAKAPPPPPPPPPSRKCGTPK"
FT   gene            complement(194571..198176)
FT                   /gene="COP1"
FT                   /gene_synonym="RET1"
FT                   /gene_synonym="SEC33"
FT                   /gene_synonym="SOO1"
FT                   /locus_tag="YDL145C"
FT   mRNA            complement(194571..198176)
FT                   /gene="COP1"
FT                   /gene_synonym="RET1"
FT                   /gene_synonym="SEC33"
FT                   /gene_synonym="SOO1"
FT                   /locus_tag="YDL145C"
FT                   /product="coatomer subunit alpha"
FT   CDS_pept        complement(194571..198176)
FT                   /codon_start=1
FT                   /gene="COP1"
FT                   /gene_synonym="RET1"
FT                   /gene_synonym="SEC33"
FT                   /gene_synonym="SOO1"
FT                   /locus_tag="YDL145C"
FT                   /product="coatomer subunit alpha"
FT                   /note="Alpha subunit of COPI vesicle coatomer complex;
FT                   complex surrounds transport vesicles in the early secretory
FT                   pathway"
FT                   /db_xref="GOA:P53622"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR010714"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016391"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="PDB:3MKQ"
FT                   /db_xref="PDB:3MV2"
FT                   /db_xref="PDB:3MV3"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53622"
FT                   /experiment="EXISTENCE:direct assay:GO:0043130 ubiquitin
FT                   binding [PMID:21070969]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006888
FT                   endoplasmic reticulum to Golgi vesicle-mediated transport
FT                   [PMID:9427388]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006890
FT                   retrograde vesicle-mediated transport, Golgi to endoplasmic
FT                   reticulum [PMID:8001155]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030126 COPI
FT                   vesicle coat [PMID:8001155]"
FT                   /protein_id="DAA11713.1"
FT                   /translation="MKMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTL
FT                   LHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFH
FT                   RELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRI
FT                   WDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP
FT                   LIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWD
FT                   LDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERPCSFIHQNQLFFV
FT                   NAEKQIQSFNFQKRVASLPYASLKGIGQPWDAFRSISYNPSQHSVLVNEANGKFALVIL
FT                   PKQPVGAVEPTSVTQDTGNFATFVGRNRFVVYNKNTESVEVRSLENKVTRNIKVEETVR
FT                   TIVAAGPGSVLVIHPREVILYDVQQGKKVSQLAVKNVKYVSWSLDGQYVALMSKHTITL
FT                   ATKKLELINSMHETIRIKSAAWDETGVLIYSTLNHIRYSLLNGDRGIIKTLEKTLYITK
FT                   VQGKLVYCLNREGEIEILTIDPTEYRFKKALVNKNFPEVLRLIKDSNLVGQNIISYLQK
FT                   SGYPEIALQFVQDPHIRFDLALEYGNLDVALDEAKKLNDSSTWERLIQEALAQGNASLA
FT                   EMIYQTQHSFDKLSFLYLVTGDVNKLSKMQNIAQTREDFGSMLLNTFYNNSTKERSSIF
FT                   AEGGSLPLAYAVAKANGDEAAASAFLEQAEVDEQDVTLPDQMDASNFVQRPVISKPLEK
FT                   WPLKEAELSYFEKAVLGQIDDLTIDDETPAVNTTQEQEEPLGEENFNDEDIGEDEGAWD
FT                   LGDEDLDVGEELPEEVEQGEITSPAQEVETAIWIKNSKLPAVLVAAGAFDAAVQALSKQ
FT                   VGVVKLEPLKKYFTNIYEGCRTYIPSTPCELPAQLGYVRAYDDTVSEDQILPYVPGLDV
FT                   VNEKMNEGYKNFKLNKPDIAIECFREAIYRITLLMVDDAEDEKLAHKILETAREYILGL
FT                   SIELERRSLKEGNTVRMLELAAYFTKAKLSPIHRTNALQVAMSQHFKHKNFLQASYFAG
FT                   EFLKIISSGPRAEQARKIKNKADSMASDAIPIDFDPYAKFDICAATYKPIYEDTPSVSD
FT                   PLTGSKYVITEKDKIDRIAMISKIGAPASGLRIRV"
FT   gene            complement(198662..199732)
FT                   /locus_tag="YDL144C"
FT   mRNA            complement(198662..199732)
FT                   /locus_tag="YDL144C"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(198662..199732)
FT                   /codon_start=1
FT                   /locus_tag="YDL144C"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; green fluorescent protein
FT                   (GFP)-fusion protein localizes to the cytoplasm and
FT                   nucleus; YDL144C is not an essential gene; protein
FT                   abundance increases in response to DNA replication stress"
FT                   /db_xref="GOA:Q07589"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07589"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /protein_id="DAA11714.1"
FT                   /translation="MSRILVIGAGGVGVITALSLWLKKESDVSLVVRSDYDRVLKHGYT
FT                   IESCDYGRLEGWRPHHIYSSVEDAASAADNQGYNYIVVTTKNIIDGPVNSRVSNIIRPV
FT                   LEKNKELHGPQLTTHILLVQNGIDIEKEIWAEFPREQYRYTVLSGIQLIGSTKIGSGHI
FT                   SQVGQDHLSCGAFDPQDAAAIQAANDFVRMYSNEGQNFVEFDPRVRYSRWKKLLYNAAI
FT                   NTSTALVGLDVPRCLEFGVNKKSTEIEVFHPAMREIIAIAASEGIIIEEEFITMFTEIT
FT                   RKKVFKPSMCVDCEKGQLMELEVILGNPIRIAKRNGVATPTLSILYNLLVLVQAKLKER
FT                   KGLLKFDEKTATLVDE"
FT   gene            199996..201582
FT                   /gene="CCT4"
FT                   /gene_synonym="ANC2"
FT                   /gene_synonym="TCP4"
FT                   /locus_tag="YDL143W"
FT   mRNA            199996..201582
FT                   /gene="CCT4"
FT                   /gene_synonym="ANC2"
FT                   /gene_synonym="TCP4"
FT                   /locus_tag="YDL143W"
FT                   /product="chaperonin-containing T-complex subunit CCT4"
FT   CDS_pept        199996..201582
FT                   /codon_start=1
FT                   /gene="CCT4"
FT                   /gene_synonym="ANC2"
FT                   /gene_synonym="TCP4"
FT                   /locus_tag="YDL143W"
FT                   /product="chaperonin-containing T-complex subunit CCT4"
FT                   /note="Subunit of the cytosolic chaperonin Cct ring
FT                   complex; related to Tcp1p, required for the assembly of
FT                   actin and tubulins in vivo"
FT                   /db_xref="GOA:P39078"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012717"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="PDB:4V81"
FT                   /db_xref="PDB:4V8R"
FT                   /db_xref="PDB:4V94"
FT                   /db_xref="PDB:5GW4"
FT                   /db_xref="PDB:5GW5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39078"
FT                   /experiment="EXISTENCE:direct assay:GO:0005832
FT                   chaperonin-containing T-complex [PMID:16762366]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006457 protein
FT                   folding [PMID:16762366]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051082 unfolded
FT                   protein binding [PMID:16762366]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0005832
FT                   chaperonin-containing T-complex [PMID:15704212]"
FT                   /protein_id="DAA11715.1"
FT                   /translation="MSAKVPSNATFKNKEKPQEVRKANIIAARSVADAIRTSLGPKGMD
FT                   KMIKTSRGEIIISNDGHTILKQMAILHPVARMLVEVSAAQDSEAGDGTTSVVILTGALL
FT                   GAAERLLNKGIHPTIIADSFQSAAKRSVDILLEMCHKVSLSDREQLVRAASTSLSSKIV
FT                   SQYSSFLAPLAVDSVLKISDENSKNVDLNDIRLVKKVGGTIDDTEMIDGVVLTQTAIKS
FT                   AGGPTRKEKAKIGLIQFQISPPKPDTENNIIVNDYRQMDKILKEERAYLLNICKKIKKA
FT                   KCNVLLIQKSILRDAVNDLALHFLSKLNIMVVKDIEREEIEFLSKGLGCKPIADIELFT
FT                   EDRLGSADLVEEIDSDGSKIVRVTGIRNNNARPTVSVVIRGANNMIIDETERSLHDALC
FT                   VIRCLVKERGLIAGGGAPEIEISRRLSKEARSMEGVQAFIWQEFASALEVIPTTLAENA
FT                   GLNSIKVVTELRSKHENGELNDGISVRRSGTTNTYEEHILQPVLVSTSAITLASECVKS
FT                   ILRIDDIAFSR"
FT   gene            complement(201719..202570)
FT                   /gene="CRD1"
FT                   /gene_synonym="CLS1"
FT                   /locus_tag="YDL142C"
FT   mRNA            complement(201719..202570)
FT                   /gene="CRD1"
FT                   /gene_synonym="CLS1"
FT                   /locus_tag="YDL142C"
FT                   /product="cardiolipin synthase"
FT   CDS_pept        complement(201719..202570)
FT                   /codon_start=1
FT                   /gene="CRD1"
FT                   /gene_synonym="CLS1"
FT                   /locus_tag="YDL142C"
FT                   /product="cardiolipin synthase"
FT                   /EC_number="2.7.8.41"
FT                   /note="Cardiolipin synthase; produces cardiolipin, which is
FT                   a phospholipid of the mitochondrial inner membrane that is
FT                   required for normal mitochondrial membrane potential and
FT                   function and for correct integration of
FT                   membrane-multispanning proteins into the mitochondrial
FT                   outer membrane; required to maintain tubular mitochondrial
FT                   morphology and functions in mitochondrial fusion; also
FT                   required for normal vacuolar ion homeostasis"
FT                   /db_xref="GOA:Q07560"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07560"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008610 lipid
FT                   biosynthetic process [PMID:7564918]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008808 cardiolipin
FT                   synthase activity [PMID:7564918]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000002
FT                   mitochondrial genome maintenance [PMID:25843549]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006612 protein
FT                   targeting to membrane [PMID:26235513]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006644
FT                   phospholipid metabolic process [PMID:27402848]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006873 cellular
FT                   ion homeostasis [PMID:18799619]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007006
FT                   mitochondrial membrane organization [PMID:10777514]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0008610 lipid
FT                   biosynthetic process [PMID:9614098]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0008808
FT                   cardiolipin synthase activity [PMID:9614098]"
FT                   /protein_id="DAA11716.1"
FT                   /translation="MIQMVPIYSCSALLRRTIPKRPFYHVLSGLTVRFKVNPQLNYNLF
FT                   RDLTRREYATNPSKTPHIKSKLLNIPNILTLSRIGCTPFIGLFIITNNLTPALGLFAFS
FT                   SITDFMDGYIARKYGLKTIAGTILDPLADKLLMITTTLALSVPSGPQIIPVSIAAIILG
FT                   RDVLLAISALFIRYSTLKLKYPGRVAWNSYWDIVRYPSAEVRPSQLSKWNTFFQMVYLG
FT                   SGVLLLLYEKEEGCEKTEEDFEDRKQDFQKAFSYLGYVTATTTIMSGVSYALKRNAFKL
FT                   LK"
FT   gene            203039..205111
FT                   /gene="BPL1"
FT                   /gene_synonym="ACC2"
FT                   /locus_tag="YDL141W"
FT   mRNA            203039..205111
FT                   /gene="BPL1"
FT                   /gene_synonym="ACC2"
FT                   /locus_tag="YDL141W"
FT                   /product="biotin--[acetyl-CoA-carboxylase] ligase BPL1"
FT   CDS_pept        203039..205111
FT                   /codon_start=1
FT                   /gene="BPL1"
FT                   /gene_synonym="ACC2"
FT                   /locus_tag="YDL141W"
FT                   /product="biotin--[acetyl-CoA-carboxylase] ligase BPL1"
FT                   /EC_number="6.3.4.15"
FT                   /EC_number="6.3.4.10"
FT                   /EC_number="6.3.4.9"
FT                   /EC_number="6.3.4.11"
FT                   /note="Biotin:apoprotein ligase; covalently modifies
FT                   proteins with the addition of biotin, required for
FT                   acetyl-CoA carboxylase (Acc1p) holoenzyme formation;
FT                   comparative analysis suggests that a mitochondrially
FT                   targeted form may result from translation starting at a
FT                   non-canonical codon upstream of the annotated start codon;
FT                   human homolog HLCS can complement yeast BPL1 mutant"
FT                   /db_xref="GOA:P48445"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR019197"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48445"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:11914276|PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0009305 protein
FT                   biotinylation [PMID:10551847]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071734
FT                   biotin-[pyruvate-carboxylase] ligase activity
FT                   [PMID:10551847]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004077
FT                   biotin-[acetyl-CoA-carboxylase] ligase activity
FT                   [PMID:6108218]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0009305 protein
FT                   biotinylation [PMID:6108218]"
FT                   /protein_id="DAA11717.1"
FT                   /translation="MNVLVYNGPGTTPGSVKHAVESLRDFLEPYYAVSTVNVKVLQTEP
FT                   WMSKTSAVVFPGGADLPYVQACQPIISRLKHFVSKQGGVFIGFCAGGYFGTSRVEFAQG
FT                   DPTMEVSGSRDLRFFPGTSRGPAYNGFQYNSEAGARAVKLNLPDGSQFSTYFNGGAVFV
FT                   DADKFDNVEILATYAEHPDVPSSDSGKGQSENPAAVVLCTVGRGKVLLTGPHPEFNVRF
FT                   MRKSTDKHFLETVVENLKAQEIMRLKFMRTVLTKTGLNCNNDFNYVRAPNLTPLFMASA
FT                   PNKRNYLQEMENNLAHHGMHANNVELCSELNAETDSFQFYRGYRASYDAASSSLLHKEP
FT                   DEVPKTVIFPGVDEDIPPFQYTPNFDMKEYFKYLNVQNTIGSLLLYGEVVTSTSTILNN
FT                   NKSLLSSIPESTLLHVGTIQVSGRGRGGNTWINPKGVCASTAVVTMPLQSPVTNRNISV
FT                   VFVQYLSMLAYCKAILSYAPGFSDIPVRIKWPNDLYALSPTYYKRKNLKLVNTGFEHTK
FT                   LPLGDIEPAYLKISGLLVNTHFINNKYCLLLGCGINLTSDGPTTSLQTWIDILNEERQQ
FT                   LHLDLLPAIKAEKLQALYMNNLEVILKQFINYGAAEILPSYYELWLHSNQIVTLPDHGN
FT                   TQAMITGITEDYGLLIAKELVSGSSTQFTGNVYNLQPDGNTFDIFKSLIAKKVQS"
FT   gene            complement(205360..210561)
FT                   /gene="RPO21"
FT                   /gene_synonym="RPB1"
FT                   /gene_synonym="RPB220"
FT                   /gene_synonym="SUA8"
FT                   /locus_tag="YDL140C"
FT   mRNA            complement(205360..210561)
FT                   /gene="RPO21"
FT                   /gene_synonym="RPB1"
FT                   /gene_synonym="RPB220"
FT                   /gene_synonym="SUA8"
FT                   /locus_tag="YDL140C"
FT                   /product="DNA-directed RNA polymerase II core subunit
FT                   RPO21"
FT   CDS_pept        complement(205360..210561)
FT                   /codon_start=1
FT                   /gene="RPO21"
FT                   /gene_synonym="RPB1"
FT                   /gene_synonym="RPB220"
FT                   /gene_synonym="SUA8"
FT                   /locus_tag="YDL140C"
FT                   /product="DNA-directed RNA polymerase II core subunit
FT                   RPO21"
FT                   /EC_number="2.7.7.6"
FT                   /note="RNA polymerase II largest subunit B220; part of
FT                   central core; phosphorylation of C-terminal heptapeptide
FT                   repeat domain regulates association with transcription and
FT                   splicing factors; similar to bacterial beta-prime"
FT                   /db_xref="GOA:P04050"
FT                   /db_xref="InterPro:IPR000684"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007073"
FT                   /db_xref="InterPro:IPR007075"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR038593"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="PDB:1I3Q"
FT                   /db_xref="PDB:1I50"
FT                   /db_xref="PDB:1I6H"
FT                   /db_xref="PDB:1K83"
FT                   /db_xref="PDB:1NIK"
FT                   /db_xref="PDB:1NT9"
FT                   /db_xref="PDB:1PQV"
FT                   /db_xref="PDB:1R5U"
FT                   /db_xref="PDB:1R9S"
FT                   /db_xref="PDB:1R9T"
FT                   /db_xref="PDB:1SFO"
FT                   /db_xref="PDB:1TWA"
FT                   /db_xref="PDB:1TWC"
FT                   /db_xref="PDB:1TWF"
FT                   /db_xref="PDB:1TWG"
FT                   /db_xref="PDB:1TWH"
FT                   /db_xref="PDB:1WCM"
FT                   /db_xref="PDB:1Y1V"
FT                   /db_xref="PDB:1Y1W"
FT                   /db_xref="PDB:1Y1Y"
FT                   /db_xref="PDB:1Y77"
FT                   /db_xref="PDB:2B63"
FT                   /db_xref="PDB:2B8K"
FT                   /db_xref="PDB:2E2H"
FT                   /db_xref="PDB:2E2I"
FT                   /db_xref="PDB:2E2J"
FT                   /db_xref="PDB:2JA5"
FT                   /db_xref="PDB:2JA6"
FT                   /db_xref="PDB:2JA7"
FT                   /db_xref="PDB:2JA8"
FT                   /db_xref="PDB:2L0I"
FT                   /db_xref="PDB:2LO6"
FT                   /db_xref="PDB:2NVQ"
FT                   /db_xref="PDB:2NVT"
FT                   /db_xref="PDB:2NVX"
FT                   /db_xref="PDB:2NVY"
FT                   /db_xref="PDB:2NVZ"
FT                   /db_xref="PDB:2R7Z"
FT                   /db_xref="PDB:2R92"
FT                   /db_xref="PDB:2R93"
FT                   /db_xref="PDB:2VUM"
FT                   /db_xref="PDB:2YU9"
FT                   /db_xref="PDB:3CQZ"
FT                   /db_xref="PDB:3FKI"
FT                   /db_xref="PDB:3GTG"
FT                   /db_xref="PDB:3GTJ"
FT                   /db_xref="PDB:3GTK"
FT                   /db_xref="PDB:3GTL"
FT                   /db_xref="PDB:3GTM"
FT                   /db_xref="PDB:3GTO"
FT                   /db_xref="PDB:3GTP"
FT                   /db_xref="PDB:3GTQ"
FT                   /db_xref="PDB:3H3V"
FT                   /db_xref="PDB:3HOU"
FT                   /db_xref="PDB:3HOV"
FT                   /db_xref="PDB:3HOW"
FT                   /db_xref="PDB:3HOX"
FT                   /db_xref="PDB:3HOY"
FT                   /db_xref="PDB:3HOZ"
FT                   /db_xref="PDB:3I4M"
FT                   /db_xref="PDB:3I4N"
FT                   /db_xref="PDB:3J0K"
FT                   /db_xref="PDB:3J1N"
FT                   /db_xref="PDB:3K1F"
FT                   /db_xref="PDB:3K7A"
FT                   /db_xref="PDB:3M3Y"
FT                   /db_xref="PDB:3M4O"
FT                   /db_xref="PDB:3PO2"
FT                   /db_xref="PDB:3PO3"
FT                   /db_xref="PDB:3QT1"
FT                   /db_xref="PDB:3RZD"
FT                   /db_xref="PDB:3RZO"
FT                   /db_xref="PDB:3S14"
FT                   /db_xref="PDB:3S15"
FT                   /db_xref="PDB:3S16"
FT                   /db_xref="PDB:3S17"
FT                   /db_xref="PDB:3S1M"
FT                   /db_xref="PDB:3S1N"
FT                   /db_xref="PDB:3S1Q"
FT                   /db_xref="PDB:3S1R"
FT                   /db_xref="PDB:3S2D"
FT                   /db_xref="PDB:3S2H"
FT                   /db_xref="PDB:4A3B"
FT                   /db_xref="PDB:4A3C"
FT                   /db_xref="PDB:4A3D"
FT                   /db_xref="PDB:4A3E"
FT                   /db_xref="PDB:4A3F"
FT                   /db_xref="PDB:4A3G"
FT                   /db_xref="PDB:4A3I"
FT                   /db_xref="PDB:4A3J"
FT                   /db_xref="PDB:4A3K"
FT                   /db_xref="PDB:4A3L"
FT                   /db_xref="PDB:4A3M"
FT                   /db_xref="PDB:4A93"
FT                   /db_xref="PDB:4BBR"
FT                   /db_xref="PDB:4BBS"
FT                   /db_xref="PDB:4BXX"
FT                   /db_xref="PDB:4BXZ"
FT                   /db_xref="PDB:4BY1"
FT                   /db_xref="PDB:4BY7"
FT                   /db_xref="PDB:4GWQ"
FT                   /db_xref="PDB:4V1M"
FT                   /db_xref="PDB:4V1N"
FT                   /db_xref="PDB:4V1O"
FT                   /db_xref="PDB:4X67"
FT                   /db_xref="PDB:4X6A"
FT                   /db_xref="PDB:4Y52"
FT                   /db_xref="PDB:4Y7N"
FT                   /db_xref="PDB:5C3E"
FT                   /db_xref="PDB:5C44"
FT                   /db_xref="PDB:5C4A"
FT                   /db_xref="PDB:5C4J"
FT                   /db_xref="PDB:5C4X"
FT                   /db_xref="PDB:5FMF"
FT                   /db_xref="PDB:5FYW"
FT                   /db_xref="PDB:5FZ5"
FT                   /db_xref="PDB:5IP7"
FT                   /db_xref="PDB:5IP9"
FT                   /db_xref="PDB:5LVF"
FT                   /db_xref="PDB:5M9D"
FT                   /db_xref="PDB:5OQJ"
FT                   /db_xref="PDB:5OQM"
FT                   /db_xref="PDB:5OT2"
FT                   /db_xref="PDB:5SVA"
FT                   /db_xref="PDB:5U5Q"
FT                   /db_xref="PDB:5VKL"
FT                   /db_xref="PDB:5VKO"
FT                   /db_xref="PDB:5VVR"
FT                   /db_xref="PDB:5VVS"
FT                   /db_xref="PDB:5W4U"
FT                   /db_xref="PDB:5W51"
FT                   /db_xref="PDB:6BLO"
FT                   /db_xref="PDB:6BLP"
FT                   /db_xref="PDB:6BM2"
FT                   /db_xref="PDB:6BM4"
FT                   /db_xref="PDB:6BQF"
FT                   /db_xref="PDB:6GYK"
FT                   /db_xref="PDB:6GYL"
FT                   /db_xref="PDB:6GYM"
FT                   /db_xref="PDB:6I84"
FT                   /db_xref="PDB:6NPW"
FT                   /db_xref="PDB:6O6C"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04050"
FT                   /experiment="EXISTENCE:direct assay:GO:0001055 RNA
FT                   polymerase II activity [PMID:8288647]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003677 DNA binding
FT                   [PMID:26945063]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003968 RNA-directed
FT                   5'-3' RNA polymerase activity [PMID:18004386]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005665 RNA
FT                   polymerase II, core complex
FT                   [PMID:1331084|PMID:2183013|PMID:2186966]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0010494 cytoplasmic
FT                   stress granule [PMID:26777405]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006366
FT                   transcription by RNA polymerase II [PMID:3299050]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0019985
FT                   translesion synthesis [PMID:22405652]"
FT                   /protein_id="DAA11718.1"
FT                   /translation="MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQ
FT                   TRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCE
FT                   CVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVS
FT                   RGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSL
FT                   GFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEH
FT                   NGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNL
FT                   MGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEH
FT                   PGAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAH
FT                   RVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSN
FT                   KPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQ
FT                   ILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTR
FT                   EKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVT
FT                   KEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKG
FT                   SFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQE
FT                   FFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGED
FT                   GMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLD
FT                   EEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNAQQTFHIDHTKPSDLTIKDIVLG
FT                   VKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQAFDWVLSN
FT                   IEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNV
FT                   AKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPED
FT                   EEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKQTFKNDLF
FT                   VIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIERVVM
FT                   MKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEA
FT                   GRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSF
FT                   EETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVMIDEESLVKYMPEQKITE
FT                   IEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
FT                   SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSP
FT                   TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP
FT                   SYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYS
FT                   PTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR"
FT   gene            complement(211375..212046)
FT                   /gene="SCM3"
FT                   /locus_tag="YDL139C"
FT   mRNA            complement(211375..212046)
FT                   /gene="SCM3"
FT                   /locus_tag="YDL139C"
FT                   /product="Scm3p"
FT   CDS_pept        complement(211375..212046)
FT                   /codon_start=1
FT                   /gene="SCM3"
FT                   /locus_tag="YDL139C"
FT                   /product="Scm3p"
FT                   /note="Nonhistone component of centromeric chromatin; binds
FT                   to histone H3 variant, Cse4p, and recruits it to
FT                   centromeres; involved in the assembly and maintenance of
FT                   Cse4-H4 at centromeres; required for kinetochore assembly
FT                   and G2/M progression; may protect Cse4p from
FT                   ubiquitination; homolog of mammalian HJURP"
FT                   /db_xref="GOA:Q12334"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR018465"
FT                   /db_xref="PDB:2L5A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12334"
FT                   /experiment="EXISTENCE:direct assay:GO:0000780 condensed
FT                   nuclear chromosome, centromeric region
FT                   [PMID:17569568|PMID:17574026]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:2000059 negative
FT                   regulation of ubiquitin-dependent protein catabolic process
FT                   [PMID:21070970]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000086 G2/M
FT                   transition of mitotic cell cycle [PMID:17548816]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007059
FT                   chromosome segregation [PMID:17569568|PMID:17574026]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0051382
FT                   kinetochore assembly [PMID:17569568]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0071459 protein
FT                   localization to chromosome, centromeric region
FT                   [PMID:17548816|PMID:17569568]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0097030 CENP-A
FT                   containing nucleosome binding [PMID:21412236]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0000780
FT                   condensed nuclear chromosome, centromeric region
FT                   [PMID:17548816]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0097030
FT                   CENP-A containing nucleosome binding [PMID:21412236]"
FT                   /protein_id="DAA11719.1"
FT                   /translation="MKTNKKISKRRSLKNLHGALKGLLKESGKKSESKIRKHSDCNPVH
FT                   RVYPPNIEKRKTKKDDGISRPIAERNGHVYIMSKENHIIPKLTDDEVMERHKLADENMR
FT                   KVWSNIISKYESIEEQGDLVDLKTGEIVEDNGHIKTLTANNSTKDKRTKYTSVLRDIID
FT                   ISDEEDGDKNDEYTLWANDSEASDSEVDADNDTEEEKDEKLIDADFKKYEAKLSKRILR
FT                   D"
FT   rep_origin      212519..212618
FT                   /note="ARS409; Autonomously Replicating Sequence"
FT   gene            213351..215642
FT                   /gene="RGT2"
FT                   /locus_tag="YDL138W"
FT   mRNA            213351..215642
FT                   /gene="RGT2"
FT                   /locus_tag="YDL138W"
FT                   /product="glucose sensor"
FT   CDS_pept        213351..215642
FT                   /codon_start=1
FT                   /gene="RGT2"
FT                   /locus_tag="YDL138W"
FT                   /product="glucose sensor"
FT                   /note="Plasma membrane high glucose sensor that regulates
FT                   glucose transport; low affinity sesnor that contains 12
FT                   predicted transmembrane segments and a long C-terminal tail
FT                   required for hexose transporter induction; phosphorylation
FT                   of the tail by Yck1p/Yck2p facilitates binding to the HXT
FT                   co-repressors, Mth1p and Std1p; RGT2 has a paralog, SNF3,
FT                   that arose from the whole genome duplication"
FT                   /db_xref="GOA:Q12300"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR037792"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12300"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005886 plasma
FT                   membrane [PMID:8901598]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0010255 glucose
FT                   mediated signaling pathway [PMID:9564039]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0051594
FT                   detection of glucose [PMID:8901598]"
FT                   /protein_id="DAA11720.1"
FT                   /translation="MNDSQNCLRQREENSHLNPGNDFGHHQGAECTINHNNMPHRNAYT
FT                   ESTNDTEAKSIVMCDDPNAYQISYTNNEPAGDGAIETTSILLSQPLPLRSNVMSVLVGI
FT                   FVAVGGFLFGYDTGLINSITDMPYVKTYIAPNHSYFTTSQIAILVSFLSLGTFFGALIA
FT                   PYISDSYGRKPTIMFSTAVIFSIGNSLQVASGGLVLLIVGRVISGIGIGIISAVVPLYQ
FT                   AEAAQKNLRGAIISSYQWAITIGLLVSSAVSQGTHSKNGPSSYRIPIGLQYVWSSILAV
FT                   GMIFLPESPRYYVLKDELNKAAKSLSFLRGLPIEDPRLLEELVEIKATYDYEASFGPST
FT                   LLDCFKTSENRPKQILRIFTGIAIQAFQQASGINFIFYYGVNFFNNTGVDNSYLVSFIS
FT                   YAVNVAFSIPGMYLVDRIGRRPVLLAGGVIMAIANLVIAIVGVSEGKTVVASKIMIAFI
FT                   CLFIAAFSATWGGVVWVVSAELYPLGVRSKCTAICAAANWLVNFTCALITPYIVDVGSH
FT                   TSSMGPKIFFIWGGLNVVAVIVVYFAVYETRGLTLEEIDELFRKAPNSVISSKWNKKIR
FT                   KRCLAFPISQQIEMKTNIKNAGKLDNNNSPIVQDDSHNIIDVDGFLENQIQSNDHMIAA
FT                   DKGSGSLVNIIDTAPLTSTEFKPVEHPPVNYVDLGNGLGLNTYNRGPPSIISDSTDEFY
FT                   EENDSSYYNNNTERNGANSVNTYMAQLINSSSTTSNDTSFSPSHNSNARTSSNWTSDLA
FT                   SKHSQYTSPQ"
FT   gene            216529..217074
FT                   /gene="ARF2"
FT                   /locus_tag="YDL137W"
FT   mRNA            216529..217074
FT                   /gene="ARF2"
FT                   /locus_tag="YDL137W"
FT                   /product="Arf family GTPase ARF2"
FT   CDS_pept        216529..217074
FT                   /codon_start=1
FT                   /gene="ARF2"
FT                   /locus_tag="YDL137W"
FT                   /product="Arf family GTPase ARF2"
FT                   /note="ADP-ribosylation factor; GTPase of the Ras
FT                   superfamily involved in regulation of coated formation
FT                   vesicles in intracellular trafficking within the Golgi;
FT                   ARF2 has a paralog, ARF1, that arose from the whole genome
FT                   duplication; arf1 arf2 double null mutation is complemented
FT                   by human ARF1, ARF4, ARF5, or ARF6"
FT                   /db_xref="GOA:P19146"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:1MR3"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19146"
FT                   /experiment="EXISTENCE:direct assay:GO:0003924 GTPase
FT                   activity [PMID:8816753]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005794 Golgi
FT                   apparatus [PMID:20841378|PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:26928762]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016236
FT                   macroautophagy [PMID:20444982]"
FT                   /protein_id="DAA11721.1"
FT                   /translation="MGLYASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITT
FT                   IPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAR
FT                   EVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQSTCATSG
FT                   EGLYEGLEWLSNNLKNQS"
FT   gene            217600..218367
FT                   /gene="RPL35B"
FT                   /gene_synonym="SOS2"
FT                   /locus_tag="YDL136W"
FT   mRNA            join(217600..217602,218008..218367)
FT                   /gene="RPL35B"
FT                   /gene_synonym="SOS2"
FT                   /locus_tag="YDL136W"
FT                   /product="ribosomal 60S subunit protein L35B"
FT   CDS_pept        join(217600..217602,218008..218367)
FT                   /codon_start=1
FT                   /gene="RPL35B"
FT                   /gene_synonym="SOS2"
FT                   /locus_tag="YDL136W"
FT                   /product="ribosomal 60S subunit protein L35B"
FT                   /note="Ribosomal 60S subunit protein L35B; homologous to
FT                   mammalian ribosomal protein L35 and bacterial L29; RPL35B
FT                   has a paralog, RPL35A, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:P0CX85"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="PDB:4V8Y"
FT                   /db_xref="PDB:4V8Z"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CX85"
FT                   /experiment="EXISTENCE:curator inference:GO:0002181
FT                   cytoplasmic translation [PMID:11983894]"
FT                   /experiment="EXISTENCE:curator inference:GO:0003735
FT                   structural constituent of ribosome [PMID:11983894]"
FT                   /experiment="EXISTENCE:direct assay:GO:0022625 cytosolic
FT                   large ribosomal subunit [PMID:11983894]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030687 preribosome,
FT                   large subunit precursor [PMID:20392820]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000463
FT                   maturation of LSU-rRNA from tricistronic rRNA transcript
FT                   (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:20392820]"
FT                   /protein_id="DAA11672.1"
FT                   /translation="MAGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIK
FT                   TVRKSIACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVTEKQ
FT                   RKKQIAFPQRKYAIKA"
FT   gene            complement(218680..219288)
FT                   /gene="RDI1"
FT                   /locus_tag="YDL135C"
FT   mRNA            complement(218680..219288)
FT                   /gene="RDI1"
FT                   /locus_tag="YDL135C"
FT                   /product="Rdi1p"
FT   CDS_pept        complement(218680..219288)
FT                   /codon_start=1
FT                   /gene="RDI1"
FT                   /locus_tag="YDL135C"
FT                   /product="Rdi1p"
FT                   /note="Rho GDP dissociation inhibitor; involved in the
FT                   localization and regulation of Cdc42p and Rho1p; protein
FT                   abundance increases in response to DNA replication stress"
FT                   /db_xref="GOA:Q12434"
FT                   /db_xref="InterPro:IPR000406"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR024792"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12434"
FT                   /experiment="EXISTENCE:direct assay:GO:0005094 Rho
FT                   GDP-dissociation inhibitor activity [PMID:10066831]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:10066831|PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:16622836]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005934 cellular bud
FT                   tip [PMID:15108020]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005935 cellular bud
FT                   neck [PMID:15108020]"
FT                   /experiment="EXISTENCE:direct assay:GO:0007015 actin
FT                   filament organization [PMID:9242378]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032889 regulation
FT                   of vacuole fusion, non-autophagic [PMID:11598008]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007015 actin
FT                   filament organization [PMID:9242378]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0007266 Rho
FT                   protein signal transduction [PMID:9242378]"
FT                   /protein_id="DAA11723.1"
FT                   /translation="MAEESTDFSQFEEERNNDQYKVSAKKTVDEYKNLDAEDESLAKWK
FT                   ESLGLSSDVLPLEFPGDKRKVVVQKIQLLVNTEPNPITFDLTNEKTIKELASKRYKIKE
FT                   NSIYKLKIVFKVQHEIITGLRYVQYIKKAGIAVDKIDDHLGSYAPNTKTKPFYEVELPE
FT                   SEAPSGFLARGNYSAVSKFIDDDKTNHLTLNWGVEIVKK"
FT   gene            complement(219662..220771)
FT                   /gene="PPH21"
FT                   /locus_tag="YDL134C"
FT   mRNA            complement(219662..220771)
FT                   /gene="PPH21"
FT                   /locus_tag="YDL134C"
FT                   /product="phosphoprotein phosphatase 2A catalytic subunit
FT                   PPH21"
FT   CDS_pept        complement(219662..220771)
FT                   /codon_start=1
FT                   /gene="PPH21"
FT                   /locus_tag="YDL134C"
FT                   /product="phosphoprotein phosphatase 2A catalytic subunit
FT                   PPH21"
FT                   /EC_number="3.1.3.16"
FT                   /note="Catalytic subunit of protein phosphatase 2A, PP2A;
FT                   functionally redundant with Pph22p; C-terminally
FT                   methylated; forms alternate complexes with several
FT                   regulatory subunits; involved in signal transduction and
FT                   regulation of mitosis; forms nuclear foci upon DNA
FT                   replication stress; PPH21 has a paralog, PPH22, that arose
FT                   from the whole genome duplication"
FT                   /db_xref="GOA:P23594"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P23594"
FT                   /experiment="EXISTENCE:direct assay:GO:0000159 protein
FT                   phosphatase type 2A complex [PMID:17550305]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0010494 cytoplasmic
FT                   stress granule [PMID:26777405]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000082 G1/S
FT                   transition of mitotic cell cycle [PMID:12518319]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0070262
FT                   peptidyl-serine dephosphorylation [PMID:27163342]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:2000786
FT                   positive regulation of autophagosome assembly
FT                   [PMID:27973551]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004722 protein
FT                   serine/threonine phosphatase activity [PMID:2176150]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0006417
FT                   regulation of translation [PMID:10329624]"
FT                   /protein_id="DAA11724.1"
FT                   /translation="MDTDLDVPMQDAVTEQLTPTVSEDMDLNNNSSDNNAEEFSVDDLK
FT                   PGSSGIADHKSSKPLELNNTNINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEEN
FT                   VKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAM
FT                   KVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNK
FT                   IFCLHGGLSPMIETIDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFG
FT                   QDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDE
FT                   NHNRQFLQYDPSVRPGEPSVSRKTPDYFL"
FT   gene            complement(221724..221801)
FT                   /gene="RPL41B"
FT                   /gene_synonym="RPL47B"
FT                   /gene_synonym="YDL134C-A"
FT                   /locus_tag="YDL133C-A"
FT   mRNA            complement(221724..221801)
FT                   /gene="RPL41B"
FT                   /gene_synonym="RPL47B"
FT                   /gene_synonym="YDL134C-A"
FT                   /locus_tag="YDL133C-A"
FT                   /product="ribosomal 60S subunit protein L41B"
FT   CDS_pept        complement(221724..221801)
FT                   /codon_start=1
FT                   /gene="RPL41B"
FT                   /gene_synonym="RPL47B"
FT                   /gene_synonym="YDL134C-A"
FT                   /locus_tag="YDL133C-A"
FT                   /product="ribosomal 60S subunit protein L41B"
FT                   /note="Ribosomal 60S subunit protein L41B; comprises only
FT                   25 amino acids; rpl41a rpl41b double null mutant is viable;
FT                   homologous to mammalian ribosomal protein L41, no bacterial
FT                   homolog; RPL41B has a paralog, RPL41A, that arose from the
FT                   whole genome duplication"
FT                   /db_xref="GOA:P0CX87"
FT                   /db_xref="InterPro:IPR007836"
FT                   /db_xref="PDB:4V8Y"
FT                   /db_xref="PDB:4V8Z"
FT                   /db_xref="PDB:5M1J"
FT                   /db_xref="PDB:5MEI"
FT                   /db_xref="PDB:5NDV"
FT                   /db_xref="PDB:5ON6"
FT                   /db_xref="PDB:6GQ1"
FT                   /db_xref="PDB:6GQB"
FT                   /db_xref="PDB:6GQV"
FT                   /db_xref="PDB:6HHQ"
FT                   /db_xref="PDB:6I7O"
FT                   /db_xref="PDB:6Q8Y"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CX87"
FT                   /experiment="EXISTENCE:direct assay:GO:0002181 cytoplasmic
FT                   translation [PMID:18782943]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003735 structural
FT                   constituent of ribosome [PMID:18782943]"
FT                   /experiment="EXISTENCE:direct assay:GO:0022625 cytosolic
FT                   large ribosomal subunit [PMID:18782943]"
FT                   /protein_id="DAA11725.1"
FT                   /translation="MRAKWRKKRTRRLKRKRRKVRARSK"
FT   gene            222427..223740
FT                   /gene="SRF1"
FT                   /locus_tag="YDL133W"
FT   mRNA            222427..223740
FT                   /gene="SRF1"
FT                   /locus_tag="YDL133W"
FT                   /product="Srf1p"
FT   CDS_pept        222427..223740
FT                   /codon_start=1
FT                   /gene="SRF1"
FT                   /locus_tag="YDL133W"
FT                   /product="Srf1p"
FT                   /note="Regulator of phospholipase D (Spo14p); interacts
FT                   with Spo14p and regulates its catalytic activity; capable
FT                   of buffering the toxicity of C16:0 platelet activating
FT                   factor, a lipid that accumulates intraneuronally in
FT                   Alzheimer's patients"
FT                   /db_xref="GOA:Q12516"
FT                   /db_xref="InterPro:IPR037737"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12516"
FT                   /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
FT                   vacuole [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043085 positive
FT                   regulation of catalytic activity [PMID:21347278]"
FT                   /protein_id="DAA11726.1"
FT                   /translation="MGDSNSSQEAYSDTTSTNASRIADQNQLNLNVDLEKNQTVRKSGS
FT                   LEALQNAKIHVPKHSDGSPLDYPKLNTYTFVPTTVPPYVLEAQFDKLRLQDKGTVDGNV
FT                   TDDKNLPKEFKWGQFASTIGCHSAYTRDQNYNPSHKSYDGYSLSSSTSSKNAALREILG
FT                   DMCSEWGGEERLEGVLHSEIGANLEFNTTEERKEWLQYIEKVKDFYYGDNKKNPESPES
FT                   VHNKVYKSDWVNELNKEREKWRRLKQRKLQQWRPPLTSLLLDNQYLILGLRIFTGILSC
FT                   ISLALAIKIFQNSRSNNTISESKIGQQPSTIMAICVNAVAIAYIIYIAHDEFAGKPVGL
FT                   RNPLSKLKLILLDLLFIIFSSANLALAFNTRFDKEWVCTSIRRSNGSTYGYPKIPRICR
FT                   KQEALSAFLFVALFMWVITFSISIVRVVEKVSSITNRN"
FT   gene            224304..226751
FT                   /gene="CDC53"
FT                   /locus_tag="YDL132W"
FT   mRNA            224304..226751
FT                   /gene="CDC53"
FT                   /locus_tag="YDL132W"
FT                   /product="cullin CDC53"
FT   CDS_pept        224304..226751
FT                   /codon_start=1
FT                   /gene="CDC53"
FT                   /locus_tag="YDL132W"
FT                   /product="cullin CDC53"
FT                   /note="Cullin; structural protein of SCF complexes (which
FT                   also contain Skp1p, Cdc34p, Hrt1p and an F-box protein)
FT                   involved in ubiquitination; SCF promotes the G1-S
FT                   transition by targeting G1 cyclins and the Cln-CDK
FT                   inhibitor Sic1p for degradation; human homolog CUL1 can
FT                   complement yeast cdc53 null mutant"
FT                   /db_xref="GOA:Q12018"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR016157"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="InterPro:IPR036317"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:3O2P"
FT                   /db_xref="PDB:3O6B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12018"
FT                   /experiment="EXISTENCE:direct assay:GO:0003688 DNA
FT                   replication origin binding [PMID:16421250]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004842
FT                   ubiquitin-protein transferase activity
FT                   [PMID:10385629|PMID:9346239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006511
FT                   ubiquitin-dependent protein catabolic process
FT                   [PMID:9346238|PMID:9346239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0019005 SCF
FT                   ubiquitin ligase complex
FT                   [PMID:19882662|PMID:9346238|PMID:9346239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031146
FT                   SCF-dependent proteasomal ubiquitin-dependent protein
FT                   catabolic process [PMID:9346238|PMID:9346239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0061630 ubiquitin
FT                   protein ligase activity [PMID:9346238]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000086 G2/M
FT                   transition of mitotic cell cycle
FT                   [PMID:7954792|PMID:9736614]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000082 G1/S
FT                   transition of mitotic cell cycle [PMID:8943317]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030674 protein
FT                   binding, bridging [PMID:9499404]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0019005 SCF
FT                   ubiquitin ligase complex [PMID:9346238|PMID:9346239]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0030674
FT                   protein binding, bridging [PMID:9499404]"
FT                   /protein_id="DAA11727.1"
FT                   /translation="MSETLPRSDDLEATWNFIEPGINQILGNEKNQASTSKRVYKILSP
FT                   TMYMEVYTAIYNYCVNKSRSSGHFSTDSRTGQSTILVGSEIYEKLKNYLKNYILNFKQS
FT                   NSETFLQFYVKRWKRFTIGAIFLNHAFDYMNRYWVQKERSDGKRHIFDVNTLCLMTWKE
FT                   VMFDPSKDVLINELLDQVTLGREGQIIQRSNISTAIKSLVALGIDPQDLKKLNLNVYIQ
FT                   VFEKPFLKKTQEYYTQYTNDYLEKHSVTEYIFEAHEIIKREEKAMTIYWDDHTKKPLSM
FT                   ALNKVLITDHIEKLENEFVVLLDARDIEKITSLYALIRRDFTLIPRMASVFENYVKKTG
FT                   ENEISSLLAMHKHNIMKNENANPKKLALMTAHSLSPKDYIKKLLEVHDIFSKIFNESFP
FT                   DDIPLAKALDNACGAFININEFALPAGSPKSATSKTSEMLAKYSDILLKKATKPEVASD
FT                   MSDEDIITIFKYLTDKDAFETHYRRLFAKRLIHGTSTSAEDEENIIQRLQAANSMEYTG
FT                   KITKMFQDIRLSKILEDDFAVALKNEPDYSKAKYPDLQPFVLAENMWPFSYQEVEFKLP
FT                   KELVPSHEKLKESYSQKHNGRILKWLWPLCRGELKADIGKPGRMPFNFTVTLFQMAILL
FT                   LYNDADVLTLENIQEGTSLTIQHIAAAMVPFIKFKLIQQVPPGLDALVKPETQFKLSRP
FT                   YKALKTNINFASGVKNDILQSLSGGGHDNHGNKLGNKRLTEDERIEKELNTERQIFLEA
FT                   CIVRIMKAKRNLPHTTLVNECIAQSHQRFNAKVSMVKRAIDSLIQKGYLQRGDDGESYA
FT                   YLA"
FT   gene            227393..228715
FT                   /gene="LYS21"
FT                   /locus_tag="YDL131W"
FT   mRNA            227393..228715
FT                   /gene="LYS21"
FT                   /locus_tag="YDL131W"
FT                   /product="homocitrate synthase LYS21"
FT   CDS_pept        227393..228715
FT                   /codon_start=1
FT                   /gene="LYS21"
FT                   /locus_tag="YDL131W"
FT                   /product="homocitrate synthase LYS21"
FT                   /EC_number="2.3.3.14"
FT                   /note="Homocitrate synthase isozyme; catalyzes the
FT                   condensation of acetyl-CoA and alpha-ketoglutarate to form
FT                   homocitrate, which is the first step in the lysine
FT                   biosynthesis pathway; LYS21 has a paralog, LYS20, that
FT                   arose from the whole genome duplication"
FT                   /db_xref="GOA:Q12122"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011872"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12122"
FT                   /experiment="EXISTENCE:direct assay:GO:0004410 homocitrate
FT                   synthase activity [PMID:10103047]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:9099739|PMID:11914276]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0019878
FT                   lysine biosynthetic process via aminoadipic acid
FT                   [PMID:18524920]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0019878 lysine
FT                   biosynthetic process via aminoadipic acid [PMID:18524920]"
FT                   /protein_id="DAA11728.1"
FT                   /translation="MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLR
FT                   EGEQFANAFFDTEKKIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILT
FT                   HIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIE
FT                   IRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKSVVSCD
FT                   IECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITPLGGLMARMIVAAPDYVR
FT                   SKYKLHKIRDIENLVADAVEVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPH
FT                   DFGMKRYIHFANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDS
FT                   IIKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK"
FT   gene            229171..229431
FT                   /gene="STF1"
FT                   /gene_synonym="AIS2"
FT                   /locus_tag="YDL130W-A"
FT   mRNA            229171..229431
FT                   /gene="STF1"
FT                   /gene_synonym="AIS2"
FT                   /locus_tag="YDL130W-A"
FT                   /product="ATPase-binding protein"
FT   CDS_pept        229171..229431
FT                   /codon_start=1
FT                   /gene="STF1"
FT                   /gene_synonym="AIS2"
FT                   /locus_tag="YDL130W-A"
FT                   /product="ATPase-binding protein"
FT                   /note="Protein involved in regulation of the mitochondrial
FT                   F1F0-ATP synthase; Stf1p and Stf2p act as stabilizing
FT                   factors that enhance inhibitory action of the Inh1p
FT                   protein; protein abundance increases in response to DNA
FT                   replication stress; STF1 has a paralog, INH1, that arose
FT                   from the whole genome duplication"
FT                   /db_xref="GOA:P01098"
FT                   /db_xref="InterPro:IPR007648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01098"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:12167646|PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032780 negative
FT                   regulation of ATPase activity [PMID:12809520]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051117 ATPase
FT                   binding [PMID:2172220]"
FT                   /protein_id="DAA11729.1"
FT                   /translation="MLNRCISRNTRLPVNLRIASRFYSDGPLGGAGPGNPQDIFIKRER
FT                   AKEDYYARQQEREQLAHVKEQLKEHKKKLENLENKINNLSK"
FT   gene            229906..230527
FT                   /gene="RPP1B"
FT                   /gene_synonym="RPL44'"
FT                   /gene_synonym="RPLA3"
FT                   /locus_tag="YDL130W"
FT   mRNA            join(229906..230019,230321..230527)
FT                   /gene="RPP1B"
FT                   /gene_synonym="RPL44'"
FT                   /gene_synonym="RPLA3"
FT                   /locus_tag="YDL130W"
FT                   /product="ribosomal protein P1B"
FT   CDS_pept        join(229906..230019,230321..230527)
FT                   /codon_start=1
FT                   /gene="RPP1B"
FT                   /gene_synonym="RPL44'"
FT                   /gene_synonym="RPLA3"
FT                   /locus_tag="YDL130W"
FT                   /product="ribosomal protein P1B"
FT                   /note="Ribosomal protein P1 beta; component of the
FT                   ribosomal stalk, which is involved in interaction of
FT                   translational elongation factors with ribosome; free
FT                   (non-ribosomal) P1 stimulates the phosphorylation of the
FT                   eIF2 alpha subunit (Sui2p) by Gcn2p; accumulation is
FT                   regulated by phosphorylation and interaction with the P2
FT                   stalk component"
FT                   /db_xref="GOA:P10622"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10622"
FT                   /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
FT                   vacuole [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003735 structural
FT                   constituent of ribosome [PMID:22096102]"
FT                   /experiment="EXISTENCE:direct assay:GO:0022625 cytosolic
FT                   large ribosomal subunit [PMID:22096102]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0002181
FT                   cytoplasmic translation [PMID:1601875]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0002181
FT                   cytoplasmic translation [PMID:1601875]"
FT                   /protein_id="DAA11730.1"
FT                   /translation="MSDSIISFAAFILADAGLEITSDNLLTITKAAGANVDNVWADVYA
FT                   KALEGKDLKEILSGFHNAGPVAGAGAASGAAAAGGDAAAEEEKEEEAAEESDDDMGFGL
FT                   FD"
FT   gene            231024..231899
FT                   /locus_tag="YDL129W"
FT   mRNA            231024..231899
FT                   /locus_tag="YDL129W"
FT                   /product="hypothetical protein"
FT   CDS_pept        231024..231899
FT                   /codon_start=1
FT                   /locus_tag="YDL129W"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; green fluorescent protein
FT                   (GFP)-fusion protein localizes to the cytoplasm and the
FT                   nucleus; YDL129W is not an essential gene; relative
FT                   distribution to the nucleus increases upon DNA replication
FT                   stress"
FT                   /db_xref="GOA:Q07555"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07555"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095|PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:11914276|PMID:14562095|PMID:22842922]"
FT                   /protein_id="DAA11731.1"
FT                   /translation="MELRSRRSAEAYLVTPEEPAKNKSERSIESNERVGTREAKSENTS
FT                   VFSPAYSDTATTDSSKKVDDNEYYNFTSHFMPSLKNTRELENTILNLIQRIKEGDDETL
FT                   VSEKDLILSVLNRSLASTSHWKLQAQLSELRATSEGRYAVETNLLKKEVEFLKNKTPKT
FT                   NESASSAELRPLLERPLKRKLSLPGLAQRPLSTGARLEGGYGGVSPNSWKTKVPKLPLP
FT                   ASRPSLNLSPQKVPTGTDKVEEDTKIDTLELVENNKPHPRMRRRSDNPATNEYVRVFHL
FT                   EKKEPKSRKK"
FT   gene            232652..233887
FT                   /gene="VCX1"
FT                   /gene_synonym="HUM1"
FT                   /gene_synonym="MNR1"
FT                   /locus_tag="YDL128W"
FT   mRNA            232652..233887
FT                   /gene="VCX1"
FT                   /gene_synonym="HUM1"
FT                   /gene_synonym="MNR1"
FT                   /locus_tag="YDL128W"
FT                   /product="Vcx1p"
FT   CDS_pept        232652..233887
FT                   /codon_start=1
FT                   /gene="VCX1"
FT                   /gene_synonym="HUM1"
FT                   /gene_synonym="MNR1"
FT                   /locus_tag="YDL128W"
FT                   /product="Vcx1p"
FT                   /note="Vacuolar membrane antiporter with Ca2+/H+ and K+/H+
FT                   exchange activity; involved in control of cytosolic Ca2+
FT                   and K+ concentrations; has similarity to sodium/calcium
FT                   exchangers, including the bovine Na+/Ca2+,K+ antiporter"
FT                   /db_xref="GOA:Q99385"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="PDB:4K1C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99385"
FT                   /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
FT                   vacuole [PMID:8628289]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000329 fungal-type
FT                   vacuole membrane [PMID:20709757|PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006816 calcium ion
FT                   transport [PMID:8628289]"
FT                   /experiment="EXISTENCE:direct assay:GO:0015369
FT                   calcium:proton antiporter activity [PMID:8628289]"
FT                   /experiment="EXISTENCE:direct assay:GO:0055085
FT                   transmembrane transport [PMID:8628289]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006816 calcium
FT                   ion transport [PMID:8628289]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006874 cellular
FT                   calcium ion homeostasis [PMID:8628289]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0015369
FT                   calcium:proton antiporter activity
FT                   [PMID:20709757|PMID:8628289]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0015386
FT                   potassium:proton antiporter activity [PMID:20709757]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0055085
FT                   transmembrane transport [PMID:8628289]"
FT                   /protein_id="DAA11732.1"
FT                   /translation="MDATTPLLTVANSHPARNPKHTAWRAAVYDLQYILKASPLNFLLV
FT                   FVPLGLIWGHFQLSHTLTFLFNFLAIIPLAAILANATEELADKAGNTIGGLLNATFGNA
FT                   VELIVSIIALKKGQVRIVQASMLGSLLSNLLLVLGLCFIFGGYNRVQQTFNQTAAQTMS
FT                   SLLAIACASLLIPAAFRATLPHGKEDHFIDGKILELSRGTSIVILIVYVLFLYFQLGSH
FT                   HALFEQQEEETDEVMSTISRNPHHSLSVKSSLVILLGTTVIISFCADFLVGTIDNVVES
FT                   TGLSKTFIGLIVIPIVGNAAEHVTSVLVAMKDKMDLALGVAIGSSLQVALFVTPFMVLV
FT                   GWMIDVPMTLNFSTFETATLFIAVFLSNYLILDGESNWLEGVMSLAMYILIAMAFFYYP
FT                   DEKTLDSIGNSL"
FT   gene            234927..235853
FT                   /gene="PCL2"
FT                   /gene_synonym="CLN4"
FT                   /locus_tag="YDL127W"
FT   mRNA            234927..235853
FT                   /gene="PCL2"
FT                   /gene_synonym="CLN4"
FT                   /locus_tag="YDL127W"
FT                   /product="cyclin PCL2"
FT   CDS_pept        234927..235853
FT                   /codon_start=1
FT                   /gene="PCL2"
FT                   /gene_synonym="CLN4"
FT                   /locus_tag="YDL127W"
FT                   /product="cyclin PCL2"
FT                   /note="Cyclin, interacts with cyclin-dependent kinase
FT                   Pho85p; member of the Pcl1,2-like subfamily, involved in
FT                   the regulation of polarized growth and morphogenesis and
FT                   progression through the cell cycle; localizes to sites of
FT                   polarized cell growth; PCL2 has a paralog, PCL9, that arose
FT                   from the whole genome duplication"
FT                   /db_xref="GOA:P25693"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25693"
FT                   /experiment="EXISTENCE:direct assay:GO:0000079 regulation
FT                   of cyclin-dependent protein serine/threonine kinase
FT                   activity [PMID:7973731]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000131 incipient
FT                   cellular bud site [PMID:14688790]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14688790]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005934 cellular bud
FT                   tip [PMID:14688790]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005935 cellular bud
FT                   neck [PMID:14688790]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016538
FT                   cyclin-dependent protein serine/threonine kinase regulator
FT                   activity [PMID:7973731]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0031106
FT                   septin ring organization [PMID:19458192]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0032878
FT                   regulation of establishment or maintenance of cell polarity
FT                   [PMID:17853895]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0000307
FT                   cyclin-dependent protein kinase holoenzyme complex
FT                   [PMID:7973731]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0032878
FT                   regulation of establishment or maintenance of cell polarity
FT                   [PMID:17853895]"
FT                   /protein_id="DAA11733.1"
FT                   /translation="MSNYEALLKFNRKAVSKEMVQYLASTTASIIKIKKTNSMIDIALP
FT                   APPLTKFINRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLILAA
FT                   KTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITCLSPFLKPI
FT                   KEEQLYKSQRDCRTLKNFSAQEKDIVNKTSISHSRSSSNMSIPSLASTSTLSTLESRRS
FT                   NLSNYSNRIRTLPELHESNNISDKFSPRTYNIDSKHDNKENRPIPTIKPFNFSKARPVI
FT                   LKTGLNKQIIKEDTKVKKSNWSNYFKS"
FT   rep_origin      235937..236185
FT                   /note="ARS409.5; Strong autonomously replicating sequence"
FT   gene            complement(236157..238664)
FT                   /gene="CDC48"
FT                   /locus_tag="YDL126C"
FT   mRNA            complement(236157..238664)
FT                   /gene="CDC48"
FT                   /locus_tag="YDL126C"
FT                   /product="AAA family ATPase CDC48"
FT   CDS_pept        complement(236157..238664)
FT                   /codon_start=1
FT                   /gene="CDC48"
FT                   /locus_tag="YDL126C"
FT                   /product="AAA family ATPase CDC48"
FT                   /EC_number="3.6.4.6"
FT                   /note="AAA ATPase; subunit of polyUb-selective segregase
FT                   complex involved in ERAD, INM-associated degradation
FT                   (INMAD), mitotic spindle disassembly, macroautophagy, PMN,
FT                   ribosome-associated degradation, ribophagy, homotypic ER
FT                   membrane fusion, SCF complex disassembly, cell wall
FT                   integrity during heat stress, and telomerase regulation;
FT                   mobilizes membrane-anchored transcription factors by
FT                   regulated Ub/proteasome-dependent processing (RUP); human
FT                   ortholog VCP complements a cdc48 mutant"
FT                   /db_xref="GOA:P25694"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="PDB:6OA9"
FT                   /db_xref="PDB:6OAA"
FT                   /db_xref="PDB:6OAB"
FT                   /db_xref="PDB:6OMB"
FT                   /db_xref="PDB:6OPC"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25694"
FT                   /experiment="EXISTENCE:direct assay:GO:0000837 Doa10p
FT                   ubiquitin ligase complex [PMID:16873066]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000839 Hrd1p
FT                   ubiquitin ligase ERAD-L complex
FT                   [PMID:16873065|PMID:16873066]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:9436996|PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:21070972|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005789 endoplasmic
FT                   reticulum membrane [PMID:15910746]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:15910746|PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006274 DNA
FT                   replication termination [PMID:31509741]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016887 ATPase
FT                   activity [PMID:7492595]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030894 replisome
FT                   [PMID:31509741]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034098
FT                   VCP-NPL4-UFD1 AAA ATPase complex
FT                   [PMID:11598205|PMID:11733065]"
FT                   /experiment="EXISTENCE:direct assay:GO:0036266
FT                   Cdc48p-Npl4p-Vms1p AAA ATPase complex [PMID:21070972]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043130 ubiquitin
FT                   binding [PMID:11733065]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043332 mating
FT                   projection tip [PMID:19053807]"
FT                   /experiment="EXISTENCE:direct assay:GO:1990112 RQC complex
FT                   [PMID:23178123]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0043328
FT                   protein transport to vacuole involved in
FT                   ubiquitin-dependent protein catabolic process via the
FT                   multivesicular body sorting pathway [PMID:29444958]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0043624
FT                   cellular protein complex disassembly [PMID:26255844]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0010636 positive
FT                   regulation of mitochondrial fusion [PMID:29309037]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016236
FT                   macroautophagy [PMID:20855502]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016320
FT                   endoplasmic reticulum membrane fusion [PMID:7553849]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0019888 protein
FT                   phosphatase regulator activity [PMID:23418575]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030433
FT                   ubiquitin-dependent ERAD pathway
FT                   [PMID:11739805|PMID:11756557]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030970
FT                   retrograde protein transport, ER to cytosol
FT                   [PMID:11740563]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031134 sister
FT                   chromatid biorientation [PMID:20483956]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034517
FT                   ribophagy [PMID:20508643]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034727
FT                   piecemeal microautophagy of the nucleus [PMID:20855502]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043161
FT                   proteasome-mediated ubiquitin-dependent protein catabolic
FT                   process [PMID:20206597|PMID:29309037]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043328 protein
FT                   transport to vacuole involved in ubiquitin-dependent
FT                   protein catabolic process via the multivesicular body
FT                   sorting pathway [PMID:29444958]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043624 cellular
FT                   protein complex disassembly [PMID:25342810|PMID:26255844]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0051228 mitotic
FT                   spindle disassembly [PMID:14636562]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0051974 negative
FT                   regulation of telomerase activity [PMID:26365526]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0070651
FT                   nonfunctional rRNA decay [PMID:22505030]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0071629
FT                   cytoplasm protein quality control by the
FT                   ubiquitin-proteasome system [PMID:18812321]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0071630 nuclear
FT                   protein quality control by the ubiquitin-proteasome system
FT                   [PMID:22718752]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0071712
FT                   ER-associated misfolded protein catabolic process
FT                   [PMID:11740563|PMID:11813000]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0072671
FT                   mitochondria-associated ubiquitin-dependent protein
FT                   catabolic process [PMID:21070972]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0120174
FT                   stress-induced homeostatically regulated protein
FT                   degradation pathway [PMID:29861160]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1900182 positive
FT                   regulation of protein localization to nucleus
FT                   [PMID:11598205|PMID:11733065]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1990116
FT                   ribosome-associated ubiquitin-dependent protein catabolic
FT                   process [PMID:23358411|PMID:23479637]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1990171 SCF
FT                   complex disassembly in response to cadmium stress
FT                   [PMID:23000173]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:2001168 positive
FT                   regulation of histone H2B ubiquitination [PMID:25183520]"
FT                   /experiment="EXISTENCE:physical interaction:GO:1990112 RQC
FT                   complex [PMID:23479637]"
FT                   /protein_id="DAA11734.1"
FT                   /translation="MGEEHKPLLDASGVDPREEDKTATAILRRKKKDNMLLVDDAINDD
FT                   NSVIAINSNTMDKLELFRGDTVLVKGKKRKDTVLIVLIDDELEDGACRINRVVRNNLRI
FT                   RLGDLVTIHPCPDIKYATRISVLPIADTIEGITGNLFDVFLKPYFVEAYRPVRKGDHFV
FT                   VRGGMRQVEFKVVDVEPEEYAVVAQDTIIHWEGEPINREDEENNMNEVGYDDIGGCRKQ
FT                   MAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVANETGAFFFLING
FT                   PEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRVVSQLLT
FT                   LMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLRIHTKNMK
FT                   LADDVDLEALAAETHGYVGADIASLCSEAAMQQIREKMDLIDLDEDEIDAEVLDSLGVT
FT                   MDNFRFALGNSNPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFG
FT                   LSPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKA
FT                   RAAAPTVVFLDELDSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNR
FT                   PDQIDPAILRPGRLDQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSG
FT                   ADLLYIVQRAAKYAIKDSIEAHRQHEAEKEVKVEGEDVEMTDEGAKAEQEPEVDPVPYI
FT                   TKEHFAEAMKTAKRSVSDAELRRYEAYSQQMKASRGQFSNFNFNDAPLGTTATDNANSN
FT                   NSAPSGAGAAFGSNAEEDDDLYS"
FT   gene            complement(239019..239606)
FT                   /gene="HNT1"
FT                   /locus_tag="YDL125C"
FT   mRNA            complement(join(239019..239398,239510..239606))
FT                   /gene="HNT1"
FT                   /locus_tag="YDL125C"
FT                   /product="adenosine 5'-monophosphoramidase"
FT   CDS_pept        complement(join(239019..239398,239510..239606))
FT                   /codon_start=1
FT                   /gene="HNT1"
FT                   /locus_tag="YDL125C"
FT                   /product="adenosine 5'-monophosphoramidase"
FT                   /note="Adenosine 5'-monophosphoramidase; interacts
FT                   physically and genetically with Kin28p, a CDK and TFIIK
FT                   subunit, and genetically with CAK1; member of histidine
FT                   triad (HIT) superfamily of nucleotide-binding proteins;
FT                   protein abundance increases in response to DNA replication
FT                   stress; human homolog HINT1 can complement yeast hnt1
FT                   mutant"
FT                   /db_xref="GOA:Q04344"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04344"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:11914276|PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0009117 nucleotide
FT                   metabolic process [PMID:11805111]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043530 adenosine
FT                   5'-monophosphoramidase activity [PMID:11805111]"
FT                   /protein_id="DAA11735.1"
FT                   /translation="MEPLISAPYLTTTKMSAPATLDAACIFCKIIKSEIPSFKLIETKY
FT                   SYAFLDIQPTAEGHALIIPKYHGAKLHDIPDEFLTDAMPIAKRLAKAMKLDTYNVLQNN
FT                   GKIAHQEVDHVHFHLIPKRDEKSGLIVGWPAQETDFDKLGKLHKELLAKLEGSD"
FT   gene            240259..241197
FT                   /locus_tag="YDL124W"
FT   mRNA            240259..241197
FT                   /locus_tag="YDL124W"
FT                   /product="aldo-keto reductase superfamily protein"
FT   CDS_pept        240259..241197
FT                   /codon_start=1
FT                   /locus_tag="YDL124W"
FT                   /product="aldo-keto reductase superfamily protein"
FT                   /note="NADPH-dependent alpha-keto amide reductase; reduces
FT                   aromatic alpha-keto amides, aliphatic alpha-keto esters,
FT                   and aromatic alpha-keto esters; member of the aldo-keto
FT                   reductase (AKR) family; protein abundance increases in
FT                   response to DNA replication stress"
FT                   /db_xref="GOA:Q07551"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07551"
FT                   /experiment="EXISTENCE:direct assay:GO:0004032
FT                   alditol:NADP+ 1-oxidoreductase activity [PMID:11306085]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004033 aldo-keto
FT                   reductase (NADP) activity [PMID:17140678]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:16622836]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006725 cellular
FT                   aromatic compound metabolic process [PMID:16268655]"
FT                   /experiment="EXISTENCE:direct assay:GO:0042180 cellular
FT                   ketone metabolic process [PMID:17140678]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043603 cellular
FT                   amide metabolic process [PMID:15564669]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051268 alpha-keto
FT                   amide reductase activity [PMID:15564669]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051269 alpha-keto
FT                   ester reductase activity [PMID:15564669]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0034599
FT                   cellular response to oxidative stress [PMID:17919749]"
FT                   /protein_id="DAA11736.1"
FT                   /translation="MSFHQQFFTLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQ
FT                   IVYALKLPGIIHIDAAEIYRTYPEVGKALSLTEKPRNAIFLTDKYSPQIKMSDSPADGL
FT                   DLALKKMGTDYVDLYLLHSPFVSKEVNGLSLEEAWKDMEQLYKSGKAKNIGVSNFAVED
FT                   LQRILKVAEVKPQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDS
FT                   QPFFEYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEV
FT                   DKITELGLEHEPLRLYWNKLYGKYNYAAQKV"
FT   gene            241418..241840
FT                   /gene="SNA4"
FT                   /locus_tag="YDL123W"
FT   mRNA            241418..241840
FT                   /gene="SNA4"
FT                   /locus_tag="YDL123W"
FT                   /product="Sna4p"
FT   CDS_pept        241418..241840
FT                   /codon_start=1
FT                   /gene="SNA4"
FT                   /locus_tag="YDL123W"
FT                   /product="Sna4p"
FT                   /note="hypothetical protein; localized to the vacuolar
FT                   outer membrane; predicted to be palmitoylated"
FT                   /db_xref="GOA:Q07549"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07549"
FT                   /experiment="EXISTENCE:direct assay:GO:0000328 fungal-type
FT                   vacuole lumen [PMID:19168755]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000329 fungal-type
FT                   vacuole membrane [PMID:11566881|PMID:26928762]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000328
FT                   fungal-type vacuole lumen [PMID:19168755]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000329
FT                   fungal-type vacuole membrane [PMID:19168755]"
FT                   /protein_id="DAA11737.1"
FT                   /translation="MCCYCVCCTVSDFILYIVAFFFPPAAVLLRSGPCSSDFLLNVLLT
FT                   LLGFLPGMLHAFYYITITSPLRNAEYVYYYQQGWVDSERNVPSNRPQNSQTPQNRPQQG
FT                   SSARNVYPSVETPLLQGAAPHDNKQSLVESPPPYVP"
FT   gene            242552..244981
FT                   /gene="UBP1"
FT                   /locus_tag="YDL122W"
FT   mRNA            242552..244981
FT                   /gene="UBP1"
FT                   /locus_tag="YDL122W"
FT                   /product="ubiquitin-specific protease UBP1"
FT   CDS_pept        242552..244981
FT                   /codon_start=1
FT                   /gene="UBP1"
FT                   /locus_tag="YDL122W"
FT                   /product="ubiquitin-specific protease UBP1"
FT                   /EC_number="3.4.19.12"
FT                   /note="Ubiquitin-specific protease; removes ubiquitin from
FT                   ubiquitinated proteins; cleaves at the C terminus of
FT                   ubiquitin fusions irrespective of their size; capable of
FT                   cleaving polyubiquitin chains"
FT                   /db_xref="GOA:P25037"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25037"
FT                   /experiment="EXISTENCE:curator inference:GO:0005737
FT                   cytoplasm [PMID:1429680]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004843
FT                   thiol-dependent ubiquitin-specific protease activity
FT                   [PMID:1429680]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:15635103]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:15635103|PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016579 protein
FT                   deubiquitination [PMID:1429680|PMID:2050695]"
FT                   /protein_id="DAA11738.1"
FT                   /translation="MDLFIESKINSLLQFLFGSRQDFLRNFKTWSNNNNNLSIYLLIFG
FT                   IVVFFYKKPDHLNYIVESVSEMTTNFRNNNSLSRWLPRSKFTHLDEEILKRGGFIAGLV
FT                   NDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYEEIEQNEHNEEGNGQESAQDEATHKK
FT                   NTRKGGKVYGKHKKKLNRKSSSKEDEEKSQEPDITFSVALRDLLSALNAKYYRDKPYFK
FT                   TNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELP
FT                   DDALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLDGITAERIGCLQC
FT                   GENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSDWSKPEIIEGVECNRCALTAAHSHL
FT                   FGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAKPVIDDEDYKKLHTANMVRKCSKS
FT                   KQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCCDINEINLDARL
FT                   PMSKKEKAAQQDSSEDENIGGEYYTKLHERFEQEFEDSEEEKEYDDAEGNYASHYNHTK
FT                   DISNYDPLNGEVDGVTSDDEDEYIEETDALGNTIKKRIIEHSDVENENVKDNEELQEID
FT                   NVSLDEPKINVEDQLETSSDEEDVIPAPPINYARSFSTVPATPLTYSLRSVIVHYGTHN
FT                   YGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTPGVFMLFYEYDFDEETGKMKDDLEAI
FT                   QSNNEEDDEKEQEQKGVQEPKESQEQGEGEEQEEGQEQMKFERTEDHRDISGKDVN"
FT   gene            complement(245133..245582)
FT                   /gene="EXP1"
FT                   /locus_tag="YDL121C"
FT   mRNA            complement(245133..245582)
FT                   /gene="EXP1"
FT                   /locus_tag="YDL121C"
FT                   /product="Exp1p"
FT   CDS_pept        complement(245133..245582)
FT                   /codon_start=1
FT                   /gene="EXP1"
FT                   /locus_tag="YDL121C"
FT                   /product="Exp1p"
FT                   /note="A cargo receptor protein for Pma1p; works with Psg1p
FT                   to promote the transport and maturation of Pma1p; localizes
FT                   to the ER and COPII vesicles; a non-essential protein"
FT                   /db_xref="GOA:Q07541"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07541"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:10684247|PMID:14562095|PMID:26928762]"
FT                   /protein_id="DAA11739.1"
FT                   /translation="MNLYGYFLLLIIVIAFIALLPLFSGIGTFKLTKPKSSATAQSATG
FT                   KLGKREYLKKKLDHTNVLKFDLKDTEESLGHDSASASSASRKFEIDSKTGLKRRVIGQY
FT                   NKDPNDFDFDIDDLINEDELDERREEEKKLKKYNGKKNEAYEGFV"
FT   gene            245923..246447
FT                   /gene="YFH1"
FT                   /locus_tag="YDL120W"
FT   mRNA            245923..246447
FT                   /gene="YFH1"
FT                   /locus_tag="YDL120W"
FT                   /product="ferroxidase"
FT   CDS_pept        245923..246447
FT                   /codon_start=1
FT                   /gene="YFH1"
FT                   /locus_tag="YDL120W"
FT                   /product="ferroxidase"
FT                   /EC_number="1.16.3.1"
FT                   /note="Mitochondrial matrix iron chaperone; oxidizes and
FT                   stores iron; interacts with Isu1p to promote Fe-S cluster
FT                   assembly; mutation results in multiple Fe/S-dependent
FT                   enzyme deficiencies; human frataxin homolog FXN is mutated
FT                   in Friedrich's ataxia; human FTL gene can complement yeast
FT                   yfh1 null mutant"
FT                   /db_xref="GOA:Q07540"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR017789"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="PDB:2FQL"
FT                   /db_xref="PDB:2GA5"
FT                   /db_xref="PDB:3OEQ"
FT                   /db_xref="PDB:3OER"
FT                   /db_xref="PDB:4EC2"
FT                   /db_xref="PDB:5T0V"
FT                   /db_xref="PDB:5TRE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07540"
FT                   /experiment="EXISTENCE:direct assay:GO:0004322 ferroxidase
FT                   activity [PMID:12149269|PMID:12732649]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion
FT                   [PMID:9180083|PMID:9241271|PMID:14576278|PMID:16823961|PMI
FT                   D:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005759
FT                   mitochondrial matrix [PMID:10428860]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006879 cellular
FT                   iron ion homeostasis [PMID:9180083]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008198 ferrous iron
FT                   binding [PMID:10930361|PMID:16784228]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016226 iron-sulfur
FT                   cluster assembly [PMID:12947415]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034986 iron
FT                   chaperone activity [PMID:12732649]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006879
FT                   cellular iron ion homeostasis [PMID:11734220|PMID:9180083]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0016226
FT                   iron-sulfur cluster assembly [PMID:14741370]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0034986 iron
FT                   chaperone activity [PMID:15247478]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006749
FT                   glutathione metabolic process [PMID:18562474]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006879 cellular
FT                   iron ion homeostasis [PMID:11734220|PMID:9180083]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016226
FT                   iron-sulfur cluster assembly
FT                   [PMID:12221295|PMID:12947415|PMID:12970193]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0016226
FT                   iron-sulfur cluster assembly [PMID:14741370]"
FT                   /protein_id="DAA11740.1"
FT                   /translation="MIKRSLASLVRVSSVMGRRYMIAAAGGERARFCPAVTNKKNHTVN
FT                   TFQKRFVESSTDGQVVPQEVLNLPLEKYHEEADDYLDHLLDSLEELSEAHPDCIPDVEL
FT                   SHGVMTLEIPAFGTYVINKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILT
FT                   EEVEKAISKSQ"
FT   gene            complement(246689..247612)
FT                   /gene="HEM25"
FT                   /locus_tag="YDL119C"
FT   mRNA            complement(246689..247612)
FT                   /gene="HEM25"
FT                   /locus_tag="YDL119C"
FT                   /product="Hem25p"
FT   CDS_pept        complement(246689..247612)
FT                   /codon_start=1
FT                   /gene="HEM25"
FT                   /locus_tag="YDL119C"
FT                   /product="Hem25p"
FT                   /note="Mitochondrial glycine transporter; required for the
FT                   transport of glycine into mitochondria for initiation of
FT                   heme biosynthesis, with YMC1 acting as a secondary
FT                   transporter; homolog of human SLC25A38, a mitochondrial
FT                   glycine transporter associated with nonsyndromic autosomal
FT                   recessive congenital sideroblastic anemia; human SLC25A38
FT                   can complement the heme deficiency associated with the null
FT                   mutant; GFP-fusion protein is induced in response to the
FT                   DNA-damaging agent MMS"
FT                   /db_xref="GOA:Q07534"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR030847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07534"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:27476175|PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0015187 glycine
FT                   transmembrane transporter activity [PMID:27476175]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006783 heme
FT                   biosynthetic process [PMID:26821380]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0015187
FT                   glycine transmembrane transporter activity [PMID:26821380]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:1904983
FT                   glycine import into mitochondrion [PMID:26821380]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006783 heme
FT                   biosynthetic process [PMID:26821380|PMID:27476175]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0015187 glycine
FT                   transmembrane transporter activity
FT                   [PMID:26821380|PMID:27476175]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1904983 glycine
FT                   import into mitochondrion [PMID:26821380|PMID:27476175]"
FT                   /protein_id="DAA11741.1"
FT                   /translation="MTEQATKPRNSSHLIGGFFGGLTSAVALQPLDLLKTRIQQDKKAT
FT                   LWKNLKEIDSPLQLWRGTLPSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNI
FT                   VYNKSSSLPRLTMYENLLTGAFARGLVGYITMPITVIKVRYESTLYNYSSLKEAITHIY
FT                   TKEGLFGFFRGFGATCLRDAPYAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGFTTYTS
FT                   TTVNTTSAVLSASLATTVTAPFDTIKTRMQLEPSKFTNSFNTFTSIVKNENVLKLFSGL
FT                   SMRLARKAFSAGIAWGIYEELVKRFM"
FT   gene            248581..251238
FT                   /gene="CYK3"
FT                   /locus_tag="YDL117W"
FT   mRNA            248581..251238
FT                   /gene="CYK3"
FT                   /locus_tag="YDL117W"
FT                   /product="Cyk3p"
FT   CDS_pept        248581..251238
FT                   /codon_start=1
FT                   /gene="CYK3"
FT                   /locus_tag="YDL117W"
FT                   /product="Cyk3p"
FT                   /note="SH3-domain protein located in the bud neck and
FT                   cytokinetic actin ring; relocalizes from bud neck to
FT                   nucleus upon DNA replication stress; activates the chitin
FT                   synthase activity of Chs2p during cytokinesis; suppressor
FT                   of growth and cytokinesis defects of chs2 phospho-mutants"
FT                   /db_xref="GOA:Q07533"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07533"
FT                   /experiment="EXISTENCE:direct assay:GO:0000142 cellular bud
FT                   neck contractile ring [PMID:21498574]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095|PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005935 cellular bud
FT                   neck [PMID:21498574|PMID:14562095|PMID:22842922]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0030234
FT                   enzyme regulator activity [PMID:22956544]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:1990344
FT                   secondary cell septum biogenesis [PMID:19528296]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0044697 HICS
FT                   complex [PMID:22623719]"
FT                   /experiment="EXISTENCE:physical interaction:GO:1990344
FT                   secondary cell septum biogenesis [PMID:19528296]"
FT                   /protein_id="DAA11743.1"
FT                   /translation="MATNLTSLKPPFKVKARYGWSGQTKGDLGFLEGDIMEVTRIAGSW
FT                   FYGKLLRNKKCSGYFPHNFVILLEERLNSSTENGRQPSKIVESFEKSNKVVIPPVPSRY
FT                   SDERPRPKKKLSSSMPNSPKKPVDSLTKARKAKSKEMVNEKNIYNTQSSRHHNNSAPNL
FT                   PLASHSKPQVRNFEESMNNPLPPLPPLPDLDNMRKTDKRAPKKSYSANDLHMARSSREY
FT                   NYYKDNQKFYDGFIPEKRYSLEEDSISSGLFSNSQYLNDSACSSENSFALMSDFSATSA
FT                   GSFARHKYAQSFSDSLQRSQNANGCSTKINDSQEFGDSNASSRNGKMGDILRKIIIPKR
FT                   NTNIYSSSVSSPKSPKAYPKLPDIQNLNLSATPDEARDWIAVKCHLNRARTLTKYDKHP
FT                   RYMRALEENRDLILHPQDSIYNGLNTNEVKGNTKPGLVDVELAELNIEYIDKMTWKRCI
FT                   RDGTMTLDSWAQTTFSARYSTVLEKLRGIYIFCTEMFALTDDNGTSDFSAEPQNLEKIL
FT                   YRKHCTPYELTWLFKKLANSLGITCEIVIGFLKTPSAINWEFKYNHCWLRILVNKEWRF
FT                   IDVILGNVTNPIHEFVNNRKIKKAENSYFLMAPLEMIYTHIPPREFEQHIVPSIDQLSA
FT                   LYLPLVFPSFFKNELKLYKFSTALSFLEDSEIYECSLEIPNDVEVFASVVIPTDNEEAS
FT                   SAYRNMELALTQIKKQKAESGRRIALIKAVLPPNVNKGSLYIHSGVRGTQTSIANIHPL
FT                   SMMVPLTHKGSNMKYEFVIKIPSESIQKIELYIVEPQSRYLFVGNEYSFEVIQSPSDGI
FT                   VYSSDEGPNQNRKQPMAIKSPSGRVHELVKSDPHFPYGTWKGSIKIKEPGVWSALVIAD
FT                   SGIGWSVFAEWLCV"
FT   gene            251566..253746
FT                   /gene="NUP84"
FT                   /locus_tag="YDL116W"
FT   mRNA            251566..253746
FT                   /gene="NUP84"
FT                   /locus_tag="YDL116W"
FT                   /product="Nup84p"
FT   CDS_pept        251566..253746
FT                   /codon_start=1
FT                   /gene="NUP84"
FT                   /locus_tag="YDL116W"
FT                   /product="Nup84p"
FT                   /note="Subunit of the Nup84p subcomplex of the nuclear pore
FT                   complex (NPC); contributes to nucleocytoplasmic transport
FT                   and NPC biogenesis; also plays roles in several processes
FT                   that may require localization of genes or chromosomes at
FT                   the nuclear periphery, including double-strand break
FT                   repair, transcription and chromatin silencing; homologous
FT                   to human NUP107"
FT                   /db_xref="GOA:P52891"
FT                   /db_xref="InterPro:IPR007252"
FT                   /db_xref="PDB:3IKO"
FT                   /db_xref="PDB:3JRO"
FT                   /db_xref="PDB:4XMM"
FT                   /db_xref="PDB:4XMN"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52891"
FT                   /experiment="EXISTENCE:direct assay:GO:0005643 nuclear pore
FT                   [PMID:10684247]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030466 chromatin
FT                   silencing at silent mating-type cassette [PMID:21818277]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031080 nuclear pore
FT                   outer ring [PMID:11823431|PMID:18046406]"
FT                   /experiment="EXISTENCE:direct assay:GO:0045893 positive
FT                   regulation of transcription, DNA-templated [PMID:15817685]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006302
FT                   double-strand break repair [PMID:15725626]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0045893
FT                   positive regulation of transcription, DNA-templated
FT                   [PMID:15817685]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000973
FT                   posttranscriptional tethering of RNA polymerase II gene DNA
FT                   at nuclear periphery [PMID:20932479]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006302
FT                   double-strand break repair [PMID:16418532|PMID:17538013]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006406 mRNA
FT                   export from nucleus [PMID:8565072]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006606 protein
FT                   import into nucleus [PMID:12730220]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006974 cellular
FT                   response to DNA damage stimulus [PMID:12482937]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0017056
FT                   structural constituent of nuclear pore [PMID:22331846]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031081 nuclear
FT                   pore distribution [PMID:8565072]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031990 mRNA
FT                   export from nucleus in response to heat stress
FT                   [PMID:18258809]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034398 telomere
FT                   tethering at nuclear periphery [PMID:16418532]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0035392
FT                   maintenance of chromatin silencing at telomere
FT                   [PMID:16418532]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045893 positive
FT                   regulation of transcription, DNA-templated [PMID:15817685]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045944 positive
FT                   regulation of transcription by RNA polymerase II
FT                   [PMID:22110603]"
FT                   /protein_id="DAA11744.1"
FT                   /translation="MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSA
FT                   AGQLALDLANSGDESNVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGL
FT                   FEKKLMQDNKQLYQIWIVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLR
FT                   ENTNVLDVKDKEEDHIFFKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPV
FT                   IDTQIANEFNTQQGIKKHSLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSD
FT                   WESDLHIHLNQILQTEIENYLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESE
FT                   HPIRVLMASVILDSLPSVIHSSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDII
FT                   NPGSVEEVDKSKLITTYISLLKLQGLYENIPIYATFLNESDCLEACSFILSSLEDPQVR
FT                   KKQIETINFLRLPASNILRRTTQRVFDETEQEYSPSNEISISFDVNNIDMHLIYGVEWL
FT                   IEGKLYVDAVHSIIALSRRFLLNGRVKALEQFMERNNIGEICKNYELEKIADNISKDEN
FT                   EDQFLEEITQYEHLIKGIREYEEWQKSVSLLSSESNIPTLIEKLQGFSKDTFELIKTFL
FT                   VDLTSSNFADSADYEILYEIRALYTPFLLMELHKKLVEAAKLLKIPKFISEALAFTSLV
FT                   ANENDKIYLLFQSSGKLKEYLDLVARTATLSN"
FT   rep_origin      253791..254039
FT                   /note="ARS410; Autonomously Replicating Sequence"
FT   gene            complement(253995..255126)
FT                   /gene="IWR1"
FT                   /locus_tag="YDL115C"
FT   mRNA            complement(join(253995..254974,255045..255126))
FT                   /gene="IWR1"
FT                   /locus_tag="YDL115C"
FT                   /product="Iwr1p"
FT   CDS_pept        complement(join(253995..254974,255045..255126))
FT                   /codon_start=1
FT                   /gene="IWR1"
FT                   /locus_tag="YDL115C"
FT                   /product="Iwr1p"
FT                   /note="RNA polymerase II transport factor, conserved from
FT                   yeast to humans; also has a role in transporting RNA
FT                   polymerase III into the nucleus; interacts with most of the
FT                   RNAP II subunits; nucleo-cytoplasmic shuttling protein;
FT                   deletion causes hypersensitivity to K1 killer toxin;
FT                   protein increases in abundance and relocalizes from nucleus
FT                   to cytoplasm upon DNA replication stress"
FT                   /db_xref="GOA:Q07532"
FT                   /db_xref="InterPro:IPR013883"
FT                   /db_xref="InterPro:IPR040150"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07532"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:19679657|PMID:21504834|PMID:14562095|PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:19679657|PMID:21504834|PMID:14562095|PMID:22842922]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006606 protein
FT                   import into nucleus [PMID:21504834|PMID:23267056]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006913
FT                   nucleocytoplasmic transport [PMID:21504834]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0005515
FT                   protein binding [PMID:21504834]"
FT                   /protein_id="DAA11745.1"
FT                   /translation="MSTISTTTAPEFIRVKRRRDEDSVQALLIDEGKRVKKQKFIFKLS
FT                   KTVSSESYQSEQESSTPLLKLAHEDHRHFVLEQRKKSRRDSDDEKSQQRLAAEGSTVDD
FT                   DGLPPEINQMVNDYLKLNKGVEKTERKKPSRKYFTGDSAKIASLPSLDYVFDIYHLEKI
FT                   HDDEVARYNNEKNIGFVKIIEHIDLALDEESDPNEARSDDEDSNDENYYQNDYPEDEDD
FT                   DRSILFGSEGEDIAALGEEIVIGVNKSRFSSWNDDKIQGSNGYHDVEEEYGDLFNRLGG
FT                   KSDVLKSINSSNFIDLDGQEGEIEISDNEDDSDEGDDIEYPRNEFFPTDVDDPLAHHRD
FT                   RIFHQLQKKINRS"
FT   gene            255604..256530
FT                   /locus_tag="YDL114W"
FT   mRNA            255604..256530
FT                   /locus_tag="YDL114W"
FT                   /product="short-chain dehydrogenase/reductase"
FT   CDS_pept        255604..256530
FT                   /codon_start=1
FT                   /locus_tag="YDL114W"
FT                   /product="short-chain dehydrogenase/reductase"
FT                   /note="Putative short-chain dehydrogenase/reductase;
FT                   YDL114W is not an essential gene"
FT                   /db_xref="GOA:Q07530"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07530"
FT                   /protein_id="DAA11746.1"
FT                   /translation="MVRKNKINRASGTTKHLKDFPSVILSLPSYNPSILSKNATALITG
FT                   GSSGLGFELAKELSRRINKVIVADIQSFPTFAQVEYNNIFYYQCDITSLDEIKNLKKAI
FT                   ERDHGNINIIINNAGVAHIKKLEHMTNKEVEQLIDINLIGAYRIISTFAEDMIDNREGF
FT                   IINIASVLGELTPARLTSYGASKGAMIGFHKCMSRHFRSLSTECNKTGIKTLLVCPGKI
FT                   KTNMFIDVPTPSKLLAPDIIPSQLALAIISAMEHNHLQTLNAPYYVNLVPFFKTLSWPY
FT                   RHLLKHFSGMDHVTSTSPRAINPKRSA"
FT   rep_origin      256530..256633
FT                   /note="ARS411; Putative replication origin; identified in
FT                   multiple array studies, not yet confirmed by plasmid-based
FT                   assay"
FT   gene            complement(256633..258555)
FT                   /gene="ATG20"
FT                   /gene_synonym="CVT20"
FT                   /gene_synonym="SNX42"
FT                   /locus_tag="YDL113C"
FT   mRNA            complement(256633..258555)
FT                   /gene="ATG20"
FT                   /gene_synonym="CVT20"
FT                   /gene_synonym="SNX42"
FT                   /locus_tag="YDL113C"
FT                   /product="Atg20p"
FT   CDS_pept        complement(256633..258555)
FT                   /codon_start=1
FT                   /gene="ATG20"
FT                   /gene_synonym="CVT20"
FT                   /gene_synonym="SNX42"
FT                   /locus_tag="YDL113C"
FT                   /product="Atg20p"
FT                   /note="Sorting nexin family member; required for the
FT                   cytoplasm-to-vacuole targeting (Cvt) pathway and for
FT                   endosomal sorting; has a Phox homology domain that binds
FT                   phosphatidylinositol-3-phosphate; interacts with Snx4p;
FT                   potential Cdc28p substrate"
FT                   /db_xref="GOA:Q07528"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07528"
FT                   /experiment="EXISTENCE:direct assay:GO:0000407 phagophore
FT                   assembly site [PMID:12048214|PMID:15659643|PMID:18497569]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005768 endosome
FT                   [PMID:12554655]"
FT                   /experiment="EXISTENCE:direct assay:GO:0019898 extrinsic
FT                   component of membrane [PMID:12048214]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032266
FT                   phosphatidylinositol-3-phosphate binding
FT                   [PMID:11557775|PMID:12048214]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0034498 early
FT                   endosome to Golgi transport [PMID:12554655]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000422
FT                   autophagy of mitochondrion [PMID:19793921]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016236
FT                   macroautophagy [PMID:12048214]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0032258 protein
FT                   localization by the Cvt pathway [PMID:12554655]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034498 early
FT                   endosome to Golgi transport [PMID:12554655]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0034498
FT                   early endosome to Golgi transport [PMID:12554655]"
FT                   /protein_id="DAA11747.1"
FT                   /translation="MSDLNDVQENAKLNSETRNTGKAEPPHGTTEYVAEAEISKNGVGS
FT                   PKKSPKKGKVGKGDNNKVETELVHTALLEKDNPFMEEGPTGFTKSALLEIPGMRSHNLK
FT                   NPNEDYEDDSEGLLPLNQESNAETCRTSLSGSINSMNGETSASEEPSVSNRKKSARIHI
FT                   LEAKRVSEGQGRAYIAYVIQFENSTVQRRYSDFESLRSILIRLFPMTLIPPIPEKQSIK
FT                   NYGKSITGSSSKYLLPSEGSGSVDLSLSVIHASVNNSDEKLIRHRIRMLTEFLNKLLTN
FT                   EEITKTSIITDFLDPNNHNWHEFVNSSSTFSSLPKSILQCNPLDPTNTTRIHAMLPIPG
FT                   SSSQLLLNKESNDKKMDKERSKSFTNIEQDYKQYENLLDNGIYKYNRRTTKTYHDLKSD
FT                   YNEIGEVFAQFAHEQAQVGELAEQLSYLSNAFSGSSISLEKLVGRLYYNINEPLNESVH
FT                   MATSARELIKYRKLKYLQNEMIKKSLNSKRAQLEKLEAQNNEYKDVDKIIDNEMSKSHT
FT                   INLERPNNNTGSGGKSYGGKLFNGFNKLASMVKDSVKYQETDPHTASINLKKEIEQLSE
FT                   SLEVTENDLEVISKVIKNDQLPKFSKEREVDLSEILKHYSRYMRNYARQNLEIWKEVKR
FT                   HQDFA"
FT   gene            258915..263225
FT                   /gene="TRM3"
FT                   /locus_tag="YDL112W"
FT   mRNA            258915..263225
FT                   /gene="TRM3"
FT                   /locus_tag="YDL112W"
FT                   /product="tRNA (guanosine(18)-2'-O)-methyltransferase"
FT   CDS_pept        258915..263225
FT                   /codon_start=1
FT                   /gene="TRM3"
FT                   /locus_tag="YDL112W"
FT                   /product="tRNA (guanosine(18)-2'-O)-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="2'-O-ribose methyltransferase; catalyzes the ribose
FT                   methylation of the guanosine nucleotide at position 18 of
FT                   tRNAs"
FT                   /db_xref="GOA:Q07527"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR025759"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07527"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016423 tRNA
FT                   (guanine) methyltransferase activity [PMID:9917067]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030488 tRNA
FT                   methylation [PMID:9917067]"
FT                   /protein_id="DAA11748.1"
FT                   /translation="MVGGALICKYLPREEQLKLISDLIQNDSLEEVLELIETSPLDITT
FT                   DSNIETPIFEKITEQVIAYASIDGEAREMFRSSRAEMNKALRTSAQLLCCLPSVWHKFQ
FT                   VWMSYRLNDIISENYKHLFNDNFGKKIVQPFFDSFAEEQNANIKHENLHLDILSLLHYL
FT                   EVVYLFDECKNGISSKCLDFIIVPLLGCNSEEIADSCSKLMRWHIKYLSKCCNTDSNFD
FT                   KLIWTFIKQLYAEGSQQAWKQKNSLSFLLRFLLAAELSPELITYIKTDAYWRHIQTELD
FT                   NDVHEHRKLALSILKLTIQKLSSHGITLQTTFYKCNDLANIEMLGSWKKFTTLYEMIAL
FT                   DTSLNQIQAAKQDIIKIFDNEHLHHSWGLILLSTGLKSSMESVRKYMMTLMFSITNMSA
FT                   FSSNLPLLTKTLLPAAMSAHYFDVKGVSCPHGEKLSLFVNNLLSQTTEGISDILFEILK
FT                   LLVEKGTSFDPSRIYLSYGILVFFQNNKQKTINSDHLSLIRKLYDFAAEEEVLETTIQT
FT                   IYLKFLLYIDPSVSASELLFTLVSHIKLKGGTYKYVEPLFEDYRDLAVSHFDDLQAKEN
FT                   LTTNIGKDTIFDLLASIIFDFKDIDITPDFLIEVAKSKQDIPVYTSKAVTFLTQLLSGE
FT                   PSNGYTYENATALLSYPNFTISTWKSINVNNLFKSVMEKFSLDKFKFFAEIYQKTYECR
FT                   FDTIELNFNDLLSLYEMVKKSANQCSRESFKVKDSAYSSYFELLNTFLKTYALNRDSSE
FT                   GNDDELHILLRLVDENINKDNGNYLGNLAVCKLLYFIIDSYIHCSTSVSDDDIFIVKFI
FT                   FEKFSFIWECINSERLVLKERDLHLMLIKGLFHPVILYFGSNQYIDTLTSKLEEHAQTI
FT                   ISLSYSRRSLLPLLGSQLRVFMKFYGKLLREDVNYWWLINIIVGVFKQPQMDVNLYKLK
FT                   PVISSLFDHKLNNYYIKGDELYEKVYGPDEILARVSIIDSILYANDQLKIRLIEKVTEK
FT                   TNALYAIKRTDGAEALQRLLQWQLLLLSLLTTNEKKLSETSMIRILKSIEDESSPLVRV
FT                   YKEWFISSKVVDYYKTGNPKFAEDYLFSLLEDHSKPVFVVSAEKICFMVLKDLRNDEKK
FT                   YGFTQLLDRFICTLVPNAASNKPLVRHFSNSLIISLWPTFKAYLSDHTLRNIIENLYSN
FT                   AKKTQIFGQYRAGDANIWDLKGDRKLTNMFGGVLKKVTDHDCPYISESVFEKYLQEKDI
FT                   VPIGTDERSLWLDKRDTNTESVNNANISCDTSPLQTKSGAWETVLDLDNKKSNDVVTRS
FT                   ELIVVSSLVDKPPNLGGICRLCDVLGVGLLTVQDIKVKNHPQFKNVAVTADRWMPMEEV
FT                   ALDEIASFMKEKKKEGYTLIGLEQTDKSVKLDNNFQFPKKSLILLGTEAFGIPGTLLSE
FT                   LDLCLEIQQFGVIRSMNIQTATAVIVHSYTVQHM"
FT   gene            complement(263313..264110)
FT                   /gene="RRP42"
FT                   /locus_tag="YDL111C"
FT   mRNA            complement(263313..264110)
FT                   /gene="RRP42"
FT                   /locus_tag="YDL111C"
FT                   /product="exosome non-catalytic core subunit RRP42"
FT   CDS_pept        complement(263313..264110)
FT                   /codon_start=1
FT                   /gene="RRP42"
FT                   /locus_tag="YDL111C"
FT                   /product="exosome non-catalytic core subunit RRP42"
FT                   /note="Exosome non-catalytic core component; involved in
FT                   3'-5' RNA processing and degradation in both the nucleus
FT                   and the cytoplasm; has similarity to E. coli RNase PH and
FT                   to human hRrp42p (EXOSC7)"
FT                   /db_xref="GOA:Q12277"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="PDB:4IFD"
FT                   /db_xref="PDB:4OO1"
FT                   /db_xref="PDB:5C0W"
FT                   /db_xref="PDB:5C0X"
FT                   /db_xref="PDB:5G06"
FT                   /db_xref="PDB:5JEA"
FT                   /db_xref="PDB:5K36"
FT                   /db_xref="PDB:5OKZ"
FT                   /db_xref="PDB:5VZJ"
FT                   /db_xref="PDB:6FSZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12277"
FT                   /experiment="EXISTENCE:curator inference:GO:0034427
FT                   nuclear-transcribed mRNA catabolic process, exonucleolytic,
FT                   3'-5' [PMID:10465791]"
FT                   /experiment="EXISTENCE:curator inference:GO:0043628 ncRNA
FT                   3'-end processing [PMID:10465791]"
FT                   /experiment="EXISTENCE:curator inference:GO:0070478
FT                   nuclear-transcribed mRNA catabolic process, 3'-5'
FT                   exonucleolytic nonsense-mediated decay [PMID:10465791]"
FT                   /experiment="EXISTENCE:curator inference:GO:0070481
FT                   nuclear-transcribed mRNA catabolic process, non-stop decay
FT                   [PMID:10465791]"
FT                   /experiment="EXISTENCE:curator inference:GO:0070651
FT                   nonfunctional rRNA decay [PMID:10465791]"
FT                   /experiment="EXISTENCE:curator inference:GO:0071042 nuclear
FT                   polyadenylation-dependent mRNA catabolic process
FT                   [PMID:10465791]"
FT                   /experiment="EXISTENCE:curator inference:GO:0071051
FT                   polyadenylation-dependent snoRNA 3'-end processing
FT                   [PMID:10465791]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000176 nuclear
FT                   exosome (RNase complex) [PMID:10465791|PMID:19046973]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000177 cytoplasmic
FT                   exosome (RNase complex) [PMID:10465791|PMID:19046973]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071038 nuclear
FT                   polyadenylation-dependent tRNA catabolic process
FT                   [PMID:15828860|PMID:17643380]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000467
FT                   exonucleolytic trimming to generate mature 3'-end of 5.8S
FT                   rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S
FT                   rRNA, LSU-rRNA) [PMID:10508172|PMID:9390555]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016075 rRNA
FT                   catabolic process [PMID:10508172]"
FT                   /protein_id="DAA11749.1"
FT                   /translation="MSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSN
FT                   GSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLK
FT                   SGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPVSLISFAIYSALNSTYLPKLISAFDD
FT                   LEVEELPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKI
FT                   TSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL"
FT   gene            complement(264512..264964)
FT                   /gene="TMA17"
FT                   /gene_synonym="ADC17"
FT                   /locus_tag="YDL110C"
FT   mRNA            complement(264512..264964)
FT                   /gene="TMA17"
FT                   /gene_synonym="ADC17"
FT                   /locus_tag="YDL110C"
FT                   /product="Tma17p"
FT   CDS_pept        complement(264512..264964)
FT                   /codon_start=1
FT                   /gene="TMA17"
FT                   /gene_synonym="ADC17"
FT                   /locus_tag="YDL110C"
FT                   /product="Tma17p"
FT                   /note="ATPase dedicated chaperone that adapts proteasome
FT                   assembly to stress; Tma17p is induced upon stress;
FT                   interacts with Rpt6p to assist its pairing to Rpt3p and
FT                   early steps in proteasome biogenesis; associates with
FT                   ribosomes; heterozygous deletion demonstrated increases in
FT                   chromosome instability in a rad9 deletion background;
FT                   protein abundance is decreased upon intracellular iron
FT                   depletion"
FT                   /db_xref="GOA:Q12513"
FT                   /db_xref="InterPro:IPR038966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12513"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030674 protein
FT                   binding, bridging [PMID:25042801]"
FT                   /experiment="EXISTENCE:direct assay:GO:0070682 proteasome
FT                   regulatory particle assembly [PMID:25042801]"
FT                   /protein_id="DAA11750.1"
FT                   /translation="MCSAGGIRRPIQIEEFKTAISGMSDMELAQIKTEIENSINHLQRS
FT                   NARLGKYIAKLEGADDRLEADDSDDLENIDSGDLALYKDSVRENEIVLNNYNERVDALE
FT                   QETVYRKTGHGKSKHEVEAKDNTNKGPDVDMDNSNVDVVTPNSIFI"
FT   gene            complement(265258..267201)
FT                   /locus_tag="YDL109C"
FT   mRNA            complement(265258..267201)
FT                   /locus_tag="YDL109C"
FT                   /product="putative lipase"
FT   CDS_pept        complement(265258..267201)
FT                   /codon_start=1
FT                   /locus_tag="YDL109C"
FT                   /product="putative lipase"
FT                   /note="Putative lipase; involved in lipid metabolism; not
FT                   an essential gene; YDL109C has a paralog, ROG1, that arose
FT                   from the whole genome duplication"
FT                   /db_xref="GOA:Q12103"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR016445"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12103"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0044255 cellular
FT                   lipid metabolic process [PMID:10341423]"
FT                   /protein_id="DAA11751.1"
FT                   /translation="MEAGRSADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLD
FT                   SLWVKIKNTTKLSYKPAYLLGPFILYCDVRAKDYESSYKIICSADKPVFQSNLQAQQKF
FT                   IAELSLHHIKPRYVWIVDIVSQILFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKAC
FT                   NILHTGLSVHRLTTADIWKVPRPIDMSQKSHLVILTHGFQSNVSADMEYLMEEIYKAQM
FT                   NNPNERLVIKGYMKNACETEKGIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQT
FT                   FAICYIKTKYPYFFKKVEPINFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLK
FT                   DGNYGDKPLLYLLSEESLISVLARFKRRTLYANAVNDGIVPLYSSSLLFLDYSQLLQKL
FT                   GGQTTAPCDPLFQPEVSPIGELPNHSDVANDDDGINASSWNTFWKSKENNCDKKSKRLM
FT                   NASVIKSMKSVLLSPCPDAKFFSDPDARVATIIHDKIYTEKNLPPPSPTLYEGTAAKEG
FT                   ETRKTRKEMEEIIARRWHKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTA
FT                   HFQRDDPIASPMQDKQFAEEDINMATGGVEPNKFYSWLTKIEDPSVYHGGIVSTASQLA
FT                   SSWISKHSSVTD"
FT   gene            267698..268699
FT                   /gene="KIN28"
FT                   /locus_tag="YDL108W"
FT   mRNA            join(267698..267725,267807..268699)
FT                   /gene="KIN28"
FT                   /locus_tag="YDL108W"
FT                   /product="TFIIH complex serine/threonine-protein kinase
FT                   subunit KIN28"
FT   CDS_pept        join(267698..267725,267807..268699)
FT                   /codon_start=1
FT                   /gene="KIN28"
FT                   /locus_tag="YDL108W"
FT                   /product="TFIIH complex serine/threonine-protein kinase
FT                   subunit KIN28"
FT                   /EC_number="2.7.11.23"
FT                   /note="Serine/threonine protein kinase, subunit of
FT                   transcription factor TFIIH; involved in transcription
FT                   initiation at RNA polymerase II promoters; phosphorylates
FT                   Ser5 residue of the PolII C-terminal domain (CTD) at gene
FT                   promoters; relocalizes to the cytosol in response to
FT                   hypoxia"
FT                   /db_xref="GOA:P06242"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR037770"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06242"
FT                   /experiment="EXISTENCE:direct assay:GO:0004672 protein
FT                   kinase activity [PMID:16319894]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:22932476]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005675
FT                   transcription factor TFIIH holo complex
FT                   [PMID:19818408|PMID:27381459]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:22932476]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006366
FT                   transcription by RNA polymerase II [PMID:19818408]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006468 protein
FT                   phosphorylation [PMID:16319894]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008353 RNA
FT                   polymerase II CTD heptapeptide repeat kinase activity
FT                   [PMID:7760796|PMID:9702190]"
FT                   /experiment="EXISTENCE:direct assay:GO:0045944 positive
FT                   regulation of transcription by RNA polymerase II
FT                   [PMID:14749387]"
FT                   /experiment="EXISTENCE:direct assay:GO:0070816
FT                   phosphorylation of RNA polymerase II C-terminal domain
FT                   [PMID:11839796|PMID:19450536|PMID:19679665|PMID:7760796|PM
FT                   ID:9702190]"
FT                   /experiment="EXISTENCE:direct assay:GO:0070985
FT                   transcription factor TFIIK complex
FT                   [PMID:11839796|PMID:19818408]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006360
FT                   transcription by RNA polymerase I [PMID:12015980]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006366
FT                   transcription by RNA polymerase II
FT                   [PMID:7760796|PMID:7783209]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006370
FT                   7-methylguanosine mRNA capping [PMID:22689984]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0008353 RNA
FT                   polymerase II CTD heptapeptide repeat kinase activity
FT                   [PMID:9702190]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0070816
FT                   phosphorylation of RNA polymerase II C-terminal domain
FT                   [PMID:9702190]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1900018
FT                   phosphorylation of RNA polymerase II C-terminal domain
FT                   serine 5 residues involved in recruitment of mRNA capping
FT                   enzyme to RNA polymerase II holoenzyme complex
FT                   [PMID:10594013|PMID:19666497]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1901921
FT                   phosphorylation of RNA polymerase II C-terminal domain
FT                   involved in recruitment of 3'-end processing factors to RNA
FT                   polymerase II holoenzyme complex [PMID:10594013]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1903654
FT                   phosphorylation of RNA polymerase II C-terminal domain
FT                   serine 5 residues involved in positive regulation of
FT                   transcription elongation from RNA polymerase II promoter
FT                   [PMID:27477907]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1905866 positive
FT                   regulation of Atg1/ULK1 kinase complex assembly
FT                   [PMID:26567215]"
FT                   /experiment="EXISTENCE:physical interaction:GO:1901921
FT                   phosphorylation of RNA polymerase II C-terminal domain
FT                   involved in recruitment of 3'-end processing factors to RNA
FT                   polymerase II holoenzyme complex [PMID:10594013]"
FT                   /protein_id="DAA11752.1"
FT                   /translation="MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKD
FT                   GLDMSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPA
FT                   DIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTS
FT                   NVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALG
FT                   TPTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTA
FT                   VQCLESDYFKELPPPSDPSSIKIRN"
FT   gene            268921..269976
FT                   /gene="MSS2"
FT                   /locus_tag="YDL107W"
FT   mRNA            268921..269976
FT                   /gene="MSS2"
FT                   /locus_tag="YDL107W"
FT                   /product="Mss2p"
FT   CDS_pept        268921..269976
FT                   /codon_start=1
FT                   /gene="MSS2"
FT                   /locus_tag="YDL107W"
FT                   /product="Mss2p"
FT                   /note="Peripherally bound inner membrane protein of the
FT                   mitochondrial matrix; involved in membrane insertion of
FT                   C-terminus of Cox2p, interacts genetically and physically
FT                   with Cox18p"
FT                   /db_xref="GOA:P40990"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40990"
FT                   /experiment="EXISTENCE:direct assay:GO:0005759
FT                   mitochondrial matrix [PMID:11604502]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031314 extrinsic
FT                   component of mitochondrial inner membrane [PMID:11604502]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0032979
FT                   protein insertion into mitochondrial inner membrane from
FT                   matrix [PMID:11950926]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0032979 protein
FT                   insertion into mitochondrial inner membrane from matrix
FT                   [PMID:11604502]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0032979
FT                   protein insertion into mitochondrial inner membrane from
FT                   matrix [PMID:11950926|PMID:17452441]"
FT                   /protein_id="DAA11753.1"
FT                   /translation="MQRFVSKFVSTPPVPKKFQEIFPKKRTVNKILFQLDTRLTYHEMY
FT                   PIFLQVSQNTNEENIPWRKKYPYIRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLN
FT                   IAAELGNNDAISILSFNVIHEYKKENVKSSYEKDIETANEFIKKLYARNHHLTVKLIGD
FT                   LFFENKTYDKAEKYYQEFLKLENSTKLAGEVHGKLGEIQIKQVNGFLKAEKSWLSCIEL
FT                   LEIERSSRWYFLLARLYMSSEPMKAKALLENCASIGFKECFKTLGFLELNYFNNYERAK
FT                   EWFKTGMEIMDLECFFGFFDCCVKEENFKGARDCLESVKKLGNDKDKKTMINVFLESRK
FT                   DSIKLLDKARL"
FT   gene            complement(270222..271901)
FT                   /gene="PHO2"
FT                   /gene_synonym="BAS2"
FT                   /gene_synonym="GRF10"
FT                   /locus_tag="YDL106C"
FT   mRNA            complement(270222..271901)
FT                   /gene="PHO2"
FT                   /gene_synonym="BAS2"
FT                   /gene_synonym="GRF10"
FT                   /locus_tag="YDL106C"
FT                   /product="Pho2p"
FT   CDS_pept        complement(270222..271901)
FT                   /codon_start=1
FT                   /gene="PHO2"
FT                   /gene_synonym="BAS2"
FT                   /gene_synonym="GRF10"
FT                   /locus_tag="YDL106C"
FT                   /product="Pho2p"
FT                   /note="Homeobox transcription factor; regulatory targets
FT                   include genes involved in phosphate metabolism; binds
FT                   cooperatively with Pho4p to the PHO5 promoter;
FT                   phosphorylation of Pho2p facilitates interaction with
FT                   Pho4p; relocalizes to the cytosol in response to hypoxia"
FT                   /db_xref="GOA:P07269"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07269"
FT                   /experiment="EXISTENCE:direct assay:GO:0000978 RNA
FT                   polymerase II proximal promoter sequence-specific DNA
FT                   binding [PMID:2664469]"
FT                   /experiment="EXISTENCE:direct assay:GO:0001228 DNA-binding
FT                   transcription activator activity, RNA polymerase
FT                   II-specific [PMID:3303332|PMID:7902583|PMID:9566882]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:1493793|PMID:22932476]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:22932476]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006141 regulation
FT                   of purine nucleobase metabolic process [PMID:1495962]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043388 positive
FT                   regulation of DNA binding [PMID:8355698]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043565
FT                   sequence-specific DNA binding [PMID:19111667]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0001228
FT                   DNA-binding transcription activator activity, RNA
FT                   polymerase II-specific [PMID:7902583|PMID:9566882]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0045937
FT                   positive regulation of phosphate metabolic process
FT                   [PMID:3915785]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0045944
FT                   positive regulation of transcription by RNA polymerase II
FT                   [PMID:3915785|PMID:7902583]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0120213
FT                   regulation of histidine biosynthetic process
FT                   [PMID:3303332]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001228
FT                   DNA-binding transcription activator activity, RNA
FT                   polymerase II-specific
FT                   [PMID:3303332|PMID:7902583|PMID:9566882]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006141
FT                   regulation of purine nucleobase metabolic process
FT                   [PMID:1495962]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006338
FT                   chromatin remodeling [PMID:2196175]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043388 positive
FT                   regulation of DNA binding [PMID:7902583]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045944 positive
FT                   regulation of transcription by RNA polymerase II
FT                   [PMID:3303332|PMID:7902583]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0120213
FT                   regulation of histidine biosynthetic process
FT                   [PMID:3303332]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:2000679 positive
FT                   regulation of transcription regulatory region DNA binding
FT                   [PMID:9354395]"
FT                   /protein_id="DAA11754.1"
FT                   /translation="MMEEFSYDHDFNTHFATDLDYLQHDQQQQQQQQHDQQHNQQQQPQ
FT                   PQPIQTQNLEHDHDQHTNDMSASSNASDSGPQRPKRTRAKGEALDVLKRKFEINPTPSL
FT                   VERKKISDLIGMPEKNVRIWFQNRRAKLRKKQHGSNKDTIPSSQSRDIANDYDRGSTDN
FT                   NLVTTTSTSSIFHDEDLTFFDRIPLNSNNNYYFFDICSITVGSWNRMKSGALQRRNFQS
FT                   IKELRNLSPIKINNIMSNATDLMVLISKKNSEINYFFSAMANNTKILFRIFFPLSSVTN
FT                   CSLTLETDDDIINSNNTSDKNNSNTNNDDDNDDNSNEDNDNSSEDKRNAKDNFGELKLT
FT                   VTRSPTFAVYFLNNAPDEDPNLNNQWSICDDFSEGRQVNDAFVGGSNIPHTLKGLQKSL
FT                   RFMNSLILDYKSSNEILPTINTAIPTAAVPQQNIAPPFLNTNSSATDSNPNTNLEDSLF
FT                   FDHDLLSSSITNTNNGQGSNNGRQASKDDTLNLLDTTVNSNNNHNANNEENHLAQEHLS
FT                   NDADIVANPNDHLLSLPTDSELPNTPDFLKNTNELTDEHRWI"
FT   gene            272389..273597
FT                   /gene="NSE4"
FT                   /gene_synonym="QRI2"
FT                   /locus_tag="YDL105W"
FT   mRNA            272389..273597
FT                   /gene="NSE4"
FT                   /gene_synonym="QRI2"
FT                   /locus_tag="YDL105W"
FT                   /product="Smc5-Smc6 complex subunit NSE4"
FT   CDS_pept        272389..273597
FT                   /codon_start=1
FT                   /gene="NSE4"
FT                   /gene_synonym="QRI2"
FT                   /locus_tag="YDL105W"
FT                   /product="Smc5-Smc6 complex subunit NSE4"
FT                   /note="Component of the SMC5-SMC6 complex; this complex
FT                   plays a key role in the removal of X-shaped DNA structures
FT                   that arise between sister chromatids during DNA replication
FT                   and repair"
FT                   /db_xref="GOA:P43124"
FT                   /db_xref="InterPro:IPR014854"
FT                   /db_xref="InterPro:IPR027786"
FT                   /db_xref="InterPro:IPR029225"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43124"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0019789 SUMO
FT                   transferase activity [PMID:15738391]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030915 Smc5-Smc6
FT                   complex [PMID:15738391]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006281 DNA
FT                   repair [PMID:15738391|PMID:15752197]"
FT                   /protein_id="DAA11755.1"
FT                   /translation="MSSTVISRKRRNSTVTEPDSSGETRKQKKSRSDEKSSSSKDGDPQ
FT                   LEFKVLQGYRDLESEMHKGRAQVTRTGDIGVAMDNLNAVDSLFNKVIGIKNNGLFAHDA
FT                   RAMVSISELAQISVRNLKFDDSRSMVNLENIVNSLKRYMLKEHFKLNNIAENRNDLTLA
FT                   ADEQSAADQQEESDGDIDRTPDDNHTDKATSSFKATSMRHSYLQQFSHYNEFSQFNWFR
FT                   IGALYNTISKNAPITDHLMGPLSIEKKPRVLTQRRRNNDQVGEKITAEKITQHSLNSTQ
FT                   QETTPEQVKKCFKKLSKKLGPEGSINLFKFIIDPNSFSRSIENLFYTSFLIKEGKLLME
FT                   HDEEGLPTIKIKQSISHTDSRSKEIERQRRRAAHQNHIIFQMDMPTWRKLIKKYNITSP
FT                   FLD"
FT   gene            complement(273653..274876)
FT                   /gene="QRI7"
FT                   /locus_tag="YDL104C"
FT   mRNA            complement(273653..274876)
FT                   /gene="QRI7"
FT                   /locus_tag="YDL104C"
FT                   /product="putative N(6)-L-threonylcarbamoyladenine
FT                   synthase"
FT   CDS_pept        complement(273653..274876)
FT                   /codon_start=1
FT                   /gene="QRI7"
FT                   /locus_tag="YDL104C"
FT                   /product="putative N(6)-L-threonylcarbamoyladenine
FT                   synthase"
FT                   /EC_number="2.3.1.234"
FT                   /note="Protein involved in threonylcarbamoyl adenosine
FT                   biosynthesis; Sua5p and Qri7p are necessary and sufficient
FT                   for RNA t6A modification in vitro; highly conserved
FT                   mitochondrial protein; essential for t6A modification of
FT                   mitochondrial tRNAs that decode ANN codons; similar to
FT                   Kae1p and E. coli YgjD, both of which are also required for
FT                   tRNA t6A modification; when directed to the cytoplasm,
FT                   complements the essential function of Kae1p in the KEOPS
FT                   complex"
FT                   /db_xref="GOA:P43122"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="PDB:3WUH"
FT                   /db_xref="PDB:4K25"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43122"
FT                   /experiment="EXISTENCE:direct assay:GO:0002949 tRNA
FT                   threonylcarbamoyladenosine modification [PMID:23620299]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14562095|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0061711
FT                   N(6)-L-threonylcarbamoyladenine synthase activity
FT                   [PMID:23620299]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0072670
FT                   mitochondrial tRNA threonylcarbamoyladenosine modification
FT                   [PMID:21183954]"
FT                   /protein_id="DAA11756.1"
FT                   /translation="MISIKGTGRFLLDNYRIWQRRAFNRPIQLRKGYKVLAIETSCDDT
FT                   CVSVLDRFSKSAAPNVLANLKDTLDSIDEGGIIPTKAHIHHQARIGPLTERALIESNAR
FT                   EGIDLICVTRGPGMPGSLSGGLDFAKGLAVAWNKPLIGVHHMLGHLLIPRMGTNGKVPQ
FT                   FPFVSLLVSGGHTTFVLSRAIDDHEILCDTIDIAVGDSLDKCGRELGFKGTMIAREMEK
FT                   FINQDINDQDFALKLEMPSPLKNSASKRNMLSFSFSAFITALRTNLTKLGKTEIQELPE
FT                   REIRSIAYQVQESVFDHIINKLKHVLKSQPEKFKNVREFVCSGGVSSNQRLRTKLETEL
FT                   GTLNSTSFFNFYYPPMDLCSDNSIMIGWAGIEIWESLRLVSDLDICPIRQWPLNDLLSV
FT                   DGWRTDQL"
FT   gene            complement(275148..276581)
FT                   /gene="QRI1"
FT                   /gene_synonym="UAP1"
FT                   /locus_tag="YDL103C"
FT   mRNA            complement(275148..276581)
FT                   /gene="QRI1"
FT                   /gene_synonym="UAP1"
FT                   /locus_tag="YDL103C"
FT                   /product="UDP-N-acetylglucosamine diphosphorylase"
FT   CDS_pept        complement(275148..276581)
FT                   /codon_start=1
FT                   /gene="QRI1"
FT                   /gene_synonym="UAP1"
FT                   /locus_tag="YDL103C"
FT                   /product="UDP-N-acetylglucosamine diphosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="UDP-N-acetylglucosamine pyrophosphorylase; catalyzes
FT                   the formation of UDP-N-acetylglucosamine (UDP-GlcNAc),
FT                   which is important in cell wall biosynthesis, protein
FT                   N-glycosylation, and GPI anchor biosynthesis; protein
FT                   abundance increases in response to DNA replication stress"
FT                   /db_xref="GOA:P43123"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039741"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43123"
FT                   /experiment="EXISTENCE:direct assay:GO:0003977
FT                   UDP-N-acetylglucosamine diphosphorylase activity
FT                   [PMID:9603950]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006048
FT                   UDP-N-acetylglucosamine biosynthetic process
FT                   [PMID:9603950]"
FT                   /protein_id="DAA11757.1"
FT                   /translation="MTDTKQLFIEAGQSQLFHNWESLSRKDQEELLSNLEQISSKRSPA
FT                   KLLEDCQNAIKFSLANSSKDTGVEISPLPPTSYESLIGNSKKENEYWRLGLEAIGKGEV
FT                   AVILMAGGQGTRLGSSQPKGCYDIGLPSKKSLFQIQAEKLIRLQDMVKDKKVEIPWYIM
FT                   TSGPTRAATEAYFQEHNYFGLNKEQITFFNQGTLPAFDLTGKHFLMKDPVNLSQSPDGN
FT                   GGLYRAIKENKLNEDFDRRGIKHVYMYCVDNVLSKIADPVFIGFAIKHGFELATKAVRK
FT                   RDAHESVGLIATKNEKPCVIEYSEISNELAEAKDKDGLLKLRAGNIVNHYYLVDLLKRD
FT                   LDQWCENMPYHIAKKKIPAYDSVTGKYTKPTEPNGIKLEQFIFDVFDTVPLNKFGCLEV
FT                   DRCKEFSPLKNGPGSKNDNPETSRLAYLKLGTSWLEDAGAIVKDGVLVEVSSKLSYAGE
FT                   NLSQFKGKVFDRSGIVLEK"
FT   gene            276872..280165
FT                   /gene="POL3"
FT                   /gene_synonym="CDC2"
FT                   /gene_synonym="HPR6"
FT                   /gene_synonym="TEX1"
FT                   /locus_tag="YDL102W"
FT   mRNA            276872..280165
FT                   /gene="POL3"
FT                   /gene_synonym="CDC2"
FT                   /gene_synonym="HPR6"
FT                   /gene_synonym="TEX1"
FT                   /locus_tag="YDL102W"
FT                   /product="DNA-directed DNA polymerase delta POL3"
FT   CDS_pept        276872..280165
FT                   /codon_start=1
FT                   /gene="POL3"
FT                   /gene_synonym="CDC2"
FT                   /gene_synonym="HPR6"
FT                   /gene_synonym="TEX1"
FT                   /locus_tag="YDL102W"
FT                   /product="DNA-directed DNA polymerase delta POL3"
FT                   /EC_number="2.7.7.7"
FT                   /note="Catalytic subunit of DNA polymerase delta; required
FT                   for chromosomal DNA replication during mitosis and meiosis,
FT                   intragenic recombination, repair of double strand DNA
FT                   breaks, and DNA replication during nucleotide excision
FT                   repair (NER)"
FT                   /db_xref="GOA:P15436"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR025687"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="PDB:3IAY"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15436"
FT                   /experiment="EXISTENCE:direct assay:GO:0003887 DNA-directed
FT                   DNA polymerase activity [PMID:1678279|PMID:18635534]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005657 replication
FT                   fork [PMID:15773893]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006278
FT                   RNA-dependent DNA biosynthetic process [PMID:17429354]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043137 DNA
FT                   replication, removal of RNA primer [PMID:16837458]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0045005
FT                   DNA-dependent DNA replication maintenance of fidelity
FT                   [PMID:15601866]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0003887
FT                   DNA-directed DNA polymerase activity [PMID:1678279]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006260 DNA
FT                   replication [PMID:1678279]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0008296
FT                   3'-5'-exodeoxyribonuclease activity [PMID:1648480]"
FT                   /protein_id="DAA11758.2"
FT                   /translation="MSEKRSLPMVDVKIDDEDTPQLEKKIKRQSIDHGVGSEPVSTIEI
FT                   IPSDSFRKYNSQGFKAKDTDLMGTQLESTFEQELSQMEHDMADQEEHDLSSFERKKLPT
FT                   DFDPSLYDISFQQIDAEQSVLNGIKDENTSTVVRFFGVTSEGHSVLCNVTGFKNYLYVP
FT                   APNSSDANDQEQINKFVHYLNETFDHAIDSIEVVSKQSIWGYSGDTKLPFWKIYVTYPH
FT                   MVNKLRTAFERGHLSFNSWFSNGTTTYDNIAYTLRLMVDCGIVGMSWITLPKGKYSMIE
FT                   PNNRVSSCQLEVSINYRNLIAHPAEGDWSHTAPLRIMSFDIECAGRIGVFPEPEYDPVI
FT                   QIANVVSIAGAKKPFIRNVFTLNTCSPITGSMIFSHATEEEMLSNWRNFIIKVDPDVII
FT                   GYNTTNFDIPYLLNRAKALKVNDFPYFGRLKTVKQEIKESVFSSKAYGTRETKNVNIDG
FT                   RLQLDLLQFIQREYKLRSYTLNAVSAHFLGEQKEDVHYSIISDLQNGDSETRRRLAVYC
FT                   LKDAYLPLRLMEKLMALVNYTEMARVTGVPFSYLLARGQQIKVVSQLFRKCLEIDTVIP
FT                   NMQSQASDDQYEGATVIEPIRGYYDVPIATLDFNSLYPSIMMAHNLCYTTLCNKATVER
FT                   LNLKIDEDYVITPNGDYFVTTKRRRGILPIILDELISARKRAKKDLRDEKDPFKRDVLN
FT                   GRQLALKISANSVYGFTGATVGKLPCLAISSSVTAYGRTMILKTKTAVQEKYCIKNGYK
FT                   HDAVVVYGDTDSVMVKFGTTDLKEAMDLGTEAAKYVSTLFKHPINLEFEKAYFPYLLIN
FT                   KKRYAGLFWTNPDKFDKLDQKGLASVRRDSCSLVSIVMNKVLKKILIERNVDGALAFVR
FT                   ETINDILHNRVDISKLIISKTLAPNYTNPQPHAVLAERMKRREGVGPNVGDRVDYVIIG
FT                   GNDKLYNRAEDPLFVLENNIQVDSRYYLTNQLQNPIISIVAPIIGDKQANGMFVVKSIK
FT                   INTGSQKGGLMSFIKKVEACKSCKGPLRKGEGPLCSNCLARSGELYIKALYDVRDLEEK
FT                   YSRLWTQCQRCAGNLHSEVLCSNKNCDIFYMRVKVKKELQEKVEQLSKW"
FT   gene            complement(280307..281848)
FT                   /gene="DUN1"
FT                   /locus_tag="YDL101C"
FT   mRNA            complement(280307..281848)
FT                   /gene="DUN1"
FT                   /locus_tag="YDL101C"
FT                   /product="serine/threonine protein kinase DUN1"
FT   CDS_pept        complement(280307..281848)
FT                   /codon_start=1
FT                   /gene="DUN1"
FT                   /locus_tag="YDL101C"
FT                   /product="serine/threonine protein kinase DUN1"
FT                   /EC_number="2.7.11.1"
FT                   /note="Cell-cycle checkpoint S/T protein kinase; required
FT                   for transient G2/M arrest after DNA damage, damage-induced
FT                   transcription, and nuclear-to-cytoplasmic redistribution of
FT                   Rnr2p-Rnr4p after genotoxic stress and iron deprivation;
FT                   phosphorylates repair protein Rad55p, transcriptional
FT                   repressor Sml1p, superoxide dismutase, and ribonucleotide
FT                   reductase inhibitors Crt1p and Dif1p; functions in the
FT                   Mec1p pathway to regulate dNTP pools and telomere length;
FT                   postreplicative repair role"
FT                   /db_xref="GOA:P39009"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:2JQJ"
FT                   /db_xref="PDB:2JQL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39009"
FT                   /experiment="EXISTENCE:direct assay:GO:0004672 protein
FT                   kinase activity [PMID:11904430|PMID:16319894]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004674 protein
FT                   serine/threonine kinase activity [PMID:24647101]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006468 protein
FT                   phosphorylation [PMID:11904430|PMID:16319894]"
FT                   /experiment="EXISTENCE:direct assay:GO:0018105
FT                   peptidyl-serine phosphorylation [PMID:24647101]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0048478
FT                   replication fork protection [PMID:17158920]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000077 DNA
FT                   damage checkpoint [PMID:11904430]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004674 protein
FT                   serine/threonine kinase activity [PMID:24647101]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006468 protein
FT                   phosphorylation [PMID:9741624]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0018105
FT                   peptidyl-serine phosphorylation
FT                   [PMID:24647101|PMID:26970775]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0018107
FT                   peptidyl-threonine phosphorylation [PMID:26970775]"
FT                   /protein_id="DAA11759.1"
FT                   /translation="MSLSTKREHSGDVTDSSFKRQQRSNKPSSEYTCLGHLVNLIPGKE
FT                   QKVEITNRNVTTIGRSRSCDVILSEPDISTFHAEFHLLQMDVDNFQRNLINVIDKSRNG
FT                   TFINGNRLVKKDYILKNGDRIVFGKSCSFLFKYASSSSTDIENDDEKVSSESRSYKNDD
FT                   EVFKKPQISATSSQNATTSAAIRKLNKTRPVSFFDKYLLGKELGAGHYALVKEAKNKKT
FT                   GQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLV
FT                   LEKIDDGELFERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITR
FT                   RENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYT
FT                   SKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLIS
FT                   NLLVLNPDERYNIDEALNHPWFNDIQQQSSVSLELQRLQITDNKIPKTYSELSCL"
FT   gene            complement(282112..283176)
FT                   /gene="GET3"
FT                   /gene_synonym="ARR4"
FT                   /locus_tag="YDL100C"
FT   mRNA            complement(282112..283176)
FT                   /gene="GET3"
FT                   /gene_synonym="ARR4"
FT                   /locus_tag="YDL100C"
FT                   /product="guanine nucleotide exchange factor GET3"
FT   CDS_pept        complement(282112..283176)
FT                   /codon_start=1
FT                   /gene="GET3"
FT                   /gene_synonym="ARR4"
FT                   /locus_tag="YDL100C"
FT                   /product="guanine nucleotide exchange factor GET3"
FT                   /note="Guanine nucleotide exchange factor for Gpa1p;
FT                   amplifies G protein signaling; functions as a chaperone
FT                   under ATP-depleted oxidative stress conditions; subunit of
FT                   GET complex, involved in ATP dependent Golgi to ER
FT                   trafficking and insertion of tail-anchored (TA) proteins
FT                   into ER membrane under non-stress conditions; binds as
FT                   dimer to transmembrane domain (TMD) cargo, shielding TMDs
FT                   from aqueous solvent; protein abundance increases under DNA
FT                   replication stress"
FT                   /db_xref="GOA:Q12154"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027542"
FT                   /db_xref="PDB:2WOJ"
FT                   /db_xref="PDB:3A36"
FT                   /db_xref="PDB:3A37"
FT                   /db_xref="PDB:3B2E"
FT                   /db_xref="PDB:3H84"
FT                   /db_xref="PDB:3IDQ"
FT                   /db_xref="PDB:3SJA"
FT                   /db_xref="PDB:3SJB"
FT                   /db_xref="PDB:3SJC"
FT                   /db_xref="PDB:3SJD"
FT                   /db_xref="PDB:3VLC"
FT                   /db_xref="PDB:3ZS8"
FT                   /db_xref="PDB:3ZS9"
FT                   /db_xref="PDB:4PWX"
FT                   /db_xref="PDB:4XTR"
FT                   /db_xref="PDB:4XVU"
FT                   /db_xref="PDB:4XWO"
FT                   /db_xref="PDB:5BW8"
FT                   /db_xref="PDB:5BWK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12154"
FT                   /experiment="EXISTENCE:direct assay:GO:0005085
FT                   guanyl-nucleotide exchange factor activity [PMID:18261907]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006620
FT                   posttranslational protein targeting to endoplasmic
FT                   reticulum membrane [PMID:20850366]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006890 retrograde
FT                   vesicle-mediated transport, Golgi to endoplasmic reticulum
FT                   [PMID:16269340]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016887 ATPase
FT                   activity [PMID:12680698]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051082 unfolded
FT                   protein binding [PMID:25242142]"
FT                   /experiment="EXISTENCE:direct assay:GO:1990507
FT                   ATP-independent chaperone mediated protein folding
FT                   [PMID:25242142]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006890
FT                   retrograde vesicle-mediated transport, Golgi to endoplasmic
FT                   reticulum [PMID:16269340]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000750
FT                   pheromone-dependent signal transduction involved in
FT                   conjugation with cellular fusion [PMID:18261907]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006890
FT                   retrograde vesicle-mediated transport, Golgi to endoplasmic
FT                   reticulum [PMID:16269340]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0009408 response
FT                   to heat [PMID:12680698]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0010038 response
FT                   to metal ion [PMID:12680698]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045048 protein
FT                   insertion into ER membrane [PMID:18724936]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0043529 GET
FT                   complex [PMID:16269340]"
FT                   /protein_id="DAA11760.1"
FT                   /translation="MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALS
FT                   QPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSR
FT                   ANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTV
FT                   IFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKAN
FT                   VETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQ
FT                   EHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNP
FT                   ITDGKVIYELEDKE"
FT   gene            283419..284444
FT                   /gene="BUG1"
FT                   /locus_tag="YDL099W"
FT   mRNA            283419..284444
FT                   /gene="BUG1"
FT                   /locus_tag="YDL099W"
FT                   /product="Bug1p"
FT   CDS_pept        283419..284444
FT                   /codon_start=1
FT                   /gene="BUG1"
FT                   /locus_tag="YDL099W"
FT                   /product="Bug1p"
FT                   /note="Cis-golgi localized protein involved in ER to Golgi
FT                   transport; forms a complex with the mammalian GRASP65
FT                   homolog, Grh1p; mutants are compromised for the fusion of
FT                   ER-derived vesicles with Golgi membranes"
FT                   /db_xref="GOA:Q12191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12191"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005801 cis-Golgi
FT                   network [PMID:17261844]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006888
FT                   endoplasmic reticulum to Golgi vesicle-mediated transport
FT                   [PMID:17261844]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006888
FT                   endoplasmic reticulum to Golgi vesicle-mediated transport
FT                   [PMID:17261844]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0009306 protein
FT                   secretion [PMID:20156967]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0005801
FT                   cis-Golgi network [PMID:17261844]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0006888
FT                   endoplasmic reticulum to Golgi vesicle-mediated transport
FT                   [PMID:16269340]"
FT                   /protein_id="DAA11761.1"
FT                   /translation="MSEQESDEVKRMKQLEEARKRVEELKKKKNKKNKGKKNKNSSATG
FT                   SIGSETPDLEGTPGEESTQEETVKANSTKSENNDQNDVDEESEEKEIEQVKSDPSGTTE
FT                   KDIEEINSTSSNVGKDDAENTKKEEVQEVIKNNNDEQTADAGKTIEPQEEKKIVQTQEG
FT                   NEPSNTSEAADDLFANDGNEESDFLTTIKKQKEEDELTKLRAENEKLTQENKQLKFLNM
FT                   ENETTVDDLQDQLQEKEDIINGLQNDLQTARDELIAAVEKLKLAEAKAARNTTATPIQF
FT                   ADFNTSSNNLTPSQSVTNSGTQVAHGNNMEVDRVMLNKWRQWNVDMTTWRSIGSGPIME
FT                   F"
FT   gene            complement(284581..285165)
FT                   /gene="SNU23"
FT                   /locus_tag="YDL098C"
FT   mRNA            complement(284581..285165)
FT                   /gene="SNU23"
FT                   /locus_tag="YDL098C"
FT                   /product="U4/U6-U5 snRNP complex subunit SNU23"
FT   CDS_pept        complement(284581..285165)
FT                   /codon_start=1
FT                   /gene="SNU23"
FT                   /locus_tag="YDL098C"
FT                   /product="U4/U6-U5 snRNP complex subunit SNU23"
FT                   /note="Component of the U4/U6.U5 snRNP complex; involved in
FT                   mRNA splicing via spliceosome"
FT                   /db_xref="GOA:Q12368"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR040107"
FT                   /db_xref="PDB:5NRL"
FT                   /db_xref="PDB:5ZWO"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12368"
FT                   /experiment="EXISTENCE:direct assay:GO:0046540 U4/U6 x U5
FT                   tri-snRNP complex [PMID:10377396|PMID:10449419]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000398 mRNA
FT                   splicing, via spliceosome [PMID:10449419|PMID:11720284]"
FT                   /protein_id="DAA11762.1"
FT                   /translation="MSNFGRRTWDREEYAEQARSGYDDRSLKATLTPIELQALKSKYTN
FT                   YDHLIKGSLKDLNKRKLTANTESLSSFKRGKKFGFYCDICNLTFKDTLQYIDHLNHKVH
FT                   AIKFENLFDEPLIIDIRDNDDVPQEEFELCYHNLIKDFVEVRSMETQSKRKRLLDTDVE
FT                   KAKKVATKPSIESESKVSQMMGFSNFATSKK"
FT   gene            complement(285391..286695)
FT                   /gene="RPN6"
FT                   /gene_synonym="NAS4"
FT                   /locus_tag="YDL097C"
FT   mRNA            complement(285391..286695)
FT                   /gene="RPN6"
FT                   /gene_synonym="NAS4"
FT                   /locus_tag="YDL097C"
FT                   /product="proteasome regulatory particle lid subunit RPN6"
FT   CDS_pept        complement(285391..286695)
FT                   /codon_start=1
FT                   /gene="RPN6"
FT                   /gene_synonym="NAS4"
FT                   /locus_tag="YDL097C"
FT                   /product="proteasome regulatory particle lid subunit RPN6"
FT                   /note="Essential, non-ATPase regulatory subunit of the 26S
FT                   proteasome lid; required for the assembly and activity of
FT                   the 26S proteasome; the human homolog (S9 protein)
FT                   partially rescues Rpn6p depletion; protein abundance
FT                   increases in response to DNA replication stress"
FT                   /db_xref="GOA:Q12377"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040773"
FT                   /db_xref="InterPro:IPR040780"
FT                   /db_xref="PDB:3J47"
FT                   /db_xref="PDB:3JCK"
FT                   /db_xref="PDB:3JCO"
FT                   /db_xref="PDB:3JCP"
FT                   /db_xref="PDB:4CR2"
FT                   /db_xref="PDB:4CR3"
FT                   /db_xref="PDB:4CR4"
FT                   /db_xref="PDB:5A5B"
FT                   /db_xref="PDB:5MPB"
FT                   /db_xref="PDB:5MPC"
FT                   /db_xref="PDB:5MPD"
FT                   /db_xref="PDB:5MPE"
FT                   /db_xref="PDB:5WVI"
FT                   /db_xref="PDB:5WVK"
FT                   /db_xref="PDB:6FVT"
FT                   /db_xref="PDB:6FVU"
FT                   /db_xref="PDB:6FVV"
FT                   /db_xref="PDB:6FVW"
FT                   /db_xref="PDB:6FVX"
FT                   /db_xref="PDB:6FVY"
FT                   /db_xref="PDB:6J2C"
FT                   /db_xref="PDB:6J2N"
FT                   /db_xref="PDB:6J2Q"
FT                   /db_xref="PDB:6J2X"
FT                   /db_xref="PDB:6J30"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12377"
FT                   /experiment="EXISTENCE:direct assay:GO:0008541 proteasome
FT                   regulatory particle, lid subcomplex [PMID:9741626]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034515 proteasome
FT                   storage granule [PMID:18504300]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005198
FT                   structural molecule activity [PMID:12486135]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006511
FT                   ubiquitin-dependent protein catabolic process
FT                   [PMID:12486135]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043248
FT                   proteasome assembly [PMID:12486135]"
FT                   /protein_id="DAA11763.1"
FT                   /translation="MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGAS
FT                   VDDKRRNEQETSILELGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKF
FT                   EQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLR
FT                   EFKKLDDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYCPTQTVAELDLMS
FT                   GILHCEDKDYKTAFSYFFESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKNI
FT                   LNAKYTKETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYD
FT                   TLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYV
FT                   YETPNQDATYDSALELVGQLNKVVDQLFEKASVLY"
FT   gene            287059..289512
FT                   /gene="PMT1"
FT                   /locus_tag="YDL095W"
FT   mRNA            287059..289512
FT                   /gene="PMT1"
FT                   /locus_tag="YDL095W"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase PMT1"
FT   CDS_pept        287059..289512
FT                   /codon_start=1
FT                   /gene="PMT1"
FT                   /locus_tag="YDL095W"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase PMT1"
FT                   /EC_number="2.4.1.109"
FT                   /note="Protein O-mannosyltransferase of the ER membrane;
FT                   transfers mannose from dolichyl phosphate-D-mannose to
FT                   protein serine and threonine residues; 1 of 7 related
FT                   proteins involved in O-glycosylation which is essential for
FT                   cell wall rigidity; involved in ER quality control; amino
FT                   terminus faces cytoplasm, carboxyl terminus faces ER lumen"
FT                   /db_xref="GOA:P33775"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="PDB:6P25"
FT                   /db_xref="PDB:6P2R"
FT                   /db_xref="UniProtKB/Swiss-Prot:P33775"
FT                   /experiment="EXISTENCE:direct assay:GO:0004169
FT                   dolichyl-phosphate-mannose-protein mannosyltransferase
FT                   activity [PMID:21956107|PMID:8367478|PMID:8543034]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0035269 protein
FT                   O-linked mannosylation [PMID:8367478|PMID:8543034]"
FT                   /experiment="EXISTENCE:direct assay:GO:0097582
FT                   dolichyl-phosphate-mannose-protein mannosyltransferase
FT                   Pmt1p-Pmt2p dimer complex [PMID:12551906]"
FT                   /experiment="EXISTENCE:direct assay:GO:0097583
FT                   dolichyl-phosphate-mannose-protein mannosyltransferase
FT                   Pmt1p-Pmt3p dimer complex [PMID:12551906]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0004169
FT                   dolichyl-phosphate-mannose-protein mannosyltransferase
FT                   activity [PMID:8543034]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0032527
FT                   protein exit from endoplasmic reticulum [PMID:21147851]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0035269
FT                   protein O-linked mannosylation
FT                   [PMID:21231968|PMID:8543034]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0071712
FT                   ER-associated misfolded protein catabolic process
FT                   [PMID:18182384|PMID:21147851]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:1900101
FT                   regulation of endoplasmic reticulum unfolded protein
FT                   response [PMID:21231968|PMID:23704572]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004169
FT                   dolichyl-phosphate-mannose-protein mannosyltransferase
FT                   activity [PMID:8367478|PMID:8543034]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0035269 protein
FT                   O-linked mannosylation
FT                   [PMID:18182384|PMID:8367478|PMID:8543034]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0071712
FT                   ER-associated misfolded protein catabolic process
FT                   [PMID:18182384]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1900101
FT                   regulation of endoplasmic reticulum unfolded protein
FT                   response [PMID:23704572]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0097582
FT                   dolichyl-phosphate-mannose-protein mannosyltransferase
FT                   Pmt1p-Pmt2p dimer complex [PMID:21956107|PMID:8543034]"
FT                   /protein_id="DAA11764.1"
FT                   /translation="MSEEKTYKRVEQDDPVPELDIKQGPVRPFIVTDPSAELASLRTMV
FT                   TLKEKLLVACLAVFTAVIRLHGLAWPDSVVFDEVHFGGFASQYIRGTYFMDVHPPLAKM
FT                   LYAGVASLGGFQGDFDFENIGDSFPSTTPYVLMRFFSASLGALTVILMYMTLRYSGVRM
FT                   WVALMSAICFAVENSYVTISRYILLDAPLMFFIAAAVYSFKKYEMYPANSLNAYKSLLA
FT                   TGIALGMASSSKWVGLFTVTWVGLLCIWRLWFMIGDLTKSSKSIFKVAFAKLAFLLGVP
FT                   FALYLVFFYIHFQSLTLDGDGASFFSPEFRSTLKNNKIPQNVVADVGIGSIISLRHLST
FT                   MGGYLHSHSHNYPAGSEQQQSTLYPHMDANNDWLLELYNAPGESLTTFQNLTDGTKVRL
FT                   FHTVTRCRLHSHDHKPPVSESSDWQKEVSCYGYSGFDGDANDDWVVEIDKKNSAPGVAQ
FT                   ERVIALDTKFRLRHAMTGCYLFSHEVKLPAWGFEQQEVTCASSGRHDLTLWYVENNSNP
FT                   LLPEDTKRISYKPASFISKFIESHKKMWHINKNLVEPHVYESQPTSWPFLLRGISYWGE
FT                   NNRNVYLLGNAIVWWAVTAFIGIFGLIVITELFSWQLGKPILKDSKVVNFHVQVIHYLL
FT                   GFAVHYAPSFLMQRQMFLHHYLPAYYFGILALGHALDIIVSYVFRSKRQMGYAVVITFL
FT                   AASVYFFKSFSPIIYGTPWTQELCQKSQWLSGWDYNCNTYFSSLEEYKNQTLTKRESQP
FT                   AATSTVEEITIEGDGPSYEDLMNEDGKKIFKDTEGNELDPEVVKKMLEEEGANILKVEK
FT                   RAVLE"
FT   gene            289909..292140
FT                   /gene="PMT5"
FT                   /locus_tag="YDL093W"
FT   mRNA            289909..292140
FT                   /gene="PMT5"
FT                   /locus_tag="YDL093W"
FT                   /product="putative dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase PMT5"
FT   CDS_pept        289909..292140
FT                   /codon_start=1
FT                   /gene="PMT5"
FT                   /locus_tag="YDL093W"
FT                   /product="putative dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase PMT5"
FT                   /EC_number="2.4.1.109"
FT                   /note="Protein O-mannosyltransferase; transfers mannose
FT                   residues from dolichyl phosphate-D-mannose to protein
FT                   serine/threonine residues; acts in a complex with Pmt3p,
FT                   can instead interact with Pmt2p in some conditions; target
FT                   for new antifungals"
FT                   /db_xref="GOA:P52867"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52867"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0097584
FT                   dolichyl-phosphate-mannose-protein mannosyltransferase
FT                   Pmt5p-Pmt2p dimer complex [PMID:12551906]"
FT                   /experiment="EXISTENCE:direct assay:GO:0097585
FT                   dolichyl-phosphate-mannose-protein mannosyltransferase
FT                   Pmt5p-Pmt3p dimer complex [PMID:12551906]"
FT                   /protein_id="DAA11765.1"
FT                   /translation="MNKEHLLKVDPIPDVTIKRGPLRSFLITKPCDNLSSLRTVTSSKE
FT                   KLLVGCLLIFTAIVRLHNISLPNSVVFGENEVGTFVSQYVNNIFFTDVHPPLVAMLYAT
FT                   VSSVFGYKGLFNYGNIGTEYTANVPYVAMRFFSATLGIVSVLVLYLTLRVSGVKIAVAA
FT                   ICAVCFAIENSFVTLSRFTLIEGPFVFFMACAVYFFRRSELYLPNSCKANKSLLAASIA
FT                   LGFAVSSKWAGLFTIAWAGIIVLWRVWFMIGDLSRPIGSSIKYMAFQFTCLLAIPAFIY
FT                   FLIFSVHIKTLNVNGISSSFFPAEFRKTLKYNNVIKETVAEVAVGSAVSLNHVGTAGGY
FT                   LHSHLHNYPAGSMQQQVTLYPHIDQNNKWIIELAEHPNENVTSFQNLTDGTIIKLRQLK
FT                   NGCRLHSHDHKPPVSQNADWQKEVSCYGYEGFEGDINDDWIIEIDKKRSEPGPAQEHIR
FT                   AIETKFRLKHYLTGCYLFSHPEKLPEWGFGQQEVTCAYFAREDLTSWYIEENENEISLP
FT                   NPEKVSYKKMSFWQKFVAIHKFMFYLNNYMDTSHAYSSEPKTWPLMLRGIDFWNENGRE
FT                   VYFLGNAVLWWSVTAFICTFIIGVAVELLAWKLGVNILRDKHIINFHYQVFQYLLGFAA
FT                   HYFPYFFVGQKLFLYDYLPAYYFGILAFGHALDLISTYISNKRNNTGYIVVAIFMVVCF
FT                   YFFSEHSPLIYATGWSSNLCKRSKWLGSWDFYCNSLLLSDSHYELNAES"
FT   gene            292781..293221
FT                   /gene="SRP14"
FT                   /locus_tag="YDL092W"
FT   mRNA            292781..293221
FT                   /gene="SRP14"
FT                   /locus_tag="YDL092W"
FT                   /product="RNA-binding signal recognition particle subunit
FT                   SRP14"
FT   CDS_pept        292781..293221
FT                   /codon_start=1
FT                   /gene="SRP14"
FT                   /locus_tag="YDL092W"
FT                   /product="RNA-binding signal recognition particle subunit
FT                   SRP14"
FT                   /note="Signal recognition particle (SRP) subunit; interacts
FT                   with the RNA component of SRP to form the Alu domain, which
FT                   is the region of SRP responsible for arrest of nascent
FT                   chain elongation during membrane targeting; homolog of
FT                   mammalian SRP14"
FT                   /db_xref="GOA:P38985"
FT                   /db_xref="InterPro:IPR003210"
FT                   /db_xref="InterPro:IPR009018"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38985"
FT                   /experiment="EXISTENCE:direct assay:GO:0005786 signal
FT                   recognition particle, endoplasmic reticulum targeting
FT                   [PMID:7925282]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006616
FT                   SRP-dependent cotranslational protein targeting to
FT                   membrane, translocation [PMID:10921896]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008312 7S RNA
FT                   binding [PMID:10573124]"
FT                   /protein_id="DAA11766.1"
FT                   /translation="MANTGCLSPGAFLSKVPEFFQTANEKHITVRLTAKRLIEHDPVEG
FT                   NLEFDSTNHPDYDVSKKASEISVSSRSDREYPLLIRMSYGSHDKKTKCSTVVKASELDQ
FT                   FWQEYSSVFKGGMQNLIKKKKKKSKNGTISKTGKKNKVAKKN"
FT   gene            complement(293392..294759)
FT                   /gene="UBX3"
FT                   /locus_tag="YDL091C"
FT   mRNA            complement(293392..294759)
FT                   /gene="UBX3"
FT                   /locus_tag="YDL091C"
FT                   /product="Ubx3p"
FT   CDS_pept        complement(293392..294759)
FT                   /codon_start=1
FT                   /gene="UBX3"
FT                   /locus_tag="YDL091C"
FT                   /product="Ubx3p"
FT                   /note="Clathrin-coated vesicle component, regulator of
FT                   endocytosis; copurifies with the DSC ubiquitin ligase
FT                   complex; UBX (ubiquitin regulatory X) domain-containing
FT                   protein that interacts with Cdc48p; required for efficient
FT                   clathrin-mediated endocytosis; ortholog of fission yeast
FT                   Ucp10"
FT                   /db_xref="GOA:Q12229"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR006577"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12229"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030136
FT                   clathrin-coated vesicle [PMID:26362318]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030276 clathrin
FT                   binding [PMID:26362318]"
FT                   /experiment="EXISTENCE:direct assay:GO:0044695 Dsc E3
FT                   ubiquitin ligase complex [PMID:22681890]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0033523 histone
FT                   H2B ubiquitination [PMID:25183520]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0072583
FT                   clathrin-dependent endocytosis [PMID:26362318]"
FT                   /protein_id="DAA11767.1"
FT                   /translation="MDIFRHTFGNNDDSFIRIPGAFREEPPADLNGRTEDQNSNTNEPT
FT                   QSRDGRLKSILHFLFQAPLIVLYYLLNFIVRSSRLLKPLLRLHGFYQRKHNRLLDHSSQ
FT                   LHRLLENLENEAQAVTCSEGNGNNDDGSNTDSTSNNESSGVQFSFGSLYNPENGTFSKS
FT                   IMQNSYTELLDACSEQVKFGVIYLHDPLLDNHMDYVNKILCSEAFVNMIRKYQVLLWYG
FT                   DVTTSEGLQVSNALKIRQYPLLGIISLKAEKKIELIARVEGSISNYKAQDLEAIFSKNY
FT                   SRLIQLRQQRQNIEMQRLIRQQQDSRYQDSLRRDQQRESERLEQTQREQMEREHQRIEN
FT                   QWLLWRKSQLKPEPSSDKDASKVAIRLENGQRLVRKFDASLPTEEIYAFVELQLHDMLN
FT                   SENDTLPVYQPANYQHQYSFKLITPVPRRELDLSTKISDVSGIYPSGNIVMERLDE"
FT   gene            complement(295034..296329)
FT                   /gene="RAM1"
FT                   /gene_synonym="DPR1"
FT                   /gene_synonym="FUS8"
FT                   /gene_synonym="SCG2"
FT                   /gene_synonym="SGP2"
FT                   /gene_synonym="STE16"
FT                   /locus_tag="YDL090C"
FT   mRNA            complement(295034..296329)
FT                   /gene="RAM1"
FT                   /gene_synonym="DPR1"
FT                   /gene_synonym="FUS8"
FT                   /gene_synonym="SCG2"
FT                   /gene_synonym="SGP2"
FT                   /gene_synonym="STE16"
FT                   /locus_tag="YDL090C"
FT                   /product="protein farnesyltransferase"
FT   CDS_pept        complement(295034..296329)
FT                   /codon_start=1
FT                   /gene="RAM1"
FT                   /gene_synonym="DPR1"
FT                   /gene_synonym="FUS8"
FT                   /gene_synonym="SCG2"
FT                   /gene_synonym="SGP2"
FT                   /gene_synonym="STE16"
FT                   /locus_tag="YDL090C"
FT                   /product="protein farnesyltransferase"
FT                   /EC_number="2.5.1.58"
FT                   /note="Beta subunit of the CAAX farnesyltransferase
FT                   (FTase); this complex prenylates the a-factor mating
FT                   pheromone and Ras proteins; required for the membrane
FT                   localization of Ras proteins and a-factor; homolog of the
FT                   mammalian FTase beta subunit"
FT                   /db_xref="GOA:P22007"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR026872"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22007"
FT                   /experiment="EXISTENCE:direct assay:GO:0004660 protein
FT                   farnesyltransferase activity [PMID:9380709]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005965 protein
FT                   farnesyltransferase complex [PMID:8424764]"
FT                   /experiment="EXISTENCE:direct assay:GO:0018343 protein
FT                   farnesylation [PMID:1763050]"
FT                   /protein_id="DAA11768.1"
FT                   /translation="MRQRVGRSIARAKFINTALLGRKRPVMERVVDIAHVDSSKAIQPL
FT                   MKELETDTTEARYKVLQSVLEIYDDEKNIEPALTKEFHKMYLDVAFEISLPPQMTALDA
FT                   SQPWMLYWIANSLKVMDRDWLSDDTKRKIVDKLFTISPSGGPFGGGPGQLSHLASTYAA
FT                   INALSLCDNIDGCWDRIDRKGIYQWLISLKEPNGGFKTCLEVGEVDTRGIYCALSIATL
FT                   LNILTEELTEGVLNYLKNCQNYEGGFGSCPHVDEAHGGYTFCATASLAILRSMDQINVE
FT                   KLLEWSSARQLQEERGFCGRSNKLVDGCYSFWVGGSAAILEAFGYGQCFNKHALRDYIL
FT                   YCCQEKEQPGLRDKPGAHSDFYHTNYCLLGLAVAESSYSCTPNDSPHNIKCTPDRLIGS
FT                   SKLTDVNPVYGLPIENVRKIIHYFKSNLSSPS"
FT   gene            296820..298274
FT                   /gene="NUR1"
FT                   /locus_tag="YDL089W"
FT   mRNA            296820..298274
FT                   /gene="NUR1"
FT                   /locus_tag="YDL089W"
FT                   /product="Nur1p"
FT   CDS_pept        296820..298274
FT                   /codon_start=1
FT                   /gene="NUR1"
FT                   /locus_tag="YDL089W"
FT                   /product="Nur1p"
FT                   /note="Protein involved in regulation of mitotic exit;
FT                   dephosphorylation target of Cdc14p in anaphase, which
FT                   promotes timely rDNA segregation and allows mitotic
FT                   progression; interacts with Csm1p, Lrs4p; required for rDNA
FT                   repeat stability; null mutant causes increase in unequal
FT                   sister-chromatid exchange; GFP-fusion protein localizes to
FT                   the nuclear periphery, possible Cdc28p substrate"
FT                   /db_xref="GOA:Q12066"
FT                   /db_xref="InterPro:IPR018819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12066"
FT                   /experiment="EXISTENCE:direct assay:GO:0034399 nuclear
FT                   periphery [PMID:14562095|PMID:26928762]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007096
FT                   regulation of exit from mitosis [PMID:25569132]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043007
FT                   maintenance of rDNA [PMID:18997772]"
FT                   /protein_id="DAA11769.1"
FT                   /translation="MGSNDLINEAYDDSEVVGEERESKSAWMKRWYQLLTSPLDLQLVI
FT                   NEKLEMINWDAYAKSLAKPLGNFLTILFFIIRLLQDNLIKPNYYKLNVKSGAFDLSKSN
FT                   KLKEFDYLWEISSSFQNNNQFYAFQSWYFVTLRFLNNLFRFTIFILLSLNLYVSCKFMF
FT                   GYFKTYNLFHLKKEFNSPNLTKHNLKDLSKEYYEDIYKQSLWSMLKHFFRGSRDDGPHV
FT                   NQNEDEIFFQLRKWIPTNFMINLFVSFSPTAIVFLSFSDVSFTSAIAIVFHQYILDYII
FT                   TKRFQRSVDDDLILSSAALQEYEDKHIMARINQCSNIDTLSSAMGTRSKTPRIFTTHSL
FT                   CGEEIREVYNYEKREFEALPKMTESVPGSRETRIKDYGGISQVSDHQSHPIGFHYSPRM
FT                   SPYYRDKVLDNNLAQSSSNENLEKGGAYLPNQDQNRPSKSLSPLRKTPLSARQKRFEGS
FT                   EFNVLNKNDINSILRSPKKKKNYHKR"
FT   gene            complement(298417..300003)
FT                   /gene="ASM4"
FT                   /gene_synonym="NUP59"
FT                   /locus_tag="YDL088C"
FT   mRNA            complement(298417..300003)
FT                   /gene="ASM4"
FT                   /gene_synonym="NUP59"
FT                   /locus_tag="YDL088C"
FT                   /product="FG-nucleoporin ASM4"
FT   CDS_pept        complement(298417..300003)
FT                   /codon_start=1
FT                   /gene="ASM4"
FT                   /gene_synonym="NUP59"
FT                   /locus_tag="YDL088C"
FT                   /product="FG-nucleoporin ASM4"
FT                   /note="FG-nucleoporin component of central core of nuclear
FT                   pore complex (NPC); contributes directly to
FT                   nucleocytoplasmic transport; induces membrane tubulation,
FT                   which may contribute to nuclear pore assembly; ASM4 has a
FT                   paralog, NUP53, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:Q05166"
FT                   /db_xref="InterPro:IPR007846"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05166"
FT                   /experiment="EXISTENCE:direct assay:GO:0003697
FT                   single-stranded DNA binding [PMID:17897934]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005543 phospholipid
FT                   binding [PMID:17897934]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005643 nuclear pore
FT                   [PMID:10684247|PMID:9864357]"
FT                   /experiment="EXISTENCE:direct assay:GO:0044613 nuclear pore
FT                   central transport channel [PMID:18046406]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006999
FT                   nuclear pore organization [PMID:19414609]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031990 mRNA
FT                   export from nucleus in response to heat stress
FT                   [PMID:18258809]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0017056
FT                   structural constituent of nuclear pore [PMID:17418788]"
FT                   /protein_id="DAA11770.1"
FT                   /translation="MFGIRSGNNNGGFTNLTSQAPQTTQMFQSQSQLQPQPQPQPQQQQ
FT                   QHLQFNGSSDASSLRFGNSLSNTVNANNYSSNIGNNSINNNNIKNGTNNISQHGQGNNP
FT                   SWVNNPKKRFTPHTVIRRKTTKQNSSSDINQNDDSSSMNATMRNFSKQNQDSKHNERNK
FT                   SAANNDINSLLSNFNDIPPSVTLQDWQREDEFGSIPSLTTQFVTDKYTAKKTNRSAYDS
FT                   KNTPNVFDKDSYVRIANIEQNHLDNNYNTAETNNKVHETSSKSSSLSAIIVFGYPESIS
FT                   NELIEHFSHFGHIMEDFQVLRLGRGINPNTFRIFHNHDTGCDENDSTVNKSITLKGRNN
FT                   ESNNKKYPIFTGESWVKLTYNSPSSALRALQENGTIFRGSLIGCIPYSKNAVEQLAGCK
FT                   IDNVDDIGEFNVSMYQNSSTSSTSNTPSPPNVIITDGTLLREDDNTPAGHAGNPTNISS
FT                   PIVANSPNKRLDVIDGKLPFMQNAGPNSNIPNLLRNLESKMRQQEAKYRNNEPAGFTHK
FT                   LSNWLFGWNDL"
FT   gene            complement(300214..300999)
FT                   /gene="LUC7"
FT                   /gene_synonym="EPE1"
FT                   /gene_synonym="EXM2"
FT                   /locus_tag="YDL087C"
FT   mRNA            complement(300214..300999)
FT                   /gene="LUC7"
FT                   /gene_synonym="EPE1"
FT                   /gene_synonym="EXM2"
FT                   /locus_tag="YDL087C"
FT                   /product="Luc7p"
FT   CDS_pept        complement(300214..300999)
FT                   /codon_start=1
FT                   /gene="LUC7"
FT                   /gene_synonym="EPE1"
FT                   /gene_synonym="EXM2"
FT                   /locus_tag="YDL087C"
FT                   /product="Luc7p"
FT                   /note="Essential protein associated with the U1 snRNP
FT                   complex; splicing factor involved in recognition of 5'
FT                   splice site; contains two zinc finger motifs; N-terminal
FT                   zinc finger binds pre-mRNA; relocalizes to the cytosol in
FT                   response to hypoxia"
FT                   /db_xref="GOA:Q07508"
FT                   /db_xref="InterPro:IPR004882"
FT                   /db_xref="PDB:5UZ5"
FT                   /db_xref="PDB:5ZWN"
FT                   /db_xref="PDB:6G90"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07508"
FT                   /experiment="EXISTENCE:direct assay:GO:0003729 mRNA binding
FT                   [PMID:17726058]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:22932476]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:22932476]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071004 U2-type
FT                   prespliceosome [PMID:16618970]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0003729 mRNA
FT                   binding [PMID:17726058]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005685 U1 snRNP
FT                   [PMID:10500099]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006376 mRNA
FT                   splice site selection [PMID:10500099]"
FT                   /protein_id="DAA11771.1"
FT                   /translation="MSTMSTPAAEQRKLVEQLMGRDFSFRHNRYSHQKRDLGLHDPKIC
FT                   KSYLVGECPYDLFQGTKQSLGKCPQMHLTKHKIQYEREVKQGKTFPEFEREYLAILSRF
FT                   VNECNGQISVALQNLKHTAEERMKIQQVTEELDVLDVRIGLMGQEIDSLIRADEVSMGM
FT                   LQSVKLQELISKRKEVAKRVRNITENVGQSAQQKLQVCEVCGAYLSRLDTDRRLADHFL
FT                   GKIHLGYVKMREDYDRLMKNNRTTNASKTATTLPGRRFV"
FT   gene            301413..302234
FT                   /locus_tag="YDL086W"
FT   mRNA            301413..302234
FT                   /locus_tag="YDL086W"
FT                   /product="carboxymethylenebutenolidase"
FT   CDS_pept        301413..302234
FT                   /codon_start=1
FT                   /locus_tag="YDL086W"
FT                   /product="carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="Putative carboxymethylenebutenolidase; the
FT                   authentic, non-tagged protein is detected in highly
FT                   purified mitochondria in high-throughput studies; YDL086W
FT                   is not an essential gene"
FT                   /db_xref="GOA:Q07505"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07505"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:11914276]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /protein_id="DAA11772.1"
FT                   /translation="MLITETFHDVQTSYGTTLRIYVYSPKIAGYPQAKFPGVILYSEIY
FT                   QVTGPVRRFGQRIASEGYVVVAPAIYHNFMGPEALPYDVQGTDIGNEYKIKKPLESYDE
FT                   DNKLCCDLLFQLPQFDGKRIGSTGMCLGGHLAFRALLDKRVTCATCFFPTDIHSRTLGL
FT                   GQNDNSLERVSKELGNNQEMVLIFGTADTHVDPQGRDLIRKTLRDHGVKFTFLEILAAQ
FT                   HAFIRDEFSKGRFDSAITQSCLGFLFEQFNRKLRIDLGEFVDDNTPLEHVC"
FT   gene            complement(302464..302670)
FT                   /locus_tag="YDL085C-A"
FT   mRNA            complement(302464..302670)
FT                   /locus_tag="YDL085C-A"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(302464..302670)
FT                   /codon_start=1
FT                   /locus_tag="YDL085C-A"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; green fluorescent protein
FT                   (GFP)-fusion protein localizes to the cytoplasm and
FT                   nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:YDL085C-A"
FT                   /db_xref="EnsemblGenomes-Tr:YDL085C-A"
FT                   /db_xref="GOA:Q3E7B7"
FT                   /db_xref="InterPro:IPR007513"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3E7B7"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /protein_id="DAA11773.1"
FT                   /translation="MARGNQRDLARQKNLKKQKDMAKNQKKSGDPKKRMESDAEILRQK
FT                   QAAADARREAEKLEKLKAEKTRR"
FT   gene            303211..304848
FT                   /gene="NDE2"
FT                   /gene_synonym="NDH2"
FT                   /locus_tag="YDL085W"
FT   mRNA            303211..304848
FT                   /gene="NDE2"
FT                   /gene_synonym="NDH2"
FT                   /locus_tag="YDL085W"
FT                   /product="NADH-ubiquinone reductase (H(+)-translocating)
FT                   NDE2"
FT   CDS_pept        303211..304848
FT                   /codon_start=1
FT                   /gene="NDE2"
FT                   /gene_synonym="NDH2"
FT                   /locus_tag="YDL085W"
FT                   /product="NADH-ubiquinone reductase (H(+)-translocating)
FT                   NDE2"
FT                   /EC_number="1.6.5.9"
FT                   /note="Mitochondrial external NADH dehydrogenase; catalyzes
FT                   the oxidation of cytosolic NADH; Nde1p and Nde2p are
FT                   involved in providing the cytosolic NADH to the
FT                   mitochondrial respiratory chain; NDE2 has a paralog, NDE1,
FT                   that arose from the whole genome duplication"
FT                   /db_xref="GOA:Q07500"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07500"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion
FT                   [PMID:11502169|PMID:14576278|PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006116 NADH
FT                   oxidation [PMID:12032156]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005739
FT                   mitochondrion [PMID:9733747]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0019655
FT                   glycolytic fermentation to ethanol [PMID:9733747]"
FT                   /protein_id="DAA11774.1"
FT                   /translation="MLPRLGFARTARSIHRFKMTQISKPFFHSTEVGKPGPQQKLSKSY
FT                   TAVFKKWFVRGLKLTFYTTLAGTLYVSYELYKESNPPKQVPQSTAFANGLKKKELVILG
FT                   TGWGAISLLKKLDTSLYNVTVVSPRSFFLFTPLLPSTPVGTIEMKSIVEPVRSIARRTP
FT                   GEVHYIEAEALDVDPKAKKVMVQSVSEDEYFVSSLSYDYLVVSVGAKTTTFNIPGVYGN
FT                   ANFLKEIEDAQNIRMKLMKTIEQASSFPVNDPERKRLLTFVVVGGGPTGVEFAAELQDY
FT                   INQDLRKWMPDLSKEMKVILIEALPNILNMFDKTLIKYAEDLFARDEIDLQVNTAVKVV
FT                   EPTYIRTLQNGQTNTDIEYGMLVWATGNEPIDFSKTLMSRIPEQTNRRGLLINDKLELL
FT                   GSENSIYAIGDCTAHTGFFPTAQVAHQEGEYLAKILDKKLQIEQLEWDMLNSTDETEVS
FT                   RLQKEVNLRKSKLDKFNYKHMGALAYIGSETAIADLHMGDSSYQLKGMFAFLFWKSAYL
FT                   AMCLSIRNRILIAMDWTKVYFLGRDSSV"
FT   gene            305237..306577
FT                   /gene="SUB2"
FT                   /locus_tag="YDL084W"
FT   mRNA            305237..306577
FT                   /gene="SUB2"
FT                   /locus_tag="YDL084W"
FT                   /product="ATP-dependent RNA helicase SUB2"
FT   CDS_pept        305237..306577
FT                   /codon_start=1
FT                   /gene="SUB2"
FT                   /locus_tag="YDL084W"
FT                   /product="ATP-dependent RNA helicase SUB2"
FT                   /EC_number="3.6.4.13"
FT                   /note="Component of the TREX complex required for nuclear
FT                   mRNA export; member of the DEAD-box RNA helicase
FT                   superfamily and is involved in early and late steps of
FT                   spliceosome assembly; homolog of the human splicing factor
FT                   hUAP56; relocalizes from nucleus to cytoplasm upon DNA
FT                   replication stress"
FT                   /db_xref="GOA:Q07478"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:5SUP"
FT                   /db_xref="PDB:5SUQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07478"
FT                   /experiment="EXISTENCE:direct assay:GO:0000346
FT                   transcription export complex [PMID:11979277]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000781 chromosome,
FT                   telomeric region [PMID:15942929]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003723 RNA binding
FT                   [PMID:28059701]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:11914276|PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006406 mRNA export
FT                   from nucleus [PMID:11675790|PMID:11696331]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0003724 RNA
FT                   helicase activity [PMID:11156602]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000398 mRNA
FT                   splicing, via spliceosome [PMID:11156602]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006283
FT                   transcription-coupled nucleotide-excision repair
FT                   [PMID:17537816]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006348
FT                   chromatin silencing at telomere [PMID:15942929]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006368
FT                   transcription elongation from RNA polymerase II promoter
FT                   [PMID:17960421]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006406 mRNA
FT                   export from nucleus [PMID:11675790|PMID:11696331]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031124 mRNA
FT                   3'-end processing [PMID:18614048]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0006406 mRNA
FT                   export from nucleus [PMID:11675790]"
FT                   /protein_id="DAA11775.1"
FT                   /translation="MSHEGEEDLLEYSDNEQEIQIDASKAAEAGETGAATSATEGDNNN
FT                   NTAAGDKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLC
FT                   QAKSGLGKTAVFVLSTLQQLDPVPGEVAVVVICNARELAYQIRNEYLRFSKYMPDVKTA
FT                   VFYGGTPISKDAELLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLE
FT                   ELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGL
FT                   QQYYIKLEEREKNRKLAQLLDDLEFNQVIIFVKSTTRANELTKLLNASNFPAITVHGHM
FT                   KQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGR
FT                   FGTKGLAISFVSSKEDEEVLAKIQERFDVKIAEFPEEGIDPSTYLNN"
FT   gene            complement(306926..307789)
FT                   /gene="RPS16B"
FT                   /locus_tag="YDL083C"
FT   mRNA            complement(join(306926..307333,307766..307789))
FT                   /gene="RPS16B"
FT                   /locus_tag="YDL083C"
FT                   /product="ribosomal 40S subunit protein S16B"
FT   CDS_pept        complement(join(306926..307333,307766..307789))
FT                   /codon_start=1
FT                   /gene="RPS16B"
FT                   /locus_tag="YDL083C"
FT                   /product="ribosomal 40S subunit protein S16B"
FT                   /note="Protein component of the small (40S) ribosomal
FT                   subunit; homologous to mammalian ribosomal protein S16 and
FT                   bacterial S9; RPS16B has a paralog, RPS16A, that arose from
FT                   the whole genome duplication"
FT                   /db_xref="GOA:P0CX52"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CX52"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000462
FT                   maturation of SSU-rRNA from tricistronic rRNA transcript
FT                   (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:16246728]"
FT                   /protein_id="DAA11776.1"
FT                   /translation="MSAVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILR
FT                   FKVYEPLLLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNE
FT                   LKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKSYR"
FT   gene            308424..309388
FT                   /gene="RPL13A"
FT                   /locus_tag="YDL082W"
FT   mRNA            join(308424..308427,308793..309388)
FT                   /gene="RPL13A"
FT                   /locus_tag="YDL082W"
FT                   /product="ribosomal 60S subunit protein L13A"
FT   CDS_pept        join(308424..308427,308793..309388)
FT                   /codon_start=1
FT                   /gene="RPL13A"
FT                   /locus_tag="YDL082W"
FT                   /product="ribosomal 60S subunit protein L13A"
FT                   /note="Ribosomal 60S subunit protein L13A; not essential
FT                   for viability; homologous to mammalian ribosomal protein
FT                   L13, no bacterial homolog; RPL13A has a paralog, RPL13B,
FT                   that arose from the whole genome duplication"
FT                   /db_xref="GOA:Q12690"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="InterPro:IPR018256"
FT                   /db_xref="PDB:3J6X"
FT                   /db_xref="PDB:3J6Y"
FT                   /db_xref="PDB:3J77"
FT                   /db_xref="PDB:3J78"
FT                   /db_xref="PDB:3JCT"
FT                   /db_xref="PDB:4U3M"
FT                   /db_xref="PDB:4U3N"
FT                   /db_xref="PDB:4U3U"
FT                   /db_xref="PDB:4U4N"
FT                   /db_xref="PDB:4U4O"
FT                   /db_xref="PDB:4U4Q"
FT                   /db_xref="PDB:4U4R"
FT                   /db_xref="PDB:4U4U"
FT                   /db_xref="PDB:4U4Y"
FT                   /db_xref="PDB:4U4Z"
FT                   /db_xref="PDB:4U50"
FT                   /db_xref="PDB:4U51"
FT                   /db_xref="PDB:4U52"
FT                   /db_xref="PDB:4U53"
FT                   /db_xref="PDB:4U55"
FT                   /db_xref="PDB:4U56"
FT                   /db_xref="PDB:4U6F"
FT                   /db_xref="PDB:4V7F"
FT                   /db_xref="PDB:4V88"
FT                   /db_xref="PDB:4V8T"
FT                   /db_xref="PDB:4V8Y"
FT                   /db_xref="PDB:4V8Z"
FT                   /db_xref="PDB:5APN"
FT                   /db_xref="PDB:5APO"
FT                   /db_xref="PDB:5DAT"
FT                   /db_xref="PDB:5DC3"
FT                   /db_xref="PDB:5DGE"
FT                   /db_xref="PDB:5DGF"
FT                   /db_xref="PDB:5DGV"
FT                   /db_xref="PDB:5FCI"
FT                   /db_xref="PDB:5FCJ"
FT                   /db_xref="PDB:5FL8"
FT                   /db_xref="PDB:5GAK"
FT                   /db_xref="PDB:5H4P"
FT                   /db_xref="PDB:5I4L"
FT                   /db_xref="PDB:5JCS"
FT                   /db_xref="PDB:5JUO"
FT                   /db_xref="PDB:5JUP"
FT                   /db_xref="PDB:5JUS"
FT                   /db_xref="PDB:5JUT"
FT                   /db_xref="PDB:5JUU"
FT                   /db_xref="PDB:5LYB"
FT                   /db_xref="PDB:5M1J"
FT                   /db_xref="PDB:5MC6"
FT                   /db_xref="PDB:5MEI"
FT                   /db_xref="PDB:5NDG"
FT                   /db_xref="PDB:5NDV"
FT                   /db_xref="PDB:5NDW"
FT                   /db_xref="PDB:5OBM"
FT                   /db_xref="PDB:5ON6"
FT                   /db_xref="PDB:5T62"
FT                   /db_xref="PDB:5T6R"
FT                   /db_xref="PDB:5TBW"
FT                   /db_xref="PDB:5TGA"
FT                   /db_xref="PDB:5TGM"
FT                   /db_xref="PDB:5Z3G"
FT                   /db_xref="PDB:6C0F"
FT                   /db_xref="PDB:6CB1"
FT                   /db_xref="PDB:6ELZ"
FT                   /db_xref="PDB:6EM1"
FT                   /db_xref="PDB:6EM3"
FT                   /db_xref="PDB:6EM4"
FT                   /db_xref="PDB:6EM5"
FT                   /db_xref="PDB:6FT6"
FT                   /db_xref="PDB:6GQ1"
FT                   /db_xref="PDB:6GQB"
FT                   /db_xref="PDB:6GQV"
FT                   /db_xref="PDB:6HD7"
FT                   /db_xref="PDB:6HHQ"
FT                   /db_xref="PDB:6I7O"
FT                   /db_xref="PDB:6N8J"
FT                   /db_xref="PDB:6N8K"
FT                   /db_xref="PDB:6N8L"
FT                   /db_xref="PDB:6N8M"
FT                   /db_xref="PDB:6N8N"
FT                   /db_xref="PDB:6N8O"
FT                   /db_xref="PDB:6Q8Y"
FT                   /db_xref="PDB:6QIK"
FT                   /db_xref="PDB:6QT0"
FT                   /db_xref="PDB:6QTZ"
FT                   /db_xref="PDB:6R84"
FT                   /db_xref="PDB:6R87"
FT                   /db_xref="PDB:6RI5"
FT                   /db_xref="PDB:6RZZ"
FT                   /db_xref="PDB:6S05"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12690"
FT                   /experiment="EXISTENCE:curator inference:GO:0002181
FT                   cytoplasmic translation [PMID:11983894]"
FT                   /experiment="EXISTENCE:curator inference:GO:0003735
FT                   structural constituent of ribosome [PMID:11983894]"
FT                   /experiment="EXISTENCE:direct assay:GO:0022625 cytosolic
FT                   large ribosomal subunit [PMID:11983894]"
FT                   /protein_id="DAA11777.1"
FT                   /translation="MAISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAK
FT                   IAPRPLDLLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNR
FT                   NQEIFDANVQRLKEYQSKIIVFPRNGKAPEAEQVLSAAATFPIAQPATDVEARAVQDNG
FT                   ESAFRTLRLARSEKKFRGIREKRAREKAEAEAEKKK"
FT   gene            complement(309802..310122)
FT                   /gene="RPP1A"
FT                   /gene_synonym="RPLA1"
FT                   /locus_tag="YDL081C"
FT   mRNA            complement(309802..310122)
FT                   /gene="RPP1A"
FT                   /gene_synonym="RPLA1"
FT                   /locus_tag="YDL081C"
FT                   /product="ribosomal protein P1A"
FT   CDS_pept        complement(309802..310122)
FT                   /codon_start=1
FT                   /gene="RPP1A"
FT                   /gene_synonym="RPLA1"
FT                   /locus_tag="YDL081C"
FT                   /product="ribosomal protein P1A"
FT                   /note="Ribosomal stalk protein P1 alpha; involved in the
FT                   interaction between translational elongation factors and
FT                   the ribosome; free (non-ribosomal) P1 stimulates the
FT                   phosphorylation of the eIF2 alpha subunit (Sui2p) by Gcn2p;
FT                   accumulation of P1 in the cytoplasm is regulated by
FT                   phosphorylation and interaction with the P2 stalk
FT                   component"
FT                   /db_xref="GOA:P05318"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="PDB:4V6I"
FT                   /db_xref="PDB:5DGE"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05318"
FT                   /experiment="EXISTENCE:direct assay:GO:0003735 structural
FT                   constituent of ribosome [PMID:22096102]"
FT                   /experiment="EXISTENCE:direct assay:GO:0022625 cytosolic
FT                   large ribosomal subunit [PMID:22096102]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030295 protein
FT                   kinase activator activity [PMID:24391917]"
FT                   /experiment="EXISTENCE:direct assay:GO:0045860 positive
FT                   regulation of protein kinase activity [PMID:24391917]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0002181
FT                   cytoplasmic translation [PMID:1601875]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0002181
FT                   cytoplasmic translation [PMID:1601875]"
FT                   /protein_id="DAA11778.1"
FT                   /translation="MSTESALSYAALILADSEIEISSEKLLTLTNAANVPVENIWADIF
FT                   AKALDGQNLKDLLVNFSAGAAAPAGVAGGVAGGEAGEAEAEKEEEEAKEESDDDMGFGL
FT                   FD"
FT   gene            complement(310642..312471)
FT                   /gene="THI3"
FT                   /gene_synonym="KID1"
FT                   /locus_tag="YDL080C"
FT   mRNA            complement(310642..312471)
FT                   /gene="THI3"
FT                   /gene_synonym="KID1"
FT                   /locus_tag="YDL080C"
FT                   /product="branched-chain-2-oxoacid decarboxylase THI3"
FT   CDS_pept        complement(310642..312471)
FT                   /codon_start=1
FT                   /gene="THI3"
FT                   /gene_synonym="KID1"
FT                   /locus_tag="YDL080C"
FT                   /product="branched-chain-2-oxoacid decarboxylase THI3"
FT                   /EC_number="4.1.1.72"
FT                   /note="Regulatory protein that binds Pdc2p and Thi2p
FT                   transcription factors; activates thiamine biosynthesis
FT                   transcription factors Pdc2p and Thi2p by binding to them,
FT                   but releases and de-activates them upon binding to thiamine
FT                   pyrophosphate (TPP), the end product of the pathway; has
FT                   similarity to decarboxylases but enzymatic activity is not
FT                   detected"
FT                   /db_xref="GOA:Q07471"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07471"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:16194233|PMID:16850348|PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016831
FT                   carboxy-lyase activity [PMID:22904058]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045944 positive
FT                   regulation of transcription by RNA polymerase II
FT                   [PMID:16194233]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0090180 positive
FT                   regulation of thiamine biosynthetic process
FT                   [PMID:16194233|PMID:19013460]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0001102 RNA
FT                   polymerase II activating transcription factor binding
FT                   [PMID:19013460]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0090180
FT                   positive regulation of thiamine biosynthetic process
FT                   [PMID:16194233|PMID:19013460]"
FT                   /protein_id="DAA11779.1"
FT                   /translation="MNSSYTQRYALPKCIAISDYLFHRLNQLNIHTIFGLSGEFSMPLL
FT                   DKLYNIPNLRWAGNSNELNAAYAADGYSRLKGLGCLITTFGVGELSAINGVAGSYAEHV
FT                   GILHIVGMPPTSAQTKQLLLHHTLGNGDFTVFHRIASDVACYTTLIIDSELCADEVDKC
FT                   IKKAWIEQRPVYMGMPVNQVNLPIESARLNTPLDLQLHKNDPDVEKEVISRILSFIYKS
FT                   QNPAIIVDACTSRQNLIEETKELCNRLKFPVFVTPMGKGTVNETDPQFGGVFTGSISAP
FT                   EVREVVDFADFIIVIGCMLSEFSTSTFHFQYKTKNCALLYSTSVKLKNATYPDLSIKLL
FT                   LQKILANLDESKLSYQPSEQPSMMVPRPYPAGNVLLRQEWVWNEISHWFQPGDIIITET
FT                   GASAFGVNQTRFPVNTLGISQALWGSVGYTMGACLGAEFAVQEINKDKFPATKHRVILF
FT                   MGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVDRFLHHRSDASYYDIQPWNYLGLL
FT                   RVFGCTNYETKKIITVGEFRSMISDPNFATNDKIRMIEIMLPPRDVPQALLDRWVVEKE
FT                   QSKQVQEENENSSAVNTPTPEFQPLLKKNQVGY"
FT   gene            complement(312951..314748)
FT                   /gene="MRK1"
FT                   /locus_tag="YDL079C"
FT   mRNA            complement(join(312951..314044,314337..314748))
FT                   /gene="MRK1"
FT                   /locus_tag="YDL079C"
FT                   /product="putative serine/threonine protein kinase MRK1"
FT   CDS_pept        complement(join(312951..314044,314337..314748))
FT                   /codon_start=1
FT                   /gene="MRK1"
FT                   /locus_tag="YDL079C"
FT                   /product="putative serine/threonine protein kinase MRK1"
FT                   /EC_number="2.7.11.1"
FT                   /note="Glycogen synthase kinase 3 (GSK-3) homolog; one of
FT                   four GSK-3 homologs in S. cerevisiae that function to
FT                   activate Msn2p-dependent transcription of stress responsive
FT                   genes and that function in protein degradation; MRK1 has a
FT                   paralog, RIM11, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:P50873"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR039192"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50873"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006468
FT                   protein phosphorylation [PMID:12704202]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0042176
FT                   regulation of protein catabolic process [PMID:10958669]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034605 cellular
FT                   response to heat [PMID:12529445]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0071472 cellular
FT                   response to salt stress [PMID:12529445]"
FT                   /protein_id="DAA11780.1"
FT                   /translation="MTDVLRSLVRKISFNNSDNLQLKHKTSIQSNTALEKKKRKPDTIK
FT                   KVSDVQVHHTVPNFNNSSEYINDIENLIISKLIDGGKEGIAVDHIEHANISDSKTDGKV
FT                   ANKHENISSKLSKEKVEKMINFDYRYIKTKERTIHKRVYKHDRKTDVDRKNHGGTIDIS
FT                   YPTTEVVGHGSFGVVVTTVIIETNQKVAIKKVLQDRRYKNRELETMKMLCHPNTVGLQY
FT                   YFYEKDEEDEVYLNLVLDYMPQSLYQRLRHFVNLKMQMPRVEIKFYAYQLFKALNYLHN
FT                   VPRICHRDIKPQNLLVDPTTFSFKICDFGSAKCLKPDQPNVSYICSRYYRAPELMFGAT
FT                   NYSNQVDVWSSACVIAELLLGKPLFSGESGIDQLVEIIKIMGIPTKDEISGMNPNYEDH
FT                   VFPNIKPITLAEIFKAEDPDTLDLLTKTLKYHPCERLVPLQCLLSSYFDETKRCDTDTY
FT                   VKAQNLRIFDFDVETELGHVPLVERPAIEERLKHFVSAPSSSL"
FT   gene            complement(315357..316388)
FT                   /gene="MDH3"
FT                   /locus_tag="YDL078C"
FT   mRNA            complement(315357..316388)
FT                   /gene="MDH3"
FT                   /locus_tag="YDL078C"
FT                   /product="malate dehydrogenase MDH3"
FT   CDS_pept        complement(315357..316388)
FT                   /codon_start=1
FT                   /gene="MDH3"
FT                   /locus_tag="YDL078C"
FT                   /product="malate dehydrogenase MDH3"
FT                   /EC_number="1.1.1.37"
FT                   /note="Peroxisomal malate dehydrogenase; catalyzes
FT                   interconversion of malate and oxaloacetate; involved in the
FT                   glyoxylate cycle"
FT                   /db_xref="GOA:P32419"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:5ZI2"
FT                   /db_xref="PDB:5ZI3"
FT                   /db_xref="PDB:5ZI4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32419"
FT                   /experiment="EXISTENCE:direct assay:GO:0003729 mRNA binding
FT                   [PMID:21124907]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005777 peroxisome
FT                   [PMID:1447211|PMID:7628449|PMID:22375831]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005782 peroxisomal
FT                   matrix [PMID:8824293]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030060 L-malate
FT                   dehydrogenase activity [PMID:1447211]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006635 fatty
FT                   acid beta-oxidation [PMID:7628449]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006735 NADH
FT                   regeneration [PMID:7628449]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030060 L-malate
FT                   dehydrogenase activity [PMID:1986231|PMID:7628449]"
FT                   /protein_id="DAA11781.1"
FT                   /translation="MVKVAILGASGGVGQPLSLLLKLSPYVSELALYDIRAAEGIGKDL
FT                   SHINTNSSCVGYDKDSIENTLSNAQVVLIPAGVPRKPGLTRDDLFKMNAGIVKSLVTAV
FT                   GKFAPNARILVISNPVNSLVPIAVETLKKMGKFKPGNVMGVTNLDLVRAETFLVDYLML
FT                   KNPKIGQEQDKTTMHRKVTVIGGHSGETIIPIITDKSLVFQLDKQYEHFIHRVQFGGDE
FT                   IVKAKQGAGSATLSMAFAGAKFAEEVLRSFHNEKPETESLSAFVYLPGLKNGKKAQQLV
FT                   GDNSIEYFSLPIVLRNGSVVSIDTSVLEKLSPREEQLVNTAVKELRKNIEKGKSFILDS
FT                   SKL"
FT   rep_origin      316771..317230
FT                   /note="ARS412; Putative replication origin; identified in
FT                   multiple array studies, not yet confirmed by plasmid-based
FT                   assay"
FT   gene            complement(316971..320120)
FT                   /gene="VAM6"
FT                   /gene_synonym="CVT4"
FT                   /gene_synonym="VPL18"
FT                   /gene_synonym="VPL22"
FT                   /gene_synonym="VPS39"
FT                   /locus_tag="YDL077C"
FT   mRNA            complement(316971..320120)
FT                   /gene="VAM6"
FT                   /gene_synonym="CVT4"
FT                   /gene_synonym="VPL18"
FT                   /gene_synonym="VPL22"
FT                   /gene_synonym="VPS39"
FT                   /locus_tag="YDL077C"
FT                   /product="Vam6p"
FT   CDS_pept        complement(316971..320120)
FT                   /codon_start=1
FT                   /gene="VAM6"
FT                   /gene_synonym="CVT4"
FT                   /gene_synonym="VPL18"
FT                   /gene_synonym="VPL22"
FT                   /gene_synonym="VPS39"
FT                   /locus_tag="YDL077C"
FT                   /product="Vam6p"
FT                   /note="Guanine nucleotide exchange factor for the GTPase
FT                   Gtr1p; subunit of the HOPS endocytic tethering complex;
FT                   vacuole membrane protein; functions as a Rab GTPase
FT                   effector, interacting with both GTP- and GDP-bound
FT                   conformations of Ypt7p; facilitates tethering and promotes
FT                   membrane fusion events at the late endosome and vacuole;
FT                   required for both membrane and protein trafficking;
FT                   component of vacuole-mitochondrion contacts (vCLAMPs)
FT                   important for lipid transfer between organelles"
FT                   /db_xref="GOA:Q07468"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR019452"
FT                   /db_xref="InterPro:IPR019453"
FT                   /db_xref="InterPro:IPR032914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07468"
FT                   /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
FT                   vacuole [PMID:11853670]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000329 fungal-type
FT                   vacuole membrane
FT                   [PMID:19748353|PMID:9111041|PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005088 Ras
FT                   guanyl-nucleotide exchange factor activity [PMID:19748353]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032889 regulation
FT                   of vacuole fusion, non-autophagic [PMID:18385512]"
FT                   /experiment="EXISTENCE:direct assay:GO:0035091
FT                   phosphatidylinositol binding [PMID:16601699]"
FT                   /experiment="EXISTENCE:direct assay:GO:0035542 regulation
FT                   of SNARE complex assembly [PMID:18385512]"
FT                   /experiment="EXISTENCE:direct assay:GO:0042144 vacuole
FT                   fusion, non-autophagic [PMID:10944212]"
FT                   /experiment="EXISTENCE:direct assay:GO:0099022 vesicle
FT                   tethering [PMID:27307091]"
FT                   /experiment="EXISTENCE:direct assay:GO:1990816
FT                   vacuole-mitochondrion membrane contact site
FT                   [PMID:25026035|PMID:25026036]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:1904263
FT                   positive regulation of TORC1 signaling [PMID:19748353]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007033 vacuole
FT                   organization [PMID:9111041]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016192
FT                   vesicle-mediated transport [PMID:12730205]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034727
FT                   piecemeal microautophagy of the nucleus [PMID:18701704]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0042144 vacuole
FT                   fusion, non-autophagic [PMID:10944212]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1904263 positive
FT                   regulation of TORC1 signaling [PMID:19748353]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0017137 Rab
FT                   GTPase binding
FT                   [PMID:11062257|PMID:18809726|PMID:20604902|PMID:21325627]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0030897 HOPS
FT                   complex [PMID:10944212]"
FT                   /protein_id="DAA11782.1"
FT                   /translation="MLRAQKLHSLKSSDITAILPTEQSQKLVLAKKNGDVEVYSRDGNT
FT                   LKLFQVYPDLLQNAKNDPLPPVIENFYFANELSTIFAQCKETLILLSTTNLHEYDRIID
FT                   RRGINHCWLFERSHKNKEEKNTYLIYSTINTAKMRVLIWEGRTYKNMMEASLSYRKETI
FT                   RSIYPGETGITLATDLGIYHWPYNKPSLIRIEKTVKNKFPKDMISALTELKEQAEKVIE
FT                   KKPKKNSHFDAQSFSSMDRMSRKSSMSSLWYRTIRNERGNKIRYTFELDGNDATPMIID
FT                   GATKKIFKVELMHNNEEPFLIATDHATFSESNSEFDHMQYLSSNLLMLYNSSTIKFVDY
FT                   ENGFTFLQQKIPEGIKWVKNLSGTYFLVWTSNDEVQLFSYHVDDGSEDDDQESICGDIN
FT                   DPDFYQLWRKVLFYKFFIDSPHSKELCVSDNPEESLDICAMKLRDLTVMWCLRIFDKFQ
FT                   NYMVQLERSRNSRMIRSKCEEMIIKSIFDLFIKFWAPPQLVILKVFPSAISSLVLEITG
FT                   QEHHCLLKEAEEVKETYDIPPHLLNRWCLPYLTDTRRHLQNLLSKENDDESRITWCYRD
FT                   REIKQSFDFFLISNHDDVDLNTMLTLIDTVLFKCYLYYNPPMVGPFIRVENHCDSHVIV
FT                   TELKIRHMFKDLIDFYYKRGNHEEALKFLTDLVDELENDNTDQKQRQKIDHGVKILVIY
FT                   YLKKLSNPQLDVIFTYTDWLLNRHNDSIKEILSSIFFYDSQACSSRDHLKVYGYIKKFD
FT                   KLLAIQYLEFAISTFRLEGNKLHTVLIKLYLENLDIPSTRIKLKSLLETTSVYEPRTIL
FT                   KLLNDAIESGSDQLPTNQLNFVKYLKIFPLSKLENHKEAVHILLDEIDDYKAATSYCND
FT                   VYQSDSTKGEELLLYLYSKLVSIYDSNRNSKLILNFLQDHGSKLNSAEIYKNLPQDISL
FT                   YDIGRVVSQLLKKHTSKMDETRLEKALLQVELVATTYKLNERMSSYGVLSDSHKCPICK
FT                   KVISNFGTDSISWFTREGRNIITHYNCGKVLQERFNAKNEKSSRIKQKTLGEVINELNN
FT                   K"
FT   gene            complement(320668..321552)
FT                   /gene="RXT3"
FT                   /locus_tag="YDL076C"
FT   mRNA            complement(320668..321552)
FT                   /gene="RXT3"
FT                   /locus_tag="YDL076C"
FT                   /product="Rxt3p"
FT   CDS_pept        complement(320668..321552)
FT                   /codon_start=1
FT                   /gene="RXT3"
FT                   /locus_tag="YDL076C"
FT                   /product="Rxt3p"
FT                   /note="Component of the Rpd3L histone deacetylase complex;
FT                   involved in histone deacetylation; protein abundance
FT                   increases in response to DNA replication stress"
FT                   /db_xref="GOA:Q07458"
FT                   /db_xref="InterPro:IPR013951"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07458"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095|PMID:24390141]"
FT                   /experiment="EXISTENCE:direct assay:GO:0033698 Rpd3L
FT                   complex [PMID:16286007|PMID:16314178|PMID:19040720]"
FT                   /experiment="EXISTENCE:direct assay:GO:0070210
FT                   Rpd3L-Expanded complex [PMID:19040720]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016479 negative
FT                   regulation of transcription by RNA polymerase I
FT                   [PMID:19270272]"
FT                   /protein_id="DAA11783.1"
FT                   /translation="MSVSEQDPNRAYRETQSQIYKLQETLLNSARTKNKQEEGQESNTH
FT                   SFPEQYMHYQNGRNSAYDLPNVSSQSVLAFTEKHYPNKLKNLGTLYYNRFKEGSFDEDS
FT                   TSYSDRHSFPYNLYDNTLPPPFLPAIGIQNINNIATLKITYEDIQASFNNIESPRKRNN
FT                   EIWGCDIYSDDSDPILVLRHCGFKIGAPSGGSFHKLRRTPVNVTNQDNVTGNLPLLEGT
FT                   PFDLEVELLFLPTLQKYPSVKRFDITSREWGSEATVIHDGLSYGIYSIVIKQRLDRDKP
FT                   HEPNGYIKNLKWT"
FT   gene            322226..322988
FT                   /gene="RPL31A"
FT                   /gene_synonym="RPL34"
FT                   /locus_tag="YDL075W"
FT   mRNA            join(322226..322282,322704..322988)
FT                   /gene="RPL31A"
FT                   /gene_synonym="RPL34"
FT                   /locus_tag="YDL075W"
FT                   /product="ribosomal 60S subunit protein L31A"
FT   CDS_pept        join(322226..322282,322704..322988)
FT                   /codon_start=1
FT                   /gene="RPL31A"
FT                   /gene_synonym="RPL34"
FT                   /locus_tag="YDL075W"
FT                   /product="ribosomal 60S subunit protein L31A"
FT                   /note="Ribosomal 60S subunit protein L31A; associates with
FT                   karyopherin Sxm1p; loss of both Rpl31p and Rpl39p confers
FT                   lethality; homologous to mammalian ribosomal protein L31,
FT                   no bacterial homolog; RPL31A has a paralog, RPL31B, that
FT                   arose from the whole genome duplication"
FT                   /db_xref="GOA:P0C2H8"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR020052"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="PDB:1K5Y"
FT                   /db_xref="PDB:2WW9"
FT                   /db_xref="PDB:2WWA"
FT                   /db_xref="PDB:2WWB"
FT                   /db_xref="PDB:3J6X"
FT                   /db_xref="PDB:3J6Y"
FT                   /db_xref="PDB:3J77"
FT                   /db_xref="PDB:3J78"
FT                   /db_xref="PDB:3JCT"
FT                   /db_xref="PDB:4U3M"
FT                   /db_xref="PDB:4U3N"
FT                   /db_xref="PDB:4U3U"
FT                   /db_xref="PDB:4U4N"
FT                   /db_xref="PDB:4U4O"
FT                   /db_xref="PDB:4U4Q"
FT                   /db_xref="PDB:4U4R"
FT                   /db_xref="PDB:4U4U"
FT                   /db_xref="PDB:4U4Y"
FT                   /db_xref="PDB:4U4Z"
FT                   /db_xref="PDB:4U50"
FT                   /db_xref="PDB:4U51"
FT                   /db_xref="PDB:4U52"
FT                   /db_xref="PDB:4U53"
FT                   /db_xref="PDB:4U55"
FT                   /db_xref="PDB:4U56"
FT                   /db_xref="PDB:4U6F"
FT                   /db_xref="PDB:4V4B"
FT                   /db_xref="PDB:4V6I"
FT                   /db_xref="PDB:4V7F"
FT                   /db_xref="PDB:4V7R"
FT                   /db_xref="PDB:4V88"
FT                   /db_xref="PDB:4V8T"
FT                   /db_xref="PDB:4V8Y"
FT                   /db_xref="PDB:4V8Z"
FT                   /db_xref="PDB:4V91"
FT                   /db_xref="PDB:5APN"
FT                   /db_xref="PDB:5APO"
FT                   /db_xref="PDB:5DAT"
FT                   /db_xref="PDB:5DC3"
FT                   /db_xref="PDB:5DGE"
FT                   /db_xref="PDB:5DGF"
FT                   /db_xref="PDB:5DGV"
FT                   /db_xref="PDB:5FCI"
FT                   /db_xref="PDB:5FCJ"
FT                   /db_xref="PDB:5FL8"
FT                   /db_xref="PDB:5GAK"
FT                   /db_xref="PDB:5H4P"
FT                   /db_xref="PDB:5I4L"
FT                   /db_xref="PDB:5JCS"
FT                   /db_xref="PDB:5JUO"
FT                   /db_xref="PDB:5JUP"
FT                   /db_xref="PDB:5JUS"
FT                   /db_xref="PDB:5JUT"
FT                   /db_xref="PDB:5JUU"
FT                   /db_xref="PDB:5LYB"
FT                   /db_xref="PDB:5M1J"
FT                   /db_xref="PDB:5MC6"
FT                   /db_xref="PDB:5MEI"
FT                   /db_xref="PDB:5NDG"
FT                   /db_xref="PDB:5NDV"
FT                   /db_xref="PDB:5NDW"
FT                   /db_xref="PDB:5OBM"
FT                   /db_xref="PDB:5ON6"
FT                   /db_xref="PDB:5T62"
FT                   /db_xref="PDB:5T6R"
FT                   /db_xref="PDB:5TBW"
FT                   /db_xref="PDB:5TGA"
FT                   /db_xref="PDB:5TGM"
FT                   /db_xref="PDB:6ELZ"
FT                   /db_xref="PDB:6EM5"
FT                   /db_xref="PDB:6FT6"
FT                   /db_xref="PDB:6GQ1"
FT                   /db_xref="PDB:6GQB"
FT                   /db_xref="PDB:6GQV"
FT                   /db_xref="PDB:6HD7"
FT                   /db_xref="PDB:6HHQ"
FT                   /db_xref="PDB:6I7O"
FT                   /db_xref="PDB:6N8J"
FT                   /db_xref="PDB:6N8K"
FT                   /db_xref="PDB:6N8L"
FT                   /db_xref="PDB:6N8M"
FT                   /db_xref="PDB:6N8N"
FT                   /db_xref="PDB:6N8O"
FT                   /db_xref="PDB:6Q8Y"
FT                   /db_xref="PDB:6QIK"
FT                   /db_xref="PDB:6QT0"
FT                   /db_xref="PDB:6QTZ"
FT                   /db_xref="PDB:6R84"
FT                   /db_xref="PDB:6R87"
FT                   /db_xref="PDB:6RI5"
FT                   /db_xref="PDB:6RZZ"
FT                   /db_xref="PDB:6S05"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C2H8"
FT                   /experiment="EXISTENCE:direct assay:GO:0002181 cytoplasmic
FT                   translation [PMID:18782943]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003735 structural
FT                   constituent of ribosome [PMID:18782943]"
FT                   /experiment="EXISTENCE:direct assay:GO:0022625 cytosolic
FT                   large ribosomal subunit [PMID:18782943]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006450
FT                   regulation of translational fidelity [PMID:18829863]"
FT                   /protein_id="DAA11784.1"
FT                   /translation="MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMG
FT                   TDDVRLAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKGL
FT                   QTVVVEEDA"
FT   gene            complement(323217..323471)
FT                   /locus_tag="snR63"
FT   ncRNA           complement(323217..323471)
FT                   /locus_tag="snR63"
FT                   /product="SNR63"
FT                   /note="C/D box small nucleolar RNA (snoRNA); guides
FT                   2'-O-methylation of large subunit (LSU) rRNA at position
FT                   A2256"
FT                   /experiment="EXISTENCE:curator inference:GO:0005730
FT                   nucleolus [PMID:10024243]"
FT                   /experiment="EXISTENCE:curator inference:GO:0031428 box C/D
FT                   snoRNP complex [PMID:10024243]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030562 rRNA
FT                   2'-O-ribose methylation guide activity [PMID:10024243]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031167 rRNA
FT                   methylation [PMID:10024243]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0031428 box
FT                   C/D snoRNP complex [PMID:11081632]"
FT                   /ncRNA_class="snoRNA"
FT   gene            complement(324047..326149)
FT                   /gene="BRE1"
FT                   /locus_tag="YDL074C"
FT   mRNA            complement(324047..326149)
FT                   /gene="BRE1"
FT                   /locus_tag="YDL074C"
FT                   /product="E3 ubiquitin-protein ligase BRE1"
FT   CDS_pept        complement(324047..326149)
FT                   /codon_start=1
FT                   /gene="BRE1"
FT                   /locus_tag="YDL074C"
FT                   /product="E3 ubiquitin-protein ligase BRE1"
FT                   /EC_number="2.3.2.27"
FT                   /note="E3 ubiquitin ligase; forms heterodimer with Rad6p to
FT                   regulate K63 polyubiquitination in response to oxidative
FT                   stress and to monoubiquinate histone H2B-K123, which is
FT                   required for the subsequent methylation of histone H3-K4
FT                   and H3-K79; required for DSBR, transcription, silencing,
FT                   and checkpoint control; interacts with RNA-binding protein
FT                   Npl3p, linking histone ubiquitination to mRNA processing;
FT                   Bre1p-dependent histone ubiquitination promotes pre-mRNA
FT                   splicing"
FT                   /db_xref="GOA:Q07457"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR013956"
FT                   /db_xref="PDB:4R7E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07457"
FT                   /experiment="EXISTENCE:direct assay:GO:0000790 nuclear
FT                   chromatin [PMID:12876294]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003688 DNA
FT                   replication origin binding [PMID:23103252]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004842
FT                   ubiquitin-protein transferase activity [PMID:19531475]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000722
FT                   telomere maintenance via recombination [PMID:23390378]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000724
FT                   double-strand break repair via homologous recombination
FT                   [PMID:16783014]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006366
FT                   transcription by RNA polymerase II [PMID:15632065]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004842
FT                   ubiquitin-protein transferase activity [PMID:19531475]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006348
FT                   chromatin silencing at telomere [PMID:12535539]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0010390 histone
FT                   monoubiquitination [PMID:12535538|PMID:12535539]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016574 histone
FT                   ubiquitination [PMID:23103252]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030174
FT                   regulation of DNA-dependent DNA replication initiation
FT                   [PMID:23103252]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031571 mitotic
FT                   G1 DNA damage checkpoint [PMID:16166626|PMID:16783014]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031573 intra-S
FT                   DNA damage checkpoint [PMID:15632126]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0042138 meiotic
FT                   DNA double-strand break formation [PMID:15280549]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0070534 protein
FT                   K63-linked ubiquitination [PMID:25622294]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0006366
FT                   transcription by RNA polymerase II [PMID:19531475]"
FT                   /protein_id="DAA11785.1"
FT                   /translation="MTAEPATKKIKLELSDPSEPLTQSDVIAFQKEALFRCINRRRVDF
FT                   EALRKQYELSRRECIDVSRKLANIMALIVTLARFIETFCTDANEKQLCREIAQGDETLI
FT                   VQRSDSFMKLLTKYGKPNTTDSNTNSNASDHIQELTTELKNLRKSKEELFYENSQLTEE
FT                   ISALKEYYTNIIRKYDRDESFTIKRVFKEDKTDAVKELREDEKESNENNIKSGNKDSSA
FT                   INGDNTSKKSEKGDELVQAEDERKEDAENEKLELDLKFSDLRAEINSLSSTIKDLENIR
FT                   RENEEELIKTRSEVSNLKKQQIAAADQDPDFKSYDHESLLAKIQHLTEQNAELSEINSS
FT                   FLSKFQVLAKEKEIYTKKVREEFQKSLDSLVEMNSSLEKDVVRIRTARDDLLSKIAILE
FT                   AEKSKTEVLSDLQHAIDILKEQWTKIDQRSNDTKSSSTQDALIKEIQDLEKGFRELSDL
FT                   THKKYSEIINHESVISKLTVEKTKADQKYFAAMRSKDSILIEIKTLSKSLSKSNELILQ
FT                   LKDSDRLLQQKIGNLHKQLDLSQNNERRLIDSSKTETLKIIDLNNTSTKLKRSLEKLQE
FT                   ESNKSIADMTHLETKLNDTEIELKHFKQKASHLESKCEKLHDTLFRGNNKNKGSSDEAL
FT                   VEELANFRTLVYCSLCSKNWKNMAIKTCGHVFCENCCKERLAARMRKCPTCNKAFSSND
FT                   LLTVHL"
FT   gene            326613..329567
FT                   /gene="AHK1"
FT                   /locus_tag="YDL073W"
FT   mRNA            326613..329567
FT                   /gene="AHK1"
FT                   /locus_tag="YDL073W"
FT                   /product="Ahk1p"
FT   CDS_pept        326613..329567
FT                   /codon_start=1
FT                   /gene="AHK1"
FT                   /locus_tag="YDL073W"
FT                   /product="Ahk1p"
FT                   /note="Scaffold protein in the HKR1 sub-branch of the
FT                   Hog1p-signaling pathway; physically interacts with the
FT                   cytoplasmic domain of Hkr1p, and with Sho1p, Pbs2p, and
FT                   Ste11p; prevents cross-talk signaling from Hkr1p of the
FT                   osmotic stress MAPK cascade to the Kss1p MAPK cascade;
FT                   non-essential gene"
FT                   /db_xref="GOA:Q07454"
FT                   /db_xref="InterPro:IPR013887"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07454"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0007232
FT                   osmosensory signaling pathway via Sho1 osmosensor
FT                   [PMID:26787842]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0043407
FT                   negative regulation of MAP kinase activity [PMID:26787842]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0005078
FT                   MAP-kinase scaffold activity [PMID:26787842]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0007232
FT                   osmosensory signaling pathway via Sho1 osmosensor
FT                   [PMID:26787842]"
FT                   /protein_id="DAA11786.1"
FT                   /translation="MGPAIHNQLYECGLKTTSQDGFLMDNYETQLFQSLNRFINFINNA
FT                   NQSASNKEQNTKFCKSSSNFLRLKLLTVLRQWCDSSRSNCTLEVRDVLTQWWVTLLNFL
FT                   NSDTSLQIDTALELSLSIELTSVCLECLSKIMTILIILPFHSSRDMEIYSHHLLLTIHC
FT                   ITNKLILISKNSKKLKRTNSDDKCSINDKKLQYLNKYSSLLRAFIGKLNAYAFFYLPED
FT                   FHFDTILLLTVSPQISSSIQTSLFSWKKRQYKFTDDQGQMIRTEAFENKDTKFFKIIVS
FT                   YIKNDFVLMSFYWHYWYIILQFMKFSDSDVGIKKSTLSCIPGSEILLTHVTTRFLNSDL
FT                   NKFTRIIKQTPNPRIANENVTESHPNFKSLNSSNALITSERINDYVFSNFKTIKLWECL
FT                   RSLSGCILKENHPEYLENMLSLHESLLIDYVSTISAYDYIAANVIYNKVLQFIIFQFES
FT                   LPSLKFIQWRSWYNGLLSMLRTKNVNCQTVSLLCLFNIWKHVTIEDRDEIVKVLLSDFW
FT                   ESLIFENEFPLIRILFMKVLVFKIIPSVQNSSSLRFLPHDRIKQLYEELLVNKEELFEM
FT                   QKHDSNDIVAHRKNALVFNGNSRLMMIPKKPNTEDHLVYKINHDKNLTTERFPSVSSVA
FT                   NTRPNVILKNGKYAYDILDEMTSKAAFLLAEKKTRLNPKKNHKIMDGYEGGQENEDNDE
FT                   DSEDSGSHKNKRKEGNSSLSATLNTWLSKFSSTSEDSQKKKEQANELGNDFEYDEDVAD
FT                   FAEILPKQSSSNIEKIFKHGNNSGSMVSYNSSIKLNRRENILIGPPELRFSNEIKEHNS
FT                   IATIFKLVFIQTNRRVVEKIDLANMKWGTIHGGSKYMKPLPVPKDLVASVAKNESETRN
FT                   LATLCGNGLDFEIPVPDFNIFGKCMEDEQDVAKIGNQNVEDLKVTGGREVTIWKQIQDM
FT                   KLRTRIQKICVLIETFNATVREYFEFSNRLEHDGIFIDFEVRKPSSNNSINIKV"
FT   rep_origin      329566..329814
FT                   /note="ARS413; Autonomously Replicating Sequence"
FT   gene            complement(329836..330447)
FT                   /gene="YET3"
FT                   /locus_tag="YDL072C"
FT   mRNA            complement(329836..330447)
FT                   /gene="YET3"
FT                   /locus_tag="YDL072C"
FT                   /product="Yet3p"
FT   CDS_pept        complement(329836..330447)
FT                   /codon_start=1
FT                   /gene="YET3"
FT                   /locus_tag="YDL072C"
FT                   /product="Yet3p"
FT                   /note="hypothetical protein; YET3 null mutant decreases the
FT                   level of secreted invertase; homolog of human BAP31
FT                   protein; protein abundance increases in response to DNA
FT                   replication stress"
FT                   /db_xref="GOA:Q07451"
FT                   /db_xref="InterPro:IPR008417"
FT                   /db_xref="InterPro:IPR040463"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07451"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:20378542|PMID:11914276|PMID:26928762]"
FT                   /protein_id="DAA11787.1"
FT                   /translation="MSLYYTLVFAILVVEIFMFSILALPIPSRYRRPLTLLLLKPFKSS
FT                   TVQVAIKCVLGFILLLFIDCINRVYSIDKELQLSSASQNNGAIIAQDRIEVLSRKFFAQ
FT                   RNMYLTGITLFLTFVVVRTFGLVIELLTMKDIYRASPPVASSDVKKNDSVTAEAAAQSG
FT                   ASKDDHGDEKNFELLKKIQDIDDEIARLKEKSESLQEEIN"
FT   gene            331024..332940
FT                   /gene="BDF2"
FT                   /locus_tag="YDL070W"
FT   mRNA            331024..332940
FT                   /gene="BDF2"
FT                   /locus_tag="YDL070W"
FT                   /product="Bdf2p"
FT   CDS_pept        331024..332940
FT                   /codon_start=1
FT                   /gene="BDF2"
FT                   /locus_tag="YDL070W"
FT                   /product="Bdf2p"
FT                   /note="Protein involved in transcription initiation; acts
FT                   at TATA-containing promoters; associates with the basal
FT                   transcription factor TFIID; contains two bromodomains;
FT                   corresponds to the C-terminal region of mammalian TAF1;
FT                   redundant with Bdf1p; protein abundance increases in
FT                   response to DNA replication stress; BDF2 has a paralog,
FT                   BDF1, that arose from the whole genome duplication"
FT                   /db_xref="GOA:Q07442"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR027353"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR038336"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07442"
FT                   /experiment="EXISTENCE:curator inference:GO:0005634 nucleus
FT                   [PMID:16239142]"
FT                   /experiment="EXISTENCE:direct assay:GO:0001047 core
FT                   promoter binding [PMID:17526728]"
FT                   /experiment="EXISTENCE:direct assay:GO:0042393 histone
FT                   binding [PMID:12620224]"
FT                   /experiment="EXISTENCE:direct assay:GO:0070577
FT                   lysine-acetylated histone binding [PMID:20126658]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0031452
FT                   negative regulation of heterochromatin assembly
FT                   [PMID:16239142]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031452 negative
FT                   regulation of heterochromatin assembly [PMID:16239142]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0001094
FT                   TFIID-class transcription factor complex binding
FT                   [PMID:10783167]"
FT                   /protein_id="DAA11788.1"
FT                   /translation="MSRTNMDTRHAHSALLAAPQSATANSRSSNSSSESSSNKNNINVG
FT                   VGDDSGNVSAVSIDDGPHFRDIFHYGHEENYKLASSGITNLNSSSHAHQTLSPISISNA
FT                   STPESFPEHPLGLERETEPALEAEMEAEELPPHQSKYLLSSIKATKRLKDARPFLKPVD
FT                   PIALNIPHYFNYVQTPMDLSLIETKLQGNVYHSVEQVTSDFKTMVDNCLNFNGPESSIS
FT                   SMAKRIQKYFEKKLSAMPPRVLPASALKKTSRNRKKNEDMDSPLVIRRSVSTTNDNIGE
FT                   SGNREGVSGGRPKRTIHPPKSKDLFDIYENSKPKSKTLQKKFRTCLKILKVLMSKKNSD
FT                   INFPFLQPVDPIALNLPNYFDVVKNPMDLGTISNNLMNWKYKTIDQFVDDLNLVFYNCF
FT                   QFNPEGNEVHSMGKKLKELFNFHWLENQDILNEIETDSDLEEDNYSSSYSSDDEYDDED
FT                   INENDITNPAIQYLEQKLKKMEVELQQLKRQELSKLSKERKRKHLGKTLLRRKAMKHSV
FT                   DDLKKSITDKINELSDLEMNGMIRIIKNSLPADEILTSNEDEIEIDLDILDEATIARIY
FT                   ERYFEKKNNNNSKRKLSGNYSTAPTNKKKKTLKFLEKDEIINNNNYSDSEEDSSDSSDS
FT                   DSD"
FT   gene            complement(333121..333810)
FT                   /gene="CBS1"
FT                   /locus_tag="YDL069C"
FT   mRNA            complement(333121..333810)
FT                   /gene="CBS1"
FT                   /locus_tag="YDL069C"
FT                   /product="Cbs1p"
FT   CDS_pept        complement(333121..333810)
FT                   /codon_start=1
FT                   /gene="CBS1"
FT                   /locus_tag="YDL069C"
FT                   /product="Cbs1p"
FT                   /note="Mitochondrial translational activator of the COB
FT                   mRNA; membrane protein that interacts with translating
FT                   ribosomes, acts on the COB mRNA 5'-untranslated leader"
FT                   /db_xref="GOA:P14066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14066"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031314 extrinsic
FT                   component of mitochondrial inner membrane [PMID:10669873]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034551
FT                   mitochondrial respiratory chain complex III assembly
FT                   [PMID:3033440]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045182
FT                   translation regulator activity [PMID:3033440]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0070131 positive
FT                   regulation of mitochondrial translation [PMID:3033440]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0005761
FT                   mitochondrial ribosome [PMID:15927884]"
FT                   /protein_id="DAA11789.1"
FT                   /translation="MLRTKVFATTVARISGIRRYIPIRTINTVTKKNISKIEKLCEVLE
FT                   VNPDGYKGKERIPTKELTKLLYTTSRNMLVRVPMTGDLSTGNTFETRNETLQKLGEQLI
FT                   HLEINKMLTITFTNFNQFNIMNKNFNYIHNLDRARVVNMDSISWLIKNSLKINQLAHLR
FT                   IPANLPKEMGLTSSSNDFQNLNDWKVILSFIGYLKLLEIKNDNKKFIESIIKTICIPLI
FT                   NYHLRKS"
FT   gene            complement(334217..334396)
FT                   /gene="COX9"
FT                   /locus_tag="YDL067C"
FT   mRNA            complement(334217..334396)
FT                   /gene="COX9"
FT                   /locus_tag="YDL067C"
FT                   /product="cytochrome c oxidase subunit VIIa"
FT   CDS_pept        complement(334217..334396)
FT                   /codon_start=1
FT                   /gene="COX9"
FT                   /locus_tag="YDL067C"
FT                   /product="cytochrome c oxidase subunit VIIa"
FT                   /EC_number="1.9.3.1"
FT                   /note="Subunit VIIa of cytochrome c oxidase (Complex IV);
FT                   Complex IV is the terminal member of the mitochondrial
FT                   inner membrane electron transport chain"
FT                   /db_xref="GOA:P07255"
FT                   /db_xref="InterPro:IPR014368"
FT                   /db_xref="PDB:6GIQ"
FT                   /db_xref="PDB:6HU9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07255"
FT                   /experiment="EXISTENCE:direct assay:GO:0004129 cytochrome-c
FT                   oxidase activity [PMID:1331058|PMID:7851399]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005751
FT                   mitochondrial respiratory chain complex IV [PMID:1331058]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006123
FT                   mitochondrial electron transport, cytochrome c to oxygen
FT                   [PMID:1331058]"
FT                   /protein_id="DAA11790.1"
FT                   /translation="MTIAPITGTIKRRVIMDIVLGFSLGGVMASYWWWGFHMDKINKRE
FT                   KFYAELAERKKQEN"
FT   gene            334835..336121
FT                   /gene="IDP1"
FT                   /locus_tag="YDL066W"
FT   mRNA            334835..336121
FT                   /gene="IDP1"
FT                   /locus_tag="YDL066W"
FT                   /product="isocitrate dehydrogenase (NADP(+)) IDP1"
FT   CDS_pept        334835..336121
FT                   /codon_start=1
FT                   /gene="IDP1"
FT                   /locus_tag="YDL066W"
FT                   /product="isocitrate dehydrogenase (NADP(+)) IDP1"
FT                   /EC_number="1.1.1.42"
FT                   /note="Mitochondrial NADP-specific isocitrate
FT                   dehydrogenase; catalyzes the oxidation of isocitrate to
FT                   alpha-ketoglutarate; not required for mitochondrial
FT                   respiration and may function to divert alpha-ketoglutarate
FT                   to biosynthetic processes"
FT                   /db_xref="GOA:P21954"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="PDB:2QFV"
FT                   /db_xref="PDB:2QFW"
FT                   /db_xref="PDB:2QFX"
FT                   /db_xref="PDB:2QFY"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21954"
FT                   /experiment="EXISTENCE:direct assay:GO:0004450 isocitrate
FT                   dehydrogenase (NADP+) activity [PMID:15574419]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion
FT                   [PMID:15001388|PMID:14576278|PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0042645
FT                   mitochondrial nucleoid [PMID:15692048]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006537
FT                   glutamate biosynthetic process [PMID:15574419]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004450
FT                   isocitrate dehydrogenase (NADP+) activity [PMID:8099357]"
FT                   /protein_id="DAA11791.1"
FT                   /translation="MSMLSRRLFSTSRLAAFSKIKVKQPVVELDGDEMTRIIWDKIKKK
FT                   LILPYLDVDLKYYDLSVESRDATSDKITQDAAEAIKKYGVGIKCATITPDEARVKEFNL
FT                   HKMWKSPNGTIRNILGGTVFREPIVIPRIPRLVPRWEKPIIIGRHAHGDQYKATDTLIP
FT                   GPGSLELVYKPSDPTTAQPQTLKVYDYKGSGVAMAMYNTDESIEGFAHSSFKLAIDKKL
FT                   NLFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKGG
FT                   FIMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRKYQKGE
FT                   ETSTNSIASIFAWSRGLLKRGELDNTPALCKFANILESATLNTVQQDGIMTKDLALACG
FT                   NNERSAYVTTEEFLDAVEKRLQKEIKSIE"
FT   gene            complement(336249..337277)
FT                   /gene="PEX19"
FT                   /gene_synonym="PAS12"
FT                   /locus_tag="YDL065C"
FT   mRNA            complement(336249..337277)
FT                   /gene="PEX19"
FT                   /gene_synonym="PAS12"
FT                   /locus_tag="YDL065C"
FT                   /product="Pex19p"
FT   CDS_pept        complement(336249..337277)
FT                   /codon_start=1
FT                   /gene="PEX19"
FT                   /gene_synonym="PAS12"
FT                   /locus_tag="YDL065C"
FT                   /product="Pex19p"
FT                   /note="Chaperone and import receptor for newly-synthesized
FT                   class I PMPs; binds peroxisomal membrane proteins (PMPs) in
FT                   the cytoplasm and delivers them to the peroxisome for
FT                   subsequent insertion into the peroxisomal membrane;
FT                   interacts with Myo2p and contributes to peroxisome
FT                   partitioning"
FT                   /db_xref="GOA:Q07418"
FT                   /db_xref="InterPro:IPR006708"
FT                   /db_xref="InterPro:IPR038322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07418"
FT                   /experiment="EXISTENCE:direct assay:GO:0005778 peroxisomal
FT                   membrane [PMID:9418908]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:16009135]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:9418908|PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:1990415
FT                   Pex17p-Pex14p docking complex [PMID:16679311]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0032527 protein
FT                   exit from endoplasmic reticulum [PMID:16009135]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0032581
FT                   ER-dependent peroxisome organization [PMID:20427571]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045046 protein
FT                   import into peroxisome membrane [PMID:10637226]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0005515
FT                   protein binding [PMID:16679311|PMID:9418908]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0033328
FT                   peroxisome membrane targeting sequence binding
FT                   [PMID:16679311]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0045033
FT                   peroxisome inheritance [PMID:22486971]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0050821
FT                   protein stabilization [PMID:16679311]"
FT                   /protein_id="DAA11792.1"
FT                   /translation="MNENEYDNFDDLDDLLDEDPTKLDEAEPDDVQAKGSVYNDSENKE
FT                   KNAESKDSDGVQVANESEEDPELKEMMVDLQNEFANLMKNNGNENNVKTEDFNKLISAL
FT                   EEAAKVPHQQMEQGCSSLKSNSTDKGTVNGSNPGFKNIVSNTLDRLKENGNKVDTSLAE
FT                   ETKESQRSGQNNNIDDILSQLLDQMVASGGKESAENQFDLKDGEMDDAITKILDQMTSK
FT                   EVLYEPMKEMRSEFGVWFQENGENEEHKEKIGTYKRQFNIVDEIVNIYELKDYDELKHK
FT                   DRVTELLDELEQLGDSPIRSANSPLKHGNEEEELMKMLEIDGNDPNLGNLDKELTDGCK
FT                   QQ"
FT   gene            337487..338070
FT                   /gene="UBC9"
FT                   /locus_tag="YDL064W"
FT   mRNA            join(337487..337524,337635..338070)
FT                   /gene="UBC9"
FT                   /locus_tag="YDL064W"
FT                   /product="E2 SUMO-conjugating protein UBC9"
FT   CDS_pept        join(337487..337524,337635..338070)
FT                   /codon_start=1
FT                   /gene="UBC9"
FT                   /locus_tag="YDL064W"
FT                   /product="E2 SUMO-conjugating protein UBC9"
FT                   /note="SUMO-conjugating enzyme involved in the Smt3p
FT                   conjugation pathway; nuclear protein required for S- and
FT                   M-phase cyclin degradation and mitotic control; involved in
FT                   proteolysis mediated by the anaphase-promoting complex
FT                   cyclosome (APCC)"
FT                   /db_xref="GOA:P50623"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="InterPro:IPR027230"
FT                   /db_xref="PDB:2EKE"
FT                   /db_xref="PDB:2GJD"
FT                   /db_xref="PDB:3ONG"
FT                   /db_xref="PDB:5JNE"
FT                   /db_xref="PDB:6Q83"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50623"
FT                   /experiment="EXISTENCE:direct assay:GO:0000794 condensed
FT                   nuclear chromosome [PMID:16782016]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:7800043]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016925 protein
FT                   sumoylation [PMID:9341106|PMID:9435231]"
FT                   /experiment="EXISTENCE:direct assay:GO:0019789 SUMO
FT                   transferase activity [PMID:9341106|PMID:9435231]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000022 mitotic
FT                   spindle elongation [PMID:7800043]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016925 protein
FT                   sumoylation [PMID:9341106|PMID:9435231]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0019789 SUMO
FT                   transferase activity [PMID:9435231]"
FT                   /protein_id="DAA11793.1"
FT                   /translation="MSSLCLQRLQEERKKWRKDHPFGFYAKPVKKADGSMDLQKWEAGI
FT                   PGKEGTNWAGGVYPITVEYPNEYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQDWR
FT                   PAITLKQIVLGVQDLLDSPNPNSPAQEPAWRSFSRNKAEYDKKVLLQAKQYSK"
FT   gene            complement(338272..340134)
FT                   /gene="SYO1"
FT                   /locus_tag="YDL063C"
FT   mRNA            complement(338272..340134)
FT                   /gene="SYO1"
FT                   /locus_tag="YDL063C"
FT                   /product="Syo1p"
FT   CDS_pept        complement(338272..340134)
FT                   /codon_start=1
FT                   /gene="SYO1"
FT                   /locus_tag="YDL063C"
FT                   /product="Syo1p"
FT                   /note="Transport adaptor or symportin; facilitates
FT                   synchronized nuclear coimport of the two 5S-rRNA binding
FT                   proteins Rpl5p and Rpl11p; binds to nascent Rpl5p during
FT                   translation; required for biogenesis of the large ribosomal
FT                   subunit; green fluorescent protein (GFP)-fusion protein
FT                   localizes to the cytoplasm and nucleus"
FT                   /db_xref="GOA:Q07395"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07395"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051082 unfolded
FT                   protein binding [PMID:26112308]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006606
FT                   protein import into nucleus [PMID:23118189]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0042273
FT                   ribosomal large subunit biogenesis [PMID:19806183]"
FT                   /protein_id="DAA11794.1"
FT                   /translation="MGRSKKRSRASSSRLNPLRKAGSNDNNKDTNVVNKKLQPLLQNLS
FT                   SVVPNDRSIALSSISVLCEDAHMRQLLLKEKLVPIILNKLLNDSNSDIVVESFGLLRNL
FT                   SLEEGYDVSIYLWRSDIWTSITSNFGRIVESLSALQAAEQQPQLKPAGKSKIESKRLLF
FT                   DFADNLLSLVVALSNGSDDILNEILTESKINEIFQVISQLLKYGVEKLPINLFNTTLDL
FT                   IYDLSSESFEFIDHVSNNELLSQFLNGLSPALHPQANELTKVLIEGIHCQFLDMKITYD
FT                   QCNKMIHSVCHSINNIDPVQLVNDINNPVEIGPATSKDESSKVITKIKDYNAKRNESMI
FT                   KLQSIEIAIDLITAIIEIVASKYESPESQEVAIPEELINTLTNFLPHVFMILKDTFTSR
FT                   ILIGWNNLIWLFVSLSLTELSGELLTTLWSYVTQLDSQDDLSIKIGRMGCIWALLKLIF
FT                   PDGAFESENRALINVQMLNNSGFARGIIEEFQNNNDLELQQKCINVLSTYAMIQGQIDA
FT                   NKEIGQFFIQTLTQLNVRPEILIEMTNSLFQIYGDASYDYNEPIFVRGGFLSILKDQVV
FT                   PNLRQQFKMVDKNKNPELKERCHDCFTTLDSFIHYKMNENSTNQ"
FT   gene            complement(340628..340798)
FT                   /gene="RPS29B"
FT                   /locus_tag="YDL061C"
FT   mRNA            complement(340628..340798)
FT                   /gene="RPS29B"
FT                   /locus_tag="YDL061C"
FT                   /product="ribosomal 40S subunit protein S29B"
FT   CDS_pept        complement(340628..340798)
FT                   /codon_start=1
FT                   /gene="RPS29B"
FT                   /locus_tag="YDL061C"
FT                   /product="ribosomal 40S subunit protein S29B"
FT                   /note="Protein component of the small (40S) ribosomal
FT                   subunit; homologous to mammalian ribosomal protein S29 and
FT                   bacterial S14; RPS29B has a paralog, RPS29A, that arose
FT                   from the whole genome duplication"
FT                   /db_xref="GOA:P41058"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR039744"
FT                   /db_xref="PDB:1K5X"
FT                   /db_xref="PDB:4V4B"
FT                   /db_xref="PDB:4V92"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41058"
FT                   /experiment="EXISTENCE:curator inference:GO:0002181
FT                   cytoplasmic translation [PMID:18782943|PMID:6814480]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003735 structural
FT                   constituent of ribosome [PMID:18782943|PMID:6814480]"
FT                   /experiment="EXISTENCE:direct assay:GO:0022627 cytosolic
FT                   small ribosomal subunit [PMID:18782943|PMID:6814480]"
FT                   /protein_id="DAA11795.1"
FT                   /translation="MAHENVWFSHPRRFGKGSRQCRVCSSHTGLVRKYDLNICRQCFRE
FT                   KANDIGFHKYR"
FT   gene            341619..343985
FT                   /gene="TSR1"
FT                   /locus_tag="YDL060W"
FT   mRNA            341619..343985
FT                   /gene="TSR1"
FT                   /locus_tag="YDL060W"
FT                   /product="Tsr1p"
FT   CDS_pept        341619..343985
FT                   /codon_start=1
FT                   /gene="TSR1"
FT                   /locus_tag="YDL060W"
FT                   /product="Tsr1p"
FT                   /note="Protein required for processing of 20S pre-rRNA in
FT                   the cytoplasm; associates with pre-40S ribosomal particles;
FT                   inhibits the premature association of 60S subunits with
FT                   assembling 40S subunits in the cytoplasm; similar to Bms1p;
FT                   relocalizes from nucleus to cytoplasm upon DNA replication
FT                   stress"
FT                   /db_xref="GOA:Q07381"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="InterPro:IPR030387"
FT                   /db_xref="InterPro:IPR039761"
FT                   /db_xref="PDB:5IW7"
FT                   /db_xref="PDB:5WWN"
FT                   /db_xref="PDB:6EML"
FT                   /db_xref="PDB:6FAI"
FT                   /db_xref="PDB:6RBD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07381"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005730 nucleolus
FT                   [PMID:11565749]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:15167894|PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030686 90S
FT                   preribosome [PMID:12150911]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030688 preribosome,
FT                   small subunit precursor [PMID:15167894]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043021
FT                   ribonucleoprotein complex binding [PMID:15167894]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000461
FT                   endonucleolytic cleavage to generate mature 3'-end of
FT                   SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
FT                   [PMID:11565749]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000462
FT                   maturation of SSU-rRNA from tricistronic rRNA transcript
FT                   (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
FT                   [PMID:15167894|PMID:12089522]"
FT                   /protein_id="DAA11796.1"
FT                   /translation="MAGHSHRSSLKNGHKSYKSKHASKGALKRLYKGKVEKEPVGTGKP
FT                   DKQVSKLQRKNKAKQLRAQRILDSIENRKLFEGKNGAAKIITIVPLVNDLDPLDILYKL
FT                   LKCADDEGIMVQEVDSKRIFNVHIKKFKSNLKIIIPDMTNFLNILDCAKVADFVVFGLS
FT                   GVQEVDEEFGEQIIRALELQGIASYIGVISNLSAVHEKEKFQLDVKQSLESYFKHFFPS
FT                   EERVYNLEKNSDALNVLRTLCQRLPRSINWRDNRGYVVADFVDFVETSPDSGDLVIEGT
FT                   VRGIGFNANRLVHIPDFGDFQLNKIEKISESSQKRKIIKEKATDSLSLELDLQTVFESN
FT                   MNRDTLDEYAPEGTEDWSDYDEDFEYDGLTTARYDDHGFLPGREQTSKKAAVPKGTSDY
FT                   QAKWYLDDVIDANEEEEAEQTNGKDETMMEIDDEMMVEQDNEEVAGDEEYDIEDNEGFE
FT                   ELSPEEEERQLREFRDMEKEDREFPDEIELEPSESAIERLKRYRGLKNLYNCDWQVDEK
FT                   DPSSPAEWKRLLRIGNYKNTKNRIIKETKNEAQAIAGDRIRMFIRFPKFLLEKIQDPKQ
FT                   LLFAVYGLLLHEHKNAVVNFSLQRWEQYDKPVPSQEPIVVQYGVRRYTIQPLFSQGSNS
FT                   PNNVHKYERFLHPDTVSVATCIAPVDFTQSPAIFFKPSPTDAKNIELIGHGTFLNADHS
FT                   RILAKRAILTGHPFRFHKTVVTVRYMFFRPEDVEWFKSIPLFTKSGRSGFIKESLGTHG
FT                   YFKATFDGKLSAQDVVAMSLYKRMWPMPSLPWNGM"
FT   gene            complement(344237..344953)
FT                   /gene="RAD59"
FT                   /locus_tag="YDL059C"
FT   mRNA            complement(344237..344953)
FT                   /gene="RAD59"
FT                   /locus_tag="YDL059C"
FT                   /product="Rad59p"
FT   CDS_pept        complement(344237..344953)
FT                   /codon_start=1
FT                   /gene="RAD59"
FT                   /locus_tag="YDL059C"
FT                   /product="Rad59p"
FT                   /note="Protein involved DNA double-strand break repair;
FT                   repairs breaks in DNA during vegetative growth via
FT                   recombination and single-strand annealing; anneals
FT                   complementary single-stranded DNA; forms nuclear foci upon
FT                   DNA replication stress; required for loading of Rad52p to
FT                   DSBs; regulates replication fork progression in DNA ligase
FT                   I-deficient cells; paralog of Rad52p"
FT                   /db_xref="GOA:Q12223"
FT                   /db_xref="InterPro:IPR007232"
FT                   /db_xref="InterPro:IPR016810"
FT                   /db_xref="InterPro:IPR041247"
FT                   /db_xref="InterPro:IPR042525"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12223"
FT                   /experiment="EXISTENCE:direct assay:GO:0000733 DNA strand
FT                   renaturation [PMID:10567339]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005759
FT                   mitochondrial matrix [PMID:26540255]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0005634
FT                   nucleus [PMID:12368472]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0045002
FT                   double-strand break repair via single-strand annealing
FT                   [PMID:11606529]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:2000278
FT                   regulation of DNA biosynthetic process [PMID:23824283]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000722 telomere
FT                   maintenance via recombination [PMID:11238918]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006277 DNA
FT                   amplification [PMID:23271978]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043504
FT                   mitochondrial DNA repair [PMID:26540255]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0005515
FT                   protein binding [PMID:10655498]"
FT                   /protein_id="DAA11797.1"
FT                   /translation="MTIQAKPSSSISYDSTTYGTAPGLDIKEFQIIEDWNGRPASAWSV
FT                   QRIGLLQSKIERYTYNIYHNNKYGKHNLSKLIPGHALIQFANETFGYDGWRMDVIDVEA
FT                   RECQPFTAVNNGENTNTSEVKYTVVAEAQVKVTLKDGTNTQCGGLGRITLSSRGECYNR
FT                   SKKEAVGDALKKALLSFEKIILDYETKITNNYYVDGLYGSKKIKNEANTNYNLLSATNS
FT                   KPTFIKLEDAKGTHIK"
FT   gene            345665..351037
FT                   /gene="USO1"
FT                   /gene_synonym="INT1"
FT                   /locus_tag="YDL058W"
FT   mRNA            345665..351037
FT                   /gene="USO1"
FT                   /gene_synonym="INT1"
FT                   /locus_tag="YDL058W"
FT                   /product="Uso1p"
FT   CDS_pept        345665..351037
FT                   /codon_start=1
FT                   /gene="USO1"
FT                   /gene_synonym="INT1"
FT                   /locus_tag="YDL058W"
FT                   /product="Uso1p"
FT                   /note="Essential protein involved in vesicle-mediated ER to
FT                   Golgi transport; binds membranes and functions during
FT                   vesicle docking to the Golgi; required for assembly of the
FT                   ER-to-Golgi SNARE complex"
FT                   /db_xref="GOA:P25386"
FT                   /db_xref="InterPro:IPR006953"
FT                   /db_xref="InterPro:IPR006955"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25386"
FT                   /experiment="EXISTENCE:direct assay:GO:0000139 Golgi
FT                   membrane [PMID:17192843]"
FT                   /experiment="EXISTENCE:direct assay:GO:0012507 ER to Golgi
FT                   transport vesicle membrane [PMID:17192843]"
FT                   /experiment="EXISTENCE:direct assay:GO:0048211 Golgi
FT                   vesicle docking [PMID:9545229]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006888
FT                   endoplasmic reticulum to Golgi vesicle-mediated transport
FT                   [PMID:8603910]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0035493 SNARE
FT                   complex assembly [PMID:8603910]"
FT                   /protein_id="DAA11798.1"
FT                   /translation="MDIIQGLIQQPKIQSVDETIPTLCDRVENSTLISDRRSAVLGLKA
FT                   FSRQYRESVIASGLKPLLNTLKRDYMDEDSVKAILETILILFIRGDGHDDLTRGWISQQ
FT                   SRLQNGKYPSPLVMKQEKEQVDQFSLWIADALTQSEDLIHLLVEFWEIDNFHIRLYTIQ
FT                   LLEAVMATRPLKARSALISLPTSISTMVSLLDDMHEPIRDEAILLLMAVVNDSPHVQKL
FT                   VAFENIFERLFSIIEEEGGLRGSLVVNDCLSLINNILKYNTSNQTLFLETGNLPKLAHL
FT                   LSEPISQDEVFFWNDQRIVNINTALDIVSLTVEPGNTVTTKHQNALLDSSVLMVVLRLA
FT                   FFHNIPKKVRPVALLTAANMVRSNEHAQLEFSKIDVPYFDPSLPVNSTANGGPIKLIPV
FT                   VSILINWMLYANSVHTFDTRVACSRLLKAYFMDNFDLQRDFLLKQVQLCNNSTNNVGDN
FT                   AKENGGSNKSDKESDSDKDTDGKDGTEYEGSFKANLFEVLLNYDAELNLNPFKLFFTTD
FT                   IFMFFFQQDHKYSEELREITRNVTTGNDLEDEEPLKAIQTISELLTTSLTAADIRIPIS
FT                   YLTFLIYWLFGDFKATNDFLSDKSVIKSLLSFSYQIQDEDVTIKCLVTMLLGVAYEFSS
FT                   KESPFPRKEYFEFITKTLGKDNYASRIKQFKKDSYFSKVDMNEDSILTPELDETGLPKV
FT                   YFSTYFIQLFNENIYRIRTALSHDPDEEPINKISFEEVEKLQRQCTKLKGEITSLQTET
FT                   ESTHENLTEKLIALTNEHKELDEKYQILNSSHSSLKENFSILETELKNVRDSLDEMTQL
FT                   RDVLETKDKENQTALLEYKSTIHKQEDSIKTLEKGLETILSQKKKAEDGINKMGKDLFA
FT                   LSREMQAVEENCKNLQKEKDKSNVNHQKETKSLKEDIAAKITEIKAINENLEEMKIQCN
FT                   NLSKEKEHISKELVEYKSRFQSHDNLVAKLTEKLKSLANNYKDMQAENESLIKAVEESK
FT                   NESSIQLSNLQNKIDSMSQEKENFQIERGSIEKNIEQLKKTISDLEQTKEEIISKSDSS
FT                   KDEYESQISLLKEKLETATTANDENVNKISELTKTREELEAELAAYKNLKNELETKLET
FT                   SEKALKEVKENEEHLKEEKIQLEKEATETKQQLNSLRANLESLEKEHEDLAAQLKKYEE
FT                   QIANKERQYNEEISQLNDEITSTQQENESIKKKNDELEGEVKAMKSTSEEQSNLKKSEI
FT                   DALNLQIKELKKKNETNEASLLESIKSVESETVKIKELQDECNFKEKEVSELEDKLKAS
FT                   EDKNSKYLELQKESEKIKEELDAKTTELKIQLEKITNLSKAKEKSESELSRLKKTSSEE
FT                   RKNAEEQLEKLKNEIQIKNQAFEKERKLLNEGSSTITQEYSEKINTLEDELIRLQNENE
FT                   LKAKEIDNTRSELEKVSLSNDELLEEKQNTIKSLQDEILSYKDKITRNDEKLLSIERDN
FT                   KRDLESLKEQLRAAQESKAKVEEGLKKLEEESSKEKAELEKSKEMMKKLESTIESNETE
FT                   LKSSMETIRKSDEKLEQSKKSAEEDIKNLQHEKSDLISRINESEKDIEELKSKLRIEAK
FT                   SGSELETVKQELNNAQEKIRINAEENTVLKSKLEDIERELKDKQAEIKSNQEEKELLTS
FT                   RLKELEQELDSTQQKAQKSEEERRAEVRKFQVEKSQLDEKAMLLETKYNDLVNKEQAWK
FT                   RDEDTVKKTTDSQRQEIEKLAKELDNLKAENSKLKEANEDRSEIDDLMLLVTDLDEKNA
FT                   KYRSKLKDLGVEISSDEEDDEEDDEEDEEEGQVA"
FT   gene            351434..352420
FT                   /locus_tag="YDL057W"
FT   mRNA            351434..352420
FT                   /locus_tag="YDL057W"
FT                   /product="hypothetical protein"
FT   CDS_pept        351434..352420
FT                   /codon_start=1
FT                   /locus_tag="YDL057W"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; YDL057W is not an essential
FT                   gene"
FT                   /db_xref="GOA:Q07379"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07379"
FT                   /protein_id="DAA11799.1"
FT                   /translation="MEKKHVTVQIQSAPPSYIKLEANEKFVYITSTMNGLSYQIAAIVS
FT                   YPEKRNSSTANKEDGKLLCKENKLALLLHGSQSHKNAIYQTLLAKRLAEFGYWVLRIDF
FT                   RGQGDSSDNCDPGLGRTLAQDLEDLSTVYQTVSDRSLRVQLYKTSTISLDVVVAHSRGS
FT                   LAMFKFCLKLHAAESPLPSHLINCAGRYDGRGLIERCTRLHPHWQAEGGFWANGPRNGE
FT                   YKDFWIPLSETYSIAGVCVPEFATIPQTCSVMSCYGMCDHIVPISAASNYARLFEGRHS
FT                   LKLIENADHNYYGIEGDPNALGLPIRRGRVNYSPLVVDLIMEYLQDT"
FT   gene            352877..355378
FT                   /gene="MBP1"
FT                   /locus_tag="YDL056W"
FT   mRNA            352877..355378
FT                   /gene="MBP1"
FT                   /locus_tag="YDL056W"
FT                   /product="transcription factor MBP1"
FT   CDS_pept        352877..355378
FT                   /codon_start=1
FT                   /gene="MBP1"
FT                   /locus_tag="YDL056W"
FT                   /product="transcription factor MBP1"
FT                   /note="Transcription factor; involved in regulation of cell
FT                   cycle progression from G1 to S phase, forms a complex with
FT                   Swi6p that binds to MluI cell cycle box regulatory element
FT                   in promoters of DNA synthesis genes"
FT                   /db_xref="GOA:P39678"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR029793"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="PDB:1BM8"
FT                   /db_xref="PDB:1L3G"
FT                   /db_xref="PDB:1MB1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39678"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:11914276]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030907 MBF
FT                   transcription complex [PMID:8372350]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043565
FT                   sequence-specific DNA binding [PMID:19158363]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001228
FT                   DNA-binding transcription activator activity, RNA
FT                   polymerase II-specific [PMID:8372350]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0071931 positive
FT                   regulation of transcription involved in G1/S transition of
FT                   mitotic cell cycle [PMID:8372350]"
FT                   /protein_id="DAA11800.1"
FT                   /translation="MSNQIYSARYSGVDVYEFIHSTGSIMKRKKDDWVNATHILKAANF
FT                   AKAKRTRILEKEVLKETHEKVQGGFGKYQGTWVPLNIAKQLAEKFSVYDQLKPLFDFTQ
FT                   TDGSASPPPAPKHHHASKVDRKKAIRSASTSAIMETKRNNKKAEENQFQSSKILGNPTA
FT                   APRKRGRPVGSTRGSRRKLGVNLQRSQSDMGFPRPAIPNSSISTTQLPSIRSTMGPQSP
FT                   TLGILEEERHDSRQQQPQQNNSAQFKEIDLEDGLSSDVEPSQQLQQVFNQNTGFVPQQQ
FT                   SSLIQTQQTESMATSVSSSPSLPTSPGDFADSNPFEERFPGGGTSPIISMIPRYPVTSR
FT                   PQTSDINDKVNKYLSKLVDYFISNEMKSNKSLPQVLLHPPPHSAPYIDAPIDPELHTAF
FT                   HWACSMGNLPIAEALYEAGTSIRSTNSQGQTPLMRSSLFHNSYTRRTFPRIFQLLHETV
FT                   FDIDSQSQTVIHHIVKRKSTTPSAVYYLDVVLSKIKDFSPQYRIELLLNTQDKNGDTAL
FT                   HIASKNGDVVFFNTLVKMGALTTISNKEGLTANEIMNQQYEQMMIQNGTNQHVNSSNTD
FT                   LNIHVNTNNIETKNDVNSMVIMSPVSPSDYITYPSQIATNISRNIPNVVNSMKQMASIY
FT                   NDLHEQHDNEIKSLQKTLKSISKTKIQVSLKTLEVLKESSKDENGEAQTNDDFEILSRL
FT                   QEQNTKKLRKRLIRYKRLIKQKLEYRQTVLLNKLIEDETQATTNNTVEKDNNTLERLEL
FT                   AQELTMLQLQRKNKLSSLVKKFEDNAKIHKYRRIIREGTEMNIEEVDSSLDVILQTLIA
FT                   NNNKNKGAEQIITISNANSHA"
FT   gene            complement(355674..356759)
FT                   /gene="PSA1"
FT                   /gene_synonym="MPG1"
FT                   /gene_synonym="SRB1"
FT                   /gene_synonym="VIG9"
FT                   /locus_tag="YDL055C"
FT   mRNA            complement(355674..356759)
FT                   /gene="PSA1"
FT                   /gene_synonym="MPG1"
FT                   /gene_synonym="SRB1"
FT                   /gene_synonym="VIG9"
FT                   /locus_tag="YDL055C"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT   CDS_pept        complement(355674..356759)
FT                   /codon_start=1
FT                   /gene="PSA1"
FT                   /gene_synonym="MPG1"
FT                   /gene_synonym="SRB1"
FT                   /gene_synonym="VIG9"
FT                   /locus_tag="YDL055C"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.13"
FT                   /note="GDP-mannose pyrophosphorylase (mannose-1-phosphate
FT                   guanyltransferase); synthesizes GDP-mannose from GTP and
FT                   mannose-1-phosphate in cell wall biosynthesis; required for
FT                   normal cell wall structure"
FT                   /db_xref="GOA:P41940"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41940"
FT                   /experiment="EXISTENCE:direct assay:GO:0004475
FT                   mannose-1-phosphate guanylyltransferase activity
FT                   [PMID:9195935]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:11914276|PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0009298 GDP-mannose
FT                   biosynthetic process [PMID:9195935]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000032 cell
FT                   wall mannoprotein biosynthetic process [PMID:11055399]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004475
FT                   mannose-1-phosphate guanylyltransferase activity
FT                   [PMID:9195935]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006486 protein
FT                   glycosylation [PMID:9195935]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0009298
FT                   GDP-mannose biosynthetic process [PMID:9195935]"
FT                   /protein_id="DAA11801.1"
FT                   /translation="MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAG
FT                   VTDIVLAVNYRPEVMVETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEDVLKKDNSPF
FT                   FVLNSDVICEYPFKELADFHKAHGGKGTIVATKVDEPSKYGVIVHDIATPNLIDRFVEK
FT                   PKEFVGNRINAGLYILNPEVIDLIEMKPTSIEKETFPILVEEKQLYSFDLEGFWMDVGQ
FT                   PKDFLSGTVLYLNSLAKRQPKKLATGANIVGNALIDPTAKISSTAKIGPDVVIGPNVTI
FT                   GDGVRITRSVVLCNSTIKNHSLVKSTIVGWNSTVGQWCRLEGVTVLGDDVEVKDEIYIN
FT                   GGKVLPHKSISDNVPKEAIIM"
FT   gene            359577..359672
FT                   /locus_tag="tK(UUU)D"
FT   tRNA            join(359577..359613,359637..359672)
FT                   /locus_tag="tK(UUU)D"
FT                   /product="tRNA-Lys"
FT                   /note="tK(UUU)D; Lysine tRNA (tRNA-Lys), predicted by
FT                   tRNAscan-SE analysis; thiolation of uridine at wobble
FT                   position (34) requires Ncs6p"
FT                   /experiment="EXISTENCE:curator inference:GO:0005829 cytosol
FT                   [PMID:9023104]"
FT                   /experiment="EXISTENCE:curator inference:GO:0006414
FT                   translational elongation [PMID:9023104]"
FT   gene            complement(359825..361285)
FT                   /gene="MCH1"
FT                   /locus_tag="YDL054C"
FT   mRNA            complement(359825..361285)
FT                   /gene="MCH1"
FT                   /locus_tag="YDL054C"
FT                   /product="Mch1p"
FT   CDS_pept        complement(359825..361285)
FT                   /codon_start=1
FT                   /gene="MCH1"
FT                   /locus_tag="YDL054C"
FT                   /product="Mch1p"
FT                   /note="Protein with similarity to mammalian monocarboxylate
FT                   permeases; monocarboxylate permeases are involved in
FT                   transport of monocarboxylic acids across the plasma
FT                   membrane but mutant is not deficient in monocarboxylate
FT                   transport"
FT                   /db_xref="GOA:Q07376"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07376"
FT                   /experiment="EXISTENCE:direct assay:GO:0000329 fungal-type
FT                   vacuole membrane
FT                   [PMID:23708375|PMID:19001347|PMID:26928762]"
FT                   /protein_id="DAA11802.1"
FT                   /translation="MPLSKVEHYLSYHTRLLLPHVLSLQSSHRVAYIFSLLSAVSTGFI
FT                   TLISLYSQPWQKHLNYSSWQINTIASMTNLGMYLTPPILGMIADSHGPITLSLLAIIGF
FT                   IPSYSYLAYVFNHPELSLGGNGDSSFNLSIICFVFIGISTSALYFSALLTCTKLYPHTK
FT                   LLSISLPTTCYGISSVVGSQLLRIKWFWSSNASSSSSNSDLNLGRVFQTFALVYVVIGL
FT                   LAWIATSVVSLLHFNEEQDNQKRLDDQTDVEQSPLLERSNHVQEKFTQTMLRIFSDPVT
FT                   YILAVSILLSLGPLEMFIANMGSLTNLLVQLDAPTLSTKLLSTYALSSTFTRLLTGIVA
FT                   DFFAKKKISIKWILLTFLSLGVCAQLFLLKMTSSASPWGLVPTGSLVGIVYGGLFTVYP
FT                   TLVLLVWGERSFGTVYGSLLIAPAIGSMIFCMLYAKFYDSRCMSGGGDLRNPSCISAVY
FT                   KYSSIAFVVSAVLSAVVFWKLKSRKLRI"
FT   gene            complement(361699..362256)
FT                   /gene="PBP4"
FT                   /locus_tag="YDL053C"
FT   mRNA            complement(361699..362256)
FT                   /gene="PBP4"
FT                   /locus_tag="YDL053C"
FT                   /product="Pbp4p"
FT   CDS_pept        complement(361699..362256)
FT                   /codon_start=1
FT                   /gene="PBP4"
FT                   /locus_tag="YDL053C"
FT                   /product="Pbp4p"
FT                   /note="Pbp1p binding protein; interacts strongly with
FT                   Pab1p-binding protein 1 (Pbp1p) in the yeast two-hybrid
FT                   system; also interacts with Lsm12p in a copurification
FT                   assay; relative distribution to the nucleus increases upon
FT                   DNA replication stress"
FT                   /db_xref="GOA:Q07362"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07362"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095|PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095|PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0010494 cytoplasmic
FT                   stress granule [PMID:20368989|PMID:26777405]"
FT                   /protein_id="DAA11803.1"
FT                   /translation="MTTTSTTSVDGRTSSTLKATLSASGPNSNGPTPAVLPQKPKLTGW
FT                   AQAAAKALPRQQQQQQQARKDDSVAVQPANTKTKTIASTAPPANIKGSSTANGSSTNKK
FT                   FKRANKQPYNREEVRSYMHKLFQSYTAGEKSHSMKTYKQVLSETASGRVSTATDWGTVS
FT                   SSKNKNKKYGCLSDIAKVLRNQ"
FT   gene            complement(362672..363583)
FT                   /gene="SLC1"
FT                   /locus_tag="YDL052C"
FT   mRNA            complement(362672..363583)
FT                   /gene="SLC1"
FT                   /locus_tag="YDL052C"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase
FT                   SLC1"
FT   CDS_pept        complement(362672..363583)
FT                   /codon_start=1
FT                   /gene="SLC1"
FT                   /locus_tag="YDL052C"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase
FT                   SLC1"
FT                   /EC_number="2.3.1.51"
FT                   /note="1-acyl-sn-glycerol-3-phosphate acyltransferase;
FT                   catalyzes the acylation of lysophosphatidic acid to form
FT                   phosphatidic acid, a key intermediate in lipid metabolism;
FT                   enzymatic activity detected in lipid particles and
FT                   microsomes"
FT                   /db_xref="GOA:P33333"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/Swiss-Prot:P33333"
FT                   /experiment="EXISTENCE:direct assay:GO:0003841
FT                   1-acylglycerol-3-phosphate O-acyltransferase activity
FT                   [PMID:9212466]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005811 lipid
FT                   droplet [PMID:10515935|PMID:24868093]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0046474
FT                   glycerophospholipid biosynthetic process [PMID:17675291]"
FT                   /protein_id="DAA11804.1"
FT                   /translation="MSVIGRFLYYLRSVLVVLALAGCGFYGVIASILCTLIGKQHLAQW
FT                   ITARCFYHVMKLMLGLDVKVVGEENLAKKPYIMIANHQSTLDIFMLGRIFPPGCTVTAK
FT                   KSLKYVPFLGWFMALSGTYFLDRSKRQEAIDTLNKGLENVKKNKRALWVFPEGTRSYTS
FT                   ELTMLPFKKGAFHLAQQGKIPIVPVVVSNTSTLVSPKYGVFNRGCMIVRILKPISTENL
FT                   TKDKIGEFAEKVRDQMVDTLKEIGYSPAINDTTLPPQAIEYAALQHDKKVNKKIKNEPV
FT                   PSVSISNDVNTHNEGSSVKKMH"
FT   gene            363952..364779
FT                   /gene="LHP1"
FT                   /gene_synonym="LAH1"
FT                   /gene_synonym="YLA1"
FT                   /locus_tag="YDL051W"
FT   mRNA            363952..364779
FT                   /gene="LHP1"
FT                   /gene_synonym="LAH1"
FT                   /gene_synonym="YLA1"
FT                   /locus_tag="YDL051W"
FT                   /product="Lhp1p"
FT   CDS_pept        363952..364779
FT                   /codon_start=1
FT                   /gene="LHP1"
FT                   /gene_synonym="LAH1"
FT                   /gene_synonym="YLA1"
FT                   /locus_tag="YDL051W"
FT                   /product="Lhp1p"
FT                   /note="RNA binding protein required for maturation of tRNA
FT                   and U6 snRNA; acts as a molecular chaperone for RNAs
FT                   transcribed by polymerase III; homologous to human La
FT                   (SS-B) autoantigen"
FT                   /db_xref="GOA:P33399"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002344"
FT                   /db_xref="InterPro:IPR006630"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P33399"
FT                   /experiment="EXISTENCE:direct assay:GO:0000049 tRNA binding
FT                   [PMID:19749380]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003723 RNA binding
FT                   [PMID:7799435]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:10564276]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005654 nucleoplasm
FT                   [PMID:11720288]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005730 nucleolus
FT                   [PMID:11720288]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0008033 tRNA
FT                   processing [PMID:9150139]"
FT                   /protein_id="DAA11805.1"
FT                   /translation="MSEKPQQEEQEKPQSRRNSFAVIEFTPEVLDRCLKQVEFYFSEFN
FT                   FPYDRFLRTTAEKNDGWVPISTIATFNRMKKYRPVDKVIEALRSSEILEVSADGENVKR
FT                   RVPLDLTAARNARIEQNQRTLAVMNFPHEDVEASQIPELQENLEAFFKKLGEINQVRLR
FT                   RDHRNKKFNGTVLVEFKTIPECEAFLKSYSNDDESNEILSYEGKKLSVLTKKQFDLQRE
FT                   ASKSKNFSGRSRSFNGHKKKNLPKFPKNKKKNGKEESKEDSSAIADDDEEHKE"
FT   gene            complement(365068..365874)
FT                   /gene="KNH1"
FT                   /locus_tag="YDL049C"
FT   mRNA            complement(365068..365874)
FT                   /gene="KNH1"
FT                   /locus_tag="YDL049C"
FT                   /product="Knh1p"
FT   CDS_pept        complement(365068..365874)
FT                   /codon_start=1
FT                   /gene="KNH1"
FT                   /locus_tag="YDL049C"
FT                   /product="Knh1p"
FT                   /note="Protein with similarity to Kre9p; Kre9p is involved
FT                   in cell wall beta 1,6-glucan synthesis; overproduction
FT                   suppresses growth defects of a kre9 null mutant; required
FT                   for propionic acid resistance"
FT                   /db_xref="GOA:P50112"
FT                   /db_xref="InterPro:IPR008659"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50112"
FT                   /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
FT                   vacuole [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005576
FT                   extracellular region [PMID:8810042]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006078
FT                   (1->6)-beta-D-glucan biosynthetic process [PMID:8810042]"
FT                   /protein_id="DAA11806.1"
FT                   /translation="MLIVLFLTLFCSVVFRTAYCDVAIVAPEPNSVYDLSGTSQAVVKV
FT                   KWMHTDNTPQEKDFVRYTFTLCSGTNAMIEAMATLQTLSASDLTDNEFNAIIENTVGTD
FT                   GVYFIQVFAQTAIGYTIHYTNRFKLKGMIGTKAANPSMITIAPEAQTRITTGDVGATID
FT                   SKSFTVPYNLQTGVVKYAPMQLQPATKVTAKTWKRKYATSEVTYYYTLRNSVDQHTTVT
FT                   PGWSYIITADSNYATPAPMPADNGGWYNPRKRLSLTARKVNALRHR"
FT   gene            complement(366739..368211)
FT                   /gene="STP4"
FT                   /locus_tag="YDL048C"
FT   mRNA            complement(366739..368211)
FT                   /gene="STP4"
FT                   /locus_tag="YDL048C"
FT                   /product="Stp4p"
FT   CDS_pept        complement(366739..368211)
FT                   /codon_start=1
FT                   /gene="STP4"
FT                   /locus_tag="YDL048C"
FT                   /product="Stp4p"
FT                   /note="Protein containing a Kruppel-type zinc-finger
FT                   domain; similar to Stp1p, Stp2p; predicted transcription
FT                   factor; relative distribution to the nucleus increases upon
FT                   DNA replication stress; STP4 has a paralog, STP3, that
FT                   arose from the whole genome duplication"
FT                   /db_xref="GOA:Q07351"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07351"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095|PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043565
FT                   sequence-specific DNA binding [PMID:19111667]"
FT                   /protein_id="DAA11807.1"
FT                   /translation="MLVSSSFASSIDSVMSHETMSLRRNPPFIDTPEKMPNPTASPNGT
FT                   IHHLIDPSLPLLSSTTSSSRSTLSSTLNSPPPPPLTTSYSSYNSSACQSITSSPTDNTA
FT                   LAHNSKCYFPHSLSPTPLSSNSSSHVILPPISSFTNLITVAEREFNGRSNSLHANFTSP
FT                   VPRTVLDHHRHELTFCNPNNTTGFKTITPSPPTQHQSILPTAVDNVPRSKSVSSLPVSG
FT                   FPPLIVKQQQQQQLNSSSSASALPSIHSPLTNEHTSRYSSSLKDSAKITKQRKKKECPI
FT                   CHNFYANLSTHKSTHLTPEDRPHKCPICQRGFARNNDLIRHKKRHWKDEFMQIYARESD
FT                   NNSGADDQDDTARTSANNDSDDSNDKLAASSSSEETKLLKKNQLKSLYKIKGAFKCPYN
FT                   STLINLDMEVYPHKSRSLYFEPINCHQTGVFSRCDTFKNHLKALHFEYPPKTKKEDRGV
FT                   VPGKCKHCGLQFPNVDVWLNKHVGKGCGYSYH"
FT   gene            369771..370706
FT                   /gene="SIT4"
FT                   /gene_synonym="PPH1"
FT                   /locus_tag="YDL047W"
FT   mRNA            369771..370706
FT                   /gene="SIT4"
FT                   /gene_synonym="PPH1"
FT                   /locus_tag="YDL047W"
FT                   /product="type 2A-related serine/threonine-protein
FT                   phosphatase SIT4"
FT   CDS_pept        369771..370706
FT                   /codon_start=1
FT                   /gene="SIT4"
FT                   /gene_synonym="PPH1"
FT                   /locus_tag="YDL047W"
FT                   /product="type 2A-related serine/threonine-protein
FT                   phosphatase SIT4"
FT                   /EC_number="3.1.3.16"
FT                   /note="Ceramide-activated, type 2A-related serine-threonine
FT                   phosphatase; functions in G1/S transition of mitotic cycle;
FT                   controls lifespan, mitochondrial function, cell cycle
FT                   progression by regulating HXK2 phosphorylation; regulator
FT                   of COPII coat dephosphorylation; required for ER to Golgi
FT                   traffic; interacts with Hrr25p kinase; cytoplasmic and
FT                   nuclear protein that modulates functions mediated by Pkc1p
FT                   including cell wall and actin cytoskeleton organization;
FT                   similar to human PP6"
FT                   /db_xref="GOA:P20604"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20604"
FT                   /experiment="EXISTENCE:direct assay:GO:0000159 protein
FT                   phosphatase type 2A complex [PMID:8600023]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:1848673|PMID:14562095]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000082 G1/S
FT                   transition of mitotic cell cycle [PMID:1848673]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000159 protein
FT                   phosphatase type 2A complex [PMID:8600023]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001302
FT                   replicative cell aging [PMID:15843932]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0002098 tRNA
FT                   wobble uridine modification [PMID:18755837]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004722 protein
FT                   serine/threonine phosphatase activity [PMID:23864707]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006281 DNA
FT                   repair [PMID:15150670]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006470 protein
FT                   dephosphorylation [PMID:24476960]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016311
FT                   dephosphorylation [PMID:15367655]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031929 TOR
FT                   signaling [PMID:15367655]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0032956
FT                   regulation of actin cytoskeleton organization
FT                   [PMID:12080055]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034599 cellular
FT                   response to oxidative stress [PMID:18357452]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0035556
FT                   intracellular signal transduction [PMID:12080055]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0060237
FT                   regulation of fungal-type cell wall organization
FT                   [PMID:12080055]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0070262
FT                   peptidyl-serine dephosphorylation [PMID:27163342]"
FT                   /protein_id="DAA11808.1"
FT                   /translation="MVSRGPDEWLETIKKCQALTENEMKQLCEMVKELLMEESNIQPVQ
FT                   TPVTVCGDIHGQFHDLLELFRTAGGFPDDINYIFLGDYVDRGYYSLETFTLLMCLKVKY
FT                   PAKITLVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLAAIIDGKILCV
FT                   HGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDPDNVEAWQVSPRGAGWLFGSKVA
FT                   REFNHVNGLNLIARAHQLVMEGFKYHFPEKDVVTVWSAPNYCYRCGNVASVMKVDEDLE
FT                   PTFKIFSAVPDDYIRESTANHNNQRAGYFL"
FT   gene            371240..371761
FT                   /gene="NPC2"
FT                   /locus_tag="YDL046W"
FT   mRNA            371240..371761
FT                   /gene="NPC2"
FT                   /locus_tag="YDL046W"
FT                   /product="sterol transporter"
FT   CDS_pept        371240..371761
FT                   /codon_start=1
FT                   /gene="NPC2"
FT                   /locus_tag="YDL046W"
FT                   /product="sterol transporter"
FT                   /note="Sterol transport protein and functional homolog of
FT                   human NPC2/He1; human NPC2 is a cholesterol-binding protein
FT                   whose deficiency causes Niemann-Pick type C2 disease
FT                   involving retention of cholesterol in lysosomes; yeast NPC2
FT                   can complement mutations in human NPC2"
FT                   /db_xref="GOA:Q12408"
FT                   /db_xref="InterPro:IPR003172"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR033917"
FT                   /db_xref="InterPro:IPR039670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12408"
FT                   /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
FT                   vacuole [PMID:14562095|PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000328 fungal-type
FT                   vacuole lumen [PMID:16278452]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0032366
FT                   intracellular sterol transport [PMID:16278452]"
FT                   /experiment="EXISTENCE:direct assay:GO:0015918 sterol
FT                   transport [PMID:31543266]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032934 sterol
FT                   binding [PMID:31543266]"
FT                   /protein_id="DAA11809.1"
FT                   /translation="MTHSLKALFALLFLYTAAVNAGVIGIFNALPPPNTKPINGESPLY
FT                   QCDILDKQLVEIKEVNLDPNPPVRGENLTISANGEVFETIEEGAYIDVEVRLGYIRLLS
FT                   QTFDLCETLEDNDIEGLSCPIEPGEYNIKKIVEIPGEVPPGKYVVVARAYTEKDDLITC
FT                   LTGEVIFPPR"
FT   gene            372248..372535
FT                   /gene="MRP10"
FT                   /gene_synonym="mS37"
FT                   /locus_tag="YDL045W-A"
FT   mRNA            372248..372535
FT                   /gene="MRP10"
FT                   /gene_synonym="mS37"
FT                   /locus_tag="YDL045W-A"
FT                   /product="mitochondrial 37S ribosomal protein YmS-T"
FT   CDS_pept        372248..372535
FT                   /codon_start=1
FT                   /gene="MRP10"
FT                   /gene_synonym="mS37"
FT                   /locus_tag="YDL045W-A"
FT                   /product="mitochondrial 37S ribosomal protein YmS-T"
FT                   /note="Mitochondrial ribosomal protein of the small
FT                   subunit; contains twin cysteine-x9-cysteine motifs;
FT                   oxidized by Mia40p during import into mitochondria"
FT                   /db_xref="GOA:O75012"
FT                   /db_xref="InterPro:IPR010625"
FT                   /db_xref="InterPro:IPR017264"
FT                   /db_xref="PDB:5MRC"
FT                   /db_xref="PDB:5MRE"
FT                   /db_xref="PDB:5MRF"
FT                   /db_xref="UniProtKB/Swiss-Prot:O75012"
FT                   /experiment="EXISTENCE:curator inference:GO:0032543
FT                   mitochondrial translation [PMID:9151978]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003735 structural
FT                   constituent of ribosome [PMID:9065385|PMID:9151978]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005763
FT                   mitochondrial small ribosomal subunit
FT                   [PMID:9065385|PMID:9151978]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0032543
FT                   mitochondrial translation [PMID:9065385]"
FT                   /protein_id="DAA11810.1"
FT                   /translation="MSGKPPVYRLPPLPRLKVKKPIIRQEANKCLVLMSNLLQCWSSYG
FT                   HMSPKCAGLVTELKSCTSESALGKRNNVQKSNINYHAARLYDRINGKPHD"
FT   gene            complement(372688..373608)
FT                   /gene="FAD1"
FT                   /locus_tag="YDL045C"
FT   mRNA            complement(372688..373608)
FT                   /gene="FAD1"
FT                   /locus_tag="YDL045C"
FT                   /product="FMN adenylyltransferase"
FT   CDS_pept        complement(372688..373608)
FT                   /codon_start=1
FT                   /gene="FAD1"
FT                   /locus_tag="YDL045C"
FT                   /product="FMN adenylyltransferase"
FT                   /EC_number="2.7.7.2"
FT                   /note="Flavin adenine dinucleotide (FAD) synthetase;
FT                   performs the second step in synthesis of FAD from
FT                   riboflavin; mutation is functionally complemented by human
FT                   FLAD1"
FT                   /db_xref="GOA:P38913"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="PDB:2WSI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38913"
FT                   /experiment="EXISTENCE:direct assay:GO:0003919 FMN
FT                   adenylyltransferase activity [PMID:7799934]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:7799934]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006747 FAD
FT                   biosynthetic process [PMID:7799934]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006747 FAD
FT                   biosynthetic process [PMID:7799934]"
FT                   /protein_id="DAA11811.1"
FT                   /translation="MQLSKAAEMCYEITNSYLHIDQKSQIIASTQEAIRLTRKYLLSEI
FT                   FVRWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYFFIKAQNSQFDFEFQSFPMQRLPT
FT                   VFIDQEETFPTLENFVLETSERYCLSLYESQRQSGASVNMADAFRDFIKIYPETEAIVI
FT                   GIRHTDPFGEALKPIQRTDSNWPDFMRLQPLLHWDLTNIWSFLLYSNEPICGLYGKGFT
FT                   SIGGINNSLPNPHLRKDSNNPALHFEWEIIHAFGKDAEGERSSAINTSPISVVDKERFS
FT                   KYHDNYYPGWYLVDDTLERAGRIKN"
FT   gene            complement(373967..375289)
FT                   /gene="MTF2"
FT                   /gene_synonym="NAM1"
FT                   /locus_tag="YDL044C"
FT   mRNA            complement(373967..375289)
FT                   /gene="MTF2"
FT                   /gene_synonym="NAM1"
FT                   /locus_tag="YDL044C"
FT                   /product="Mtf2p"
FT   CDS_pept        complement(373967..375289)
FT                   /codon_start=1
FT                   /gene="MTF2"
FT                   /gene_synonym="NAM1"
FT                   /locus_tag="YDL044C"
FT                   /product="Mtf2p"
FT                   /note="Mitochondrial protein that interacts with
FT                   mitochondrial RNA polymerase; interacts with an N-terminal
FT                   region of mitochondrial RNA polymerase (Rpo41p) and couples
FT                   RNA processing and translation to transcription"
FT                   /db_xref="GOA:P10849"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10849"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion
FT                   [PMID:8200349|PMID:14576278|PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0003723 RNA
FT                   binding [PMID:8413192]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006397 mRNA
FT                   processing [PMID:8413192]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0032543
FT                   mitochondrial translation [PMID:12637560]"
FT                   /protein_id="DAA11812.1"
FT                   /translation="MIRTSSILKNCNYRYIHCIHRCLLNEANLKDRKTHNVERVSNEKT
FT                   FEQALEEERKVFGELFEAGARVENMRHTNASKIIDKYYNGLQDNSEGTSVKKEKIVFNH
FT                   SQRAQRKLPNKDHEFLKETAGNDYVYERAEPSAISTKTISEQTRTLLEKIFDEDNSINK
FT                   SNRELLNLNLRKGSGMEALRQPVAHSNVKFSEEVMQEIGNKIRYQTTLDQVLEPHIDYL
FT                   REAVKSDYDLLRYLKQSLDIYKKRNKDLELKMNAESSNIFEDIRSACINKPAELPKPLA
FT                   MTLPYIIVKSLRLGDFDFPADRKYTLISYVYNECKNNMDASLYLTICNVDFYNLLVQLL
FT                   WENFQEIRYLRRVVTEMSVNGVIGNIETVDILDKIVKEMRSLNEDVFLEAGEQLSADEE
FT                   VSSSANKIVNVGVLWNKDTNNDLLIVENYLKSLKKNLTRDR"
FT   gene            complement(375680..376480)
FT                   /gene="PRP11"
FT                   /gene_synonym="RNA11"
FT                   /locus_tag="YDL043C"
FT   mRNA            complement(375680..376480)
FT                   /gene="PRP11"
FT                   /gene_synonym="RNA11"
FT                   /locus_tag="YDL043C"
FT                   /product="Prp11p"
FT   CDS_pept        complement(375680..376480)
FT                   /codon_start=1
FT                   /gene="PRP11"
FT                   /gene_synonym="RNA11"
FT                   /locus_tag="YDL043C"
FT                   /product="Prp11p"
FT                   /note="Subunit of the SF3a splicing factor complex;
FT                   required for spliceosome assembly"
FT                   /db_xref="GOA:Q07350"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR031781"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="PDB:4DGW"
FT                   /db_xref="PDB:5GM6"
FT                   /db_xref="PDB:5NRL"
FT                   /db_xref="PDB:5ZWM"
FT                   /db_xref="PDB:5ZWO"
FT                   /db_xref="PDB:6G90"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07350"
FT                   /experiment="EXISTENCE:direct assay:GO:0000245 spliceosomal
FT                   complex assembly [PMID:8969185]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003723 RNA binding
FT                   [PMID:8065365]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071004 U2-type
FT                   prespliceosome [PMID:16618970]"
FT                   /protein_id="DAA11813.1"
FT                   /translation="MNYLEGVGSKKGGGGIASESQFNLQRRKEVESLLSKGENVPYTFQ
FT                   DEKDDQVRSNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGLNVLRRGISIEKS
FT                   SLGREGQTTHDFRQQQKIIEAKQSLKNNGTIPVCKIATVKNPKNGSVGLAIQVNYSSEV
FT                   KENSVDSDDKAKVPPLIRIVSGLELSDTKQKGKKFLVIAYEPFENIAIELPPNEILFSE
FT                   NNDMDNNNDGVDELNKKCTFWDAISKLYYVQFFFKQAEQEQADV"
FT   gene            complement(376757..378445)
FT                   /gene="SIR2"
FT                   /gene_synonym="MAR1"
FT                   /locus_tag="YDL042C"
FT   mRNA            complement(376757..378445)
FT                   /gene="SIR2"
FT                   /gene_synonym="MAR1"
FT                   /locus_tag="YDL042C"
FT                   /product="NAD-dependent histone deacetylase SIR2"
FT   CDS_pept        complement(376757..378445)
FT                   /codon_start=1
FT                   /gene="SIR2"
FT                   /gene_synonym="MAR1"
FT                   /locus_tag="YDL042C"
FT                   /product="NAD-dependent histone deacetylase SIR2"
FT                   /note="Conserved NAD+ dependent histone deacetylase of the
FT                   Sirtuin family; deacetylation targets are primarily nuclear
FT                   proteins; required for telomere hypercluster formation in
FT                   quiescent yeast cells; involved in regulation of lifespan;
FT                   plays roles in silencing at HML, HMR, telomeres, and rDNA;
FT                   negatively regulates initiation of DNA replication;
FT                   functions as regulator of autophagy like mammalian homolog
FT                   SIRT1, and also of mitophagy"
FT                   /db_xref="GOA:P06700"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR007654"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="PDB:2HJH"
FT                   /db_xref="PDB:4IAO"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06700"
FT                   /experiment="EXISTENCE:direct assay:GO:0000784 nuclear
FT                   chromosome, telomeric region [PMID:9710643]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005677 chromatin
FT                   silencing complex [PMID:9122169]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005720 nuclear
FT                   heterochromatin [PMID:20176978]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005724 nuclear
FT                   telomeric heterochromatin [PMID:9000052]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005730 nucleolus
FT                   [PMID:9214640]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006333 chromatin
FT                   assembly or disassembly [PMID:11553718]"
FT                   /experiment="EXISTENCE:direct assay:GO:0017136
FT                   NAD-dependent histone deacetylase activity [PMID:10811920]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030869 RENT complex
FT                   [PMID:10219244]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031491 nucleosome
FT                   binding [PMID:19217406]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032041
FT                   NAD-dependent histone deacetylase activity (H3-K14
FT                   specific) [PMID:10693811]"
FT                   /experiment="EXISTENCE:direct assay:GO:0046969
FT                   NAD-dependent histone deacetylase activity (H3-K9 specific)
FT                   [PMID:10693811]"
FT                   /experiment="EXISTENCE:direct assay:GO:0046970
FT                   NAD-dependent histone deacetylase activity (H4-K16
FT                   specific) [PMID:10693811]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006325
FT                   chromatin organization [PMID:26951198]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0045910
FT                   negative regulation of DNA recombination [PMID:16182251]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000183
FT                   chromatin silencing at rDNA [PMID:2647300]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000784 nuclear
FT                   chromosome, telomeric region [PMID:27122604]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001300
FT                   chronological cell aging [PMID:16286010]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001302
FT                   replicative cell aging [PMID:15722108]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006303
FT                   double-strand break repair via nonhomologous end joining
FT                   [PMID:9501103]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006348
FT                   chromatin silencing at telomere
FT                   [PMID:11950950|PMID:1913809|PMID:9501103]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007062 sister
FT                   chromatid cohesion [PMID:27185881]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0008156 negative
FT                   regulation of DNA replication [PMID:15082529]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030466
FT                   chromatin silencing at silent mating-type cassette
FT                   [PMID:11950950|PMID:3297920]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034398 telomere
FT                   tethering at nuclear periphery [PMID:27122604]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045910 negative
FT                   regulation of DNA recombination [PMID:25822194]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0097695
FT                   establishment of protein-containing complex localization to
FT                   telomere [PMID:26218225]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0097752
FT                   regulation of DNA stability [PMID:27820830]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1904524 negative
FT                   regulation of DNA amplification [PMID:26195783]"
FT                   /protein_id="DAA11814.1"
FT                   /translation="MTIPHMKYAVSKTSENKVSNTVSPTQDKDAIRKQPDDIINNDEPS
FT                   HKKIKVAQPDSLRETNTTDPLGHTKAALGEVASMELKPTNDMDPLAVSAASVVSMSNDV
FT                   LKPETPKGPIIISKNPSNGIFYGPSFTKRESLNARMFLKYYGAHKFLDTYLPEDLNSLY
FT                   IYYLIKLLGFEVKDQALIGTINSIVHINSQERVQDLGSAISVTNVEDPLAKKQTVRLIK
FT                   DLQRAINKVLCTRLRLSNFFTIDHFIQKLHTARKILVLTGAGVSTSLGIPDFRSSEGFY
FT                   SKIKHLGLDDPQDVFNYNIFMHDPSVFYNIANMVLPPEKIYSPLHSFIKMLQMKGKLLR
FT                   NYTQNIDNLESYAGISTDKLVQCHGSFATATCVTCHWNLPGERIFNKIRNLELPLCPYC
FT                   YKKRREYFPEGYNNKVGVAASQGSMSERPPYILNSYGVLKPDITFFGEALPNKFHKSIR
FT                   EDILECDLLICIGTSLKVAPVSEIVNMVPSHVPQVLINRDPVKHAEFDLSLLGYCDDIA
FT                   AMVAQKCGWTIPHKKWNDLKNKNFKCQEKDKGVYVVTSDEHPKTL"
FT   gene            complement(378874..381438)
FT                   /gene="NAT1"
FT                   /gene_synonym="AAA1"
FT                   /gene_synonym="NAA15"
FT                   /locus_tag="YDL040C"
FT   mRNA            complement(378874..381438)
FT                   /gene="NAT1"
FT                   /gene_synonym="AAA1"
FT                   /gene_synonym="NAA15"
FT                   /locus_tag="YDL040C"
FT                   /product="peptide alpha-N-acetyltransferase complex A
FT                   subunit NAT1"
FT   CDS_pept        complement(378874..381438)
FT                   /codon_start=1
FT                   /gene="NAT1"
FT                   /gene_synonym="AAA1"
FT                   /gene_synonym="NAA15"
FT                   /locus_tag="YDL040C"
FT                   /product="peptide alpha-N-acetyltransferase complex A
FT                   subunit NAT1"
FT                   /note="Subunit of protein N-terminal acetyltransferase
FT                   NatA; NatA comprised of Nat1p, Ard1p, and Nat5p;
FT                   N-terminally acetylates many proteins to influence multiple
FT                   processes such as cell cycle progression, heat-shock
FT                   resistance, mating, sporulation, telomeric silencing and
FT                   early stages of mitophagy; orthologous to human NAA15;
FT                   expression of both human NAA10 and NAA15 functionally
FT                   complements ard1 nat1 double mutant although single
FT                   mutations are not complemented by their orthologs"
FT                   /db_xref="GOA:P12945"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR021183"
FT                   /db_xref="PDB:4HNW"
FT                   /db_xref="PDB:4HNY"
FT                   /db_xref="PDB:4XNH"
FT                   /db_xref="PDB:4XPD"
FT                   /db_xref="PDB:4Y49"
FT                   /db_xref="PDB:6HD5"
FT                   /db_xref="PDB:6HD7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12945"
FT                   /experiment="EXISTENCE:direct assay:GO:0004596 peptide
FT                   alpha-N-acetyltransferase activity [PMID:2551674]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006474 N-terminal
FT                   protein amino acid acetylation [PMID:2551674]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031415 NatA complex
FT                   [PMID:14517307]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043022 ribosome
FT                   binding [PMID:14517307]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004596 peptide
FT                   alpha-N-acetyltransferase activity [PMID:2551674]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006474
FT                   N-terminal protein amino acid acetylation [PMID:2551674]"
FT                   /protein_id="DAA11815.1"
FT                   /translation="MSRKRSTKPKPAAKIALKKENDQFLEALKLYEGKQYKKSLKLLDA
FT                   ILKKDGSHVDSLALKGLDLYSVGEKDDAASYVANAIRKIEGASASPICCHVLGIYMRNT
FT                   KEYKESIKWFTAALNNGSTNKQIYRDLATLQSQIGDFKNALVSRKKYWEAFLGYRANWT
FT                   SLAVAQDVNGERQQAINTLSQFEKLAEGKISDSEKYEHSECLMYKNDIMYKAASDNQDK
FT                   LQNVLKHLNDIEPCVFDKFGLLERKATIYMKLGQLKDASIVYRTLIKRNPDNFKYYKLL
FT                   EVSLGIQGDNKLKKALYGKLEQFYPRCEPPKFIPLTFLQDKEELSKKLREYVLPQLERG
FT                   VPATFSNVKPLYQRRKSKVSPLLEKIVLDYLSGLDPTQDPIPFIWTNYYLSQHFLFLKD
FT                   FPKAQEYIDAALDHTPTLVEFYILKARILKHLGLMDTAAGILEEGRQLDLQDRFINCKT
FT                   VKYFLRANNIDKAVEVASLFTKNDDSVNGIKDLHLVEASWFIVEQAEAYYRLYLDRKKK
FT                   LDDLASLKKEVESDKSEQIANDIKENQWLVRKYKGLALKRFNAIPKFYKQFEDDQLDFH
FT                   SYCMRKGTPRAYLEMLEWGKALYTKPMYVRAMKEASKLYFQMHDDRLKRKSDSLDENSD
FT                   EIQNNGQNSSSQKKKAKKEAAAMNKRKETEAKSVAAYPSDQDNDVFGEKLIETSTPMED
FT                   FATEFYNNYSMQVREDERDYILDFEFNYRIGKLALCFASLNKFAKRFGTTSGLFGSMAI
FT                   VLLHATRNDTPFDPILKKVVTKSLEKEYSENFPLNEISNNSFDWLNFYQEKFGKNDING
FT                   LLFLYRYRDDVPIGSSNLKEMIISSLSPLEPHSQNEILQYYL"
FT   gene            complement(381985..384081)
FT                   /gene="PRM7"
FT                   /gene_synonym="YDL038C"
FT                   /locus_tag="YDL039C"
FT   mRNA            complement(381985..384081)
FT                   /gene="PRM7"
FT                   /gene_synonym="YDL038C"
FT                   /locus_tag="YDL039C"
FT                   /product="pheromone-regulated protein PRM7"
FT   CDS_pept        complement(381985..384081)
FT                   /codon_start=1
FT                   /gene="PRM7"
FT                   /gene_synonym="YDL038C"
FT                   /locus_tag="YDL039C"
FT                   /product="pheromone-regulated protein PRM7"
FT                   /note="Pheromone-regulated protein; predicted to have one
FT                   transmembrane segment; promoter contains Gcn4p binding
FT                   elements; in W303 strain one continuous open reading frame
FT                   comprising of YDL037C, the intergenic region and YDL039C
FT                   encodes the IMI1"
FT                   /db_xref="GOA:Q12459"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12459"
FT                   /protein_id="DAA11816.1"
FT                   /translation="MYRTRSSDEVTTSTDLTSSSDVATSVDPTTSVISSTSADPTTSAD
FT                   STTSTVQTTSAGPSNNIGNSTLANSTTFAVSSTSIDPTSSSDVITSTVQTTSIEPTTSL
FT                   VSSNDITTSTSLNISVVISTSTDSTSLIESTTTVGPHASSSVAGMYRTRSSDEVTTSTD
FT                   PTSSSDVATSADPTSSSAVTTLVDPTTSVVISTSVDQTSSSDVATSVDPTTSVISSTSA
FT                   DPTTSADSTTSTVQTTSVDPTSSVVSSAPVDPASSVVSLTSSYPTSSSTVTISANSNGS
FT                   ATLAAQTTSIDPVSSIVSSSGATTIISSASIDPASSVVSSTSSEPTSFIVSSTSVYSTR
FT                   PSGPTTSTDLATFSDTIILRVSTTSTSQDTQTVSSSLTDMVSSTGSADLSVSSIQRSQV
FT                   DPSTFAVSNSPVYPTASTGSTSTGIPIASESLSLSRQQGISATSSSSIVTLTPVDSASS
FT                   SRSSATSIIKPNMPVSSNDSKTQSSVSVVDAFQSTKSSYPSITSADPTTLASENGLVGS
FT                   SSSAHPITLDRTYASAHASVTDIVSRVTDSTRHTTLVTSNINIQSEVGNPNYSGPKDTT
FT                   ITKQSAFMTSPASTSTISNVQSTASVMNHSIEDNISAAASLESVSGTSTKDYSSQSSAI
FT                   HYTNSFTTTTTNAFITSKHSIAAVSTGAITSSASISLIMEGSANIEAVGKLVWLAAALP
FT                   LAFI"
FT   gene            complement(384601..385587)
FT                   /gene="BSC1"
FT                   /locus_tag="YDL037C"
FT   mRNA            complement(384601..385587)
FT                   /gene="BSC1"
FT                   /locus_tag="YDL037C"
FT                   /product="Bsc1p"
FT   CDS_pept        complement(384601..385587)
FT                   /codon_start=1
FT                   /gene="BSC1"
FT                   /locus_tag="YDL037C"
FT                   /product="Bsc1p"
FT                   /note="Protein of unconfirmed function; similar to cell
FT                   surface flocculin Flo11p; ORF exhibits genomic organization
FT                   compatible with a translational readthrough-dependent mode
FT                   of expression; in W303 strain one continuous open reading
FT                   frame comprising of YDL037C, the intergenic region and
FT                   YDL039C encodes the gene IMI1"
FT                   /db_xref="GOA:Q12140"
FT                   /db_xref="InterPro:IPR018789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12140"
FT                   /protein_id="DAA11817.1"
FT                   /translation="MSQQNILHYDMDVTSVSWVKDNTYQITIHVKAVKDIPLKYLWSLK
FT                   IIGVNGPSSTVQLYGKNEKTYLISDPTDFTSTFQVYAYPSSDGCTVWMPNFQIQFEYLQ
FT                   GDAAQYWQTWQWGTTTFDLSTGCNNYDNQGHSQTDFPGFYWTYQCKGNNDGTCTKASSS
FT                   SITTSSITTSSTTTSSTTTSSTTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTTSSSTT
FT                   SSSTTSSSTTSSSTTSSSTTSSSTKTSTTTSSTVKSSSTTSIDFTTSVDSHTSSSVADI
FT                   YRSRTSTDVTTLAASTSPFSSFTSSDSSSSSDVTSSTIQTTSVDPTT"
FT   gene            complement(387513..388901)
FT                   /gene="PUS9"
FT                   /locus_tag="YDL036C"
FT   mRNA            complement(387513..388901)
FT                   /gene="PUS9"
FT                   /locus_tag="YDL036C"
FT                   /product="pseudouridine synthase PUS9"
FT   CDS_pept        complement(387513..388901)
FT                   /codon_start=1
FT                   /gene="PUS9"
FT                   /locus_tag="YDL036C"
FT                   /product="pseudouridine synthase PUS9"
FT                   /EC_number="5.4.99.28"
FT                   /note="Mitochondrial tRNA:pseudouridine synthase; catalyzes
FT                   the formation of pseudouridine at position 32 in
FT                   mitochondrial tRNAs; contains an N-terminal mitochondrial
FT                   targeting sequence; PUS9 has a paralog, RIB2, that arose
FT                   from the whole genome duplication"
FT                   /db_xref="GOA:Q12069"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12069"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0009982
FT                   pseudouridine synthase activity [PMID:15466869]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031119 tRNA
FT                   pseudouridine synthesis [PMID:15466869]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005739
FT                   mitochondrion [PMID:15466869]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0009982
FT                   pseudouridine synthase activity [PMID:15466869]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031119 tRNA
FT                   pseudouridine synthesis [PMID:15466869]"
FT                   /protein_id="DAA11818.1"
FT                   /translation="MQRNNRLRNLFTVPVIMARQLKRNALSAGLAFAGNATSNEFDEHL
FT                   QNEVEREREIQKKKKIKRTQSKKSPDLINKSTFQSRTIGSKKEKHRQLDPEYEIVIDGP
FT                   LRKIKPYHFTYRTFCKERWRDKKLVDVFISEFRDRESEYYKRTIENGDVHINDETADLS
FT                   TVIRNGDLITHQVHRHEPPVTSRPIKVIFEDDNIMVIDKPSGIPVHPTGRYRFNTITKM
FT                   LQNNLGFVVNPCNRLDRLTSGLMFLAKTPKGADNIGDQLKAREVTKEYVAKVVGEFPET
FT                   EVIVEKPLKLIEPRLALNAVCQMDEKGAKHAKTVFNRISYDGKTSIVKCKPLTGRSHQI
FT                   RVHLQYLGHPIANDPIYSNDEVWGNNLGKGGQADFDIVITKLDEIGKRKPAKSWFHSNG
FT                   GYGEVLRQEKCSICESDLYTDPGPNDLDLWLHAYLYESTETEEGTEKKKWCYKTEYPEW
FT                   ALRR"
FT   gene            complement(389172..392057)
FT                   /gene="GPR1"
FT                   /locus_tag="YDL035C"
FT   mRNA            complement(389172..392057)
FT                   /gene="GPR1"
FT                   /locus_tag="YDL035C"
FT                   /product="Gpr1p"
FT   CDS_pept        complement(389172..392057)
FT                   /codon_start=1
FT                   /gene="GPR1"
FT                   /locus_tag="YDL035C"
FT                   /product="Gpr1p"
FT                   /note="Plasma membrane G protein coupled receptor (GPCR);
FT                   interacts with the heterotrimeric G protein alpha subunit,
FT                   Gpa2p, and with Plc1p; sensor that integrates nutritional
FT                   signals with the modulation of cell fate via PKA and cAMP
FT                   synthesis"
FT                   /db_xref="GOA:Q12361"
FT                   /db_xref="InterPro:IPR022596"
FT                   /db_xref="InterPro:IPR023041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12361"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:10655215|PMID:9388468|PMID:9524122]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0009757
FT                   hexose mediated signaling [PMID:9813141]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0010255
FT                   glucose mediated signaling pathway [PMID:10361302]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001302
FT                   replicative cell aging [PMID:15722108]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001403 invasive
FT                   growth in response to glucose limitation [PMID:12150916]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004930 G
FT                   protein-coupled receptor activity [PMID:9524122]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005536 glucose
FT                   binding [PMID:15494315]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007124
FT                   pseudohyphal growth [PMID:10655215]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007186 G
FT                   protein-coupled receptor signaling pathway [PMID:9524122]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0009731
FT                   detection of sucrose stimulus [PMID:15494315]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0009745 sucrose
FT                   mediated signaling [PMID:15494315]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0009757 hexose
FT                   mediated signaling [PMID:10655215|PMID:9813141]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0010255 glucose
FT                   mediated signaling pathway
FT                   [PMID:10361302|PMID:15494315|PMID:9813141]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0051594
FT                   detection of glucose [PMID:15494315]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0004930 G
FT                   protein-coupled receptor activity
FT                   [PMID:9388468|PMID:9524122]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0007186 G
FT                   protein-coupled receptor signaling pathway
FT                   [PMID:9388468|PMID:9524122]"
FT                   /protein_id="DAA11819.1"
FT                   /translation="MITEGFPPNLNALKGSSLLEKRVDSLRQLNTTTVNQLLGLPGMTS
FT                   TFTAPQLLQLRIIAITASAVSLIAGCLGMFFLSKMDKRRKVFRHDLIAFLIICDFLKAF
FT                   ILMIYPMIILINNSVYATPAFFNTLGWFTAFAIEGADMAIMIFAIHFAILIFKPNWKWR
FT                   NKRSGNMEGGLYKKRSYIWPITALVPAILASLAFINYNKLNDDSDTTIILDNNNYNFPD
FT                   SPRQGGYKPWSAWCYLPPKPYWYKIVLSWGPRYFIIIFIFAVYLSIYIFITSESKRIKA
FT                   QIGDFNHNVLEEEKEKKKLFGLGHWGKAKWYFRSYFKLPLLHLLRNLKNFFTISFIDPN
FT                   EETDDSGSSNGTFNFGESSNEIPTLFRKTNTGSDENVSASGGVRLLDYNSAKPLDMSKY
FT                   AMSEQPDLERNNPFDCENDITLNPSELVSKQKEHKVTFSVENEGLDTRKSSMLGHQTFS
FT                   CQNSLESPLAMYDNKNDNSDITSNIKEKGGIINNNSNNDDDDNNNNNDNDNDNNNSNNN
FT                   NNNNNNNNNNNNNNNNNNNNNNNNNNNSNNIKNNVDNNNTNPADNIPTLSNEAFTPSQQ
FT                   FSQERVNNNADRCENSSFTNVQQHFQAQTYKQMKKRRAQIQKNLRAIFIYPLSYIGIWL
FT                   FPIIADALQYNHEIKHGPTMWVTYIDTCVRPLSCLVDVIVYLFKEKPWNYSWAKTESKY
FT                   LIEKYILKGELGEKEILKFCHSNWGKRGWYYRGKWKKRKCWKYSTNPLKRILWFVERFF
FT                   KQLFELKLHFSFYDNCDDFEYWENYYSAKDSNDNKRTESDETKTNSSDRSLPSNSLELQ
FT                   AMLNNITAEEVEVPLFWRIIHHIPMLGGIDLDELNRLLKIRYNNDHFSLPGLKFALNQN
FT                   KSHDKHQDVSTNSMVKSSFFSSNIVTNDDENSIEEDKNLRYSDASASENYLVKPTIPGT
FT                   TPDPIIEAQNDNDSSDSSGIDLIAFLRNGPL"
FT   gene            complement(392659..393912)
FT                   /gene="SLM3"
FT                   /gene_synonym="MTO2"
FT                   /gene_synonym="MTU1"
FT                   /locus_tag="YDL033C"
FT   mRNA            complement(392659..393912)
FT                   /gene="SLM3"
FT                   /gene_synonym="MTO2"
FT                   /gene_synonym="MTU1"
FT                   /locus_tag="YDL033C"
FT                   /product="tRNA-5-taurinomethyluridine 2-sulfurtransferase"
FT   CDS_pept        complement(392659..393912)
FT                   /codon_start=1
FT                   /gene="SLM3"
FT                   /gene_synonym="MTO2"
FT                   /gene_synonym="MTU1"
FT                   /locus_tag="YDL033C"
FT                   /product="tRNA-5-taurinomethyluridine 2-sulfurtransferase"
FT                   /EC_number="2.8.1.14"
FT                   /note="tRNA-specific 2-thiouridylase; responsible for
FT                   2-thiolation of the wobble base of mitochondrial tRNAs;
FT                   human homolog TRMU is implicated in myoclonus epilepsy
FT                   associated with ragged red fibers (MERRF), and can
FT                   complement yeast null mutant"
FT                   /db_xref="GOA:Q12093"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12093"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:15944150|PMID:14562095]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0061708
FT                   tRNA-5-taurinomethyluridine 2-sulfurtransferase
FT                   [PMID:15509579]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1990799
FT                   mitochondrial tRNA wobble position uridine thiolation
FT                   [PMID:15509579]"
FT                   /protein_id="DAA11820.1"
FT                   /translation="MLARYLNLIGRRSASPYRPQRLPAKFDNVIVAMSSGVDSSVAAAL
FT                   FAGEFPNTRGVYMQNWSESQSLDDPGKEPCYERDWRDVNRVAKHLNIRVDKVNFEQDYW
FT                   IDVFEPMLRGYSEGSTPNPDIGCNKFVKFGKLREWLDEKYGTGNYWLVTGHYARVMQEM
FT                   NGKGLFHLLRSIYRPKDQSYYLSQINSTVLSSLLLPIGHLTKPEVRDLAKYAGLPTAEK
FT                   PDSQGICFVNNSQHGKFKNFLKHYLPSSPGDIITVDPQSGAKTTWGRHDGLWSYTIGQK
FT                   VGISMPQADPNYQGTWFVSEKLRDTNEILIVRGRDNPALYSDTMRIENFSSLGPREDTI
FT                   NAFQNTGALTLQFRSLQVPVQIKSCKLNRSADNLDITIHLASKQRAITPGQSCCLYIDD
FT                   RVLGSGPISHVNNNDTHA"
FT   gene            394217..397204
FT                   /gene="DBP10"
FT                   /locus_tag="YDL031W"
FT   mRNA            394217..397204
FT                   /gene="DBP10"
FT                   /locus_tag="YDL031W"
FT                   /product="putative ATP-dependent RNA helicase DBP10"
FT   CDS_pept        394217..397204
FT                   /codon_start=1
FT                   /gene="DBP10"
FT                   /locus_tag="YDL031W"
FT                   /product="putative ATP-dependent RNA helicase DBP10"
FT                   /EC_number="3.6.4.13"
FT                   /note="Putative ATP-dependent RNA helicase of the DEAD-box
FT                   protein family; constituent of 66S pre-ribosomal particles;
FT                   essential protein involved in ribosome biogenesis"
FT                   /db_xref="GOA:Q12389"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012541"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033517"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12389"
FT                   /experiment="EXISTENCE:direct assay:GO:0005730 nucleolus
FT                   [PMID:10871363]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0030687
FT                   preribosome, large subunit precursor [PMID:16803892]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000463
FT                   maturation of LSU-rRNA from tricistronic rRNA transcript
FT                   (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:10871363]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000466
FT                   maturation of 5.8S rRNA from tricistronic rRNA transcript
FT                   (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:10871363]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1902626 assembly
FT                   of large subunit precursor of preribosome [PMID:22735702]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0030687
FT                   preribosome, large subunit precursor
FT                   [PMID:16095611|PMID:16803892]"
FT                   /protein_id="DAA11821.2"
FT                   /translation="MAGVQKRKRDLEDQDDNGSEEDDIAFDIANEIALNDSESDANDSD
FT                   SEVEADYGPNDVQDVIEYSSDEEEGVNNKKKAENKDIKKKKNSKKEIAAFPMLEMSDDE
FT                   NNASGKTQTGDDEDDVNEYFSTNNLEKTKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPI
FT                   QRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQ
FT                   TFNVFKDFARGTELRSVLLTGGDSLEEQFGMMMTNPDVIIATPGRFLHLKVEMNLDLKS
FT                   VEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLV
FT                   RLDAETKVSENLEMLFLSSKNADREANLLYILQEIIKIPLATSEQLQKLQNSNNEADSD
FT                   SDDENDRQKKRRNFKKEKFRKQKMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYL
FT                   ISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFV
FT                   HRVGRTARAGNKGWAYSIVAENELPYLLDLELFLGKKILLTPMYDSLVDVMKKRWIDEG
FT                   KPEYQFQPPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMSSNFDLQLAKKTAMKAEKLYY
FT                   RTRTSASPESLKRSKEIISSGWDAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEFTRN
FT                   PDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYTVS
FT                   EDALKEFEDADQLLEAQENENKKKKKPKSFKDPTFFLSHYAPAGDIQDKQLQITNGFAN
FT                   DAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRS
FT                   GRFDDWSKARNLKPLKVGSRETSIPSNLLEDPSQGPAANGRTVRGKFKHKQMKAPKMPD
FT                   KHRDNYYSQKKKVEKALQSGISVKGYNNAPGLRSELKSTEQIRKDRIIAEKKRAKNARP
FT                   SKKRKF"
FT   gene            397537..399129
FT                   /gene="PRP9"
FT                   /locus_tag="YDL030W"
FT   mRNA            397537..399129
FT                   /gene="PRP9"
FT                   /locus_tag="YDL030W"
FT                   /product="SF3a splicing factor complex subunit PRP9"
FT   CDS_pept        397537..399129
FT                   /codon_start=1
FT                   /gene="PRP9"
FT                   /locus_tag="YDL030W"
FT                   /product="SF3a splicing factor complex subunit PRP9"
FT                   /note="Subunit of the SF3a splicing factor complex;
FT                   required for spliceosome assembly; acts after the formation
FT                   of the U1 snRNP-pre-mRNA complex"
FT                   /db_xref="GOA:P19736"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR024598"
FT                   /db_xref="InterPro:IPR031590"
FT                   /db_xref="InterPro:IPR031774"
FT                   /db_xref="InterPro:IPR031776"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="PDB:4DGW"
FT                   /db_xref="PDB:5NRL"
FT                   /db_xref="PDB:5ZWM"
FT                   /db_xref="PDB:5ZWO"
FT                   /db_xref="PDB:6G90"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19736"
FT                   /experiment="EXISTENCE:direct assay:GO:0000398 mRNA
FT                   splicing, via spliceosome [PMID:8969185]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003723 RNA binding
FT                   [PMID:8065365]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071004 U2-type
FT                   prespliceosome [PMID:16618970]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000395 mRNA
FT                   5'-splice site recognition [PMID:2147224]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000398 mRNA
FT                   splicing, via spliceosome [PMID:2147224]"
FT                   /protein_id="DAA11822.1"
FT                   /translation="MNLLETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSKVFPD
FT                   TKLPRSSLIAENKIYKFKKVKRKRKQIILQQHEINIFLRDYQEKQQTFNKINRPEETQE
FT                   DDKDLPNFERKLQQLEKELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARD
FT                   LDLNEIFTRDEQYGEYMELEQFHSLWLNVIKRGDCSLLQFLDILELFLDDEKYLLTPPM
FT                   DRKNDRYMAFLLKLSKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIY
FT                   CPFCSRWFKTSSVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVE
FT                   RKLAFTANERMAEMDILTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMP
FT                   LGPDGLPMPYWLYKLHGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPS
FT                   SVFKGITKIKEAQELWKNMQGQSQLTSIAAVPPKPNPSQLKVPTELELEEEDEEGNVMS
FT                   KKVYDELKKQGLV"
FT   gene            399340..400638
FT                   /gene="ARP2"
FT                   /gene_synonym="ACT2"
FT                   /locus_tag="YDL029W"
FT   mRNA            join(399340..399361,399485..400638)
FT                   /gene="ARP2"
FT                   /gene_synonym="ACT2"
FT                   /locus_tag="YDL029W"
FT                   /product="actin-related protein 2"
FT   CDS_pept        join(399340..399361,399485..400638)
FT                   /codon_start=1
FT                   /gene="ARP2"
FT                   /gene_synonym="ACT2"
FT                   /locus_tag="YDL029W"
FT                   /product="actin-related protein 2"
FT                   /note="Essential component of the Arp2/3 complex; Arp2/3 is
FT                   a highly conserved actin nucleation center required for the
FT                   motility and integrity of actin patches; involved in
FT                   endocytosis and membrane growth and polarity; required for
FT                   efficient Golgi-to-ER trafficking in COPI mutants"
FT                   /db_xref="GOA:P32381"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="InterPro:IPR027306"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32381"
FT                   /experiment="EXISTENCE:direct assay:GO:0005524 ATP binding
FT                   [PMID:15657399]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:11248049]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005885 Arp2/3
FT                   protein complex [PMID:10377407]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000001
FT                   mitochondrion inheritance [PMID:11248049]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005524 ATP
FT                   binding [PMID:15657399]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016887 ATPase
FT                   activity [PMID:16862144]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030476
FT                   ascospore wall assembly [PMID:17118118]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0032258 protein
FT                   localization by the Cvt pathway [PMID:18287533]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034314 Arp2/3
FT                   complex-mediated actin nucleation [PMID:16862144]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0044396 actin
FT                   cortical patch organization [PMID:10377407]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0051654
FT                   establishment of mitochondrion localization
FT                   [PMID:16107558]"
FT                   /protein_id="DAA11823.1"
FT                   /translation="MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA
FT                   SVATPLKDIMIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNG
FT                   KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVT
FT                   HIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV
FT                   SYDLDLDTKLARETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELL
FT                   FNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFK
FT                   VRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGPSAMTKFGPR"
FT   gene            complement(400997..403291)
FT                   /gene="MPS1"
FT                   /gene_synonym="PAC8"
FT                   /gene_synonym="RPK1"
FT                   /locus_tag="YDL028C"
FT   mRNA            complement(400997..403291)
FT                   /gene="MPS1"
FT                   /gene_synonym="PAC8"
FT                   /gene_synonym="RPK1"
FT                   /locus_tag="YDL028C"
FT                   /product="serine/threonine/tyrosine protein kinase MPS1"
FT   CDS_pept        complement(400997..403291)
FT                   /codon_start=1
FT                   /gene="MPS1"
FT                   /gene_synonym="RPK1"
FT                   /gene_synonym="PAC8"
FT                   /locus_tag="YDL028C"
FT                   /product="serine/threonine/tyrosine protein kinase MPS1"
FT                   /EC_number="2.7.12.2"
FT                   /note="Dual-specificity kinase; autophosphorylation
FT                   required for function; required for spindle pole body (SPB)
FT                   duplication and spindle checkpoint function; contributes to
FT                   bi-orientation by promoting formation of force-generating
FT                   kinetochore-microtubule attachments in meiosis I;
FT                   substrates include SPB proteins Spc42p, Spc110p, and
FT                   Spc98p, mitotic exit network protein Mob1p, kinetochore
FT                   protein Cnn1p, and checkpoint protein Mad1p; substrate of
FT                   APCC(Cdh1); similar to human Mps1p"
FT                   /db_xref="GOA:P54199"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016242"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027084"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54199"
FT                   /experiment="EXISTENCE:direct assay:GO:0000778 condensed
FT                   nuclear chromosome kinetochore [PMID:11827982]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004672 protein
FT                   kinase activity [PMID:16319894]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004674 protein
FT                   serine/threonine kinase activity
FT                   [PMID:11278681|PMID:25382489]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004712 protein
FT                   serine/threonine/tyrosine kinase activity [PMID:7737118]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005816 spindle pole
FT                   body [PMID:11827982]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006468 protein
FT                   phosphorylation
FT                   [PMID:11278681|PMID:11827982|PMID:16890524|PMID:24402315|P
FT                   MID:25382489|PMID:8688079|PMID:16319894|PMID:9436989]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043515 kinetochore
FT                   binding [PMID:31405987]"
FT                   /experiment="EXISTENCE:direct assay:GO:0046777 protein
FT                   autophosphorylation
FT                   [PMID:7737118|PMID:31405987|PMID:9436989]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0007094
FT                   mitotic spindle assembly checkpoint [PMID:8567717]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0034501
FT                   protein localization to kinetochore [PMID:24402315]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004712 protein
FT                   serine/threonine/tyrosine kinase activity [PMID:15668173]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006468 protein
FT                   phosphorylation
FT                   [PMID:11278681|PMID:11827982|PMID:24402315|PMID:8688079]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007094 mitotic
FT                   spindle assembly checkpoint [PMID:8567717]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030474 spindle
FT                   pole body duplication [PMID:1869587]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031134 sister
FT                   chromatid biorientation [PMID:18060784]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0051225 spindle
FT                   assembly [PMID:15668173]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0051988
FT                   regulation of attachment of spindle microtubules to
FT                   kinetochore [PMID:23334295]"
FT                   /protein_id="DAA11824.2"
FT                   /translation="MSTNSFHDYVDLKSRTNTRQFSDDEEFTTPPKLSNFGSALLSHTE
FT                   KTSASEILSSHNNDKIANRLEEMDRSSSRSHPPPSMGNLTSGHTSTSSHSTLFGRYLRN
FT                   NHQTSMTTMNTSDIEINVGNSLDKSFERIRNLRQNMKEDITAKYAERRSKRFLISNRTT
FT                   KLGPAKRAMTLTNIFDEDVPNSPNQPINARETVELPLEDSHQTNFKETKRNTDYDSIDF
FT                   GDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALRKHSSRELLYKSRSSSSSLS
FT                   SNNLLANKDNSITSNNGSQPRRKVSTGSSSSKSSIEIRRALKENIDTSNNSNFNSPIHK
FT                   IYKGISRNKDSDSEKREVLRNISINANHADNLLQQENKRLKRSLDDAITNENINSKNLE
FT                   VFYHRPAPKPPVTKKVEIVEPAKSASLSNNRNIITVNDSQYEKIELLGRGGSSRVYKVK
FT                   GSGNRVYALKRVSFDAFDDSSIDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIME
FT                   CGDHDLSQILNQRSGMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGIL
FT                   KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPS
FT                   DMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPKSAIELMK
FT                   ACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIRNAVRYGSEKPHISQDDLNDVVD
FT                   TVLRKFADYKI"
FT   gene            complement(403695..404957)
FT                   /gene="MRX9"
FT                   /locus_tag="YDL027C"
FT   mRNA            complement(403695..404957)
FT                   /gene="MRX9"
FT                   /locus_tag="YDL027C"
FT                   /product="Mrx9p"
FT   CDS_pept        complement(403695..404957)
FT                   /codon_start=1
FT                   /gene="MRX9"
FT                   /locus_tag="YDL027C"
FT                   /product="Mrx9p"
FT                   /note="Protein that associates with mitochondrial ribosome;
FT                   the authentic, non-tagged protein is detected in highly
FT                   purified mitochondria in high-throughput studies; YDL027C
FT                   is not an essential gene"
FT                   /db_xref="GOA:Q07349"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q07349"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14562095|PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:26928762]"
FT                   /protein_id="DAA11825.1"
FT                   /translation="MFKVPVGLASRTRELMNSVTLNSLNNGKGFNMYLPGILRAFPKPV
FT                   PSAITSPAIPKYRGESFQFRKLSCISSNYCSTTHQFLSSLKSSTSRLVGKRAFHSSRRA
FT                   EIKFIFSSKSPKNGNKPFVKVYKVSPFFIIFATASIFTFILTSTIVVIPLIFHFFFPLL
FT                   IMFFFFKQFKKWQKNIFYKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISSRMGIP
FT                   NEFAKGLNVDLVKQEETRKQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDL
FT                   ELDIDNCRSELRKFQTFIFSSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDES
FT                   FPAIMFNGGAYSKADFFKILQESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGE
FT                   FFSKYNISKINDKNTEYTLKE"
FT   gene            complement(405344..407206)
FT                   /gene="RTK1"
FT                   /locus_tag="YDL025C"
FT   mRNA            complement(405344..407206)
FT                   /gene="RTK1"
FT                   /locus_tag="YDL025C"
FT                   /product="putative serine/threonine protein kinase RTK1"
FT   CDS_pept        complement(405344..407206)
FT                   /codon_start=1
FT                   /gene="RTK1"
FT                   /locus_tag="YDL025C"
FT                   /product="putative serine/threonine protein kinase RTK1"
FT                   /EC_number="2.7.11.1"
FT                   /note="Putative protein kinase, potentially phosphorylated
FT                   by Cdc28p; interacts with ribosome biogenesis factors,
FT                   Cka2, Gus1 and Arc1; protein abundance increases in
FT                   response to DNA replication stress"
FT                   /db_xref="GOA:Q12100"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12100"
FT                   /experiment="EXISTENCE:direct assay:GO:0005935 cellular bud
FT                   neck [PMID:23785265]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:23785265]"
FT                   /protein_id="DAA11826.1"
FT                   /translation="MVKETPLHSSSSTSLSSLFRPTKLKNLSAKIFNGGGNQSYSKTDD
FT                   VSRSSSRSSKKNTDSDQEDQIKYNKPNDRRSTIGKSPQGNGALSKESHVVASSTLTGIS
FT                   PTSAKKAPIDYSPSRPLPNNHNPVRTGHTVPHLPHSIHNPINYIHQGSKDAFHHPHPVR
FT                   STAHSNISTVSSAKSDTPSSNLSYQAHMHPVEILQKQIEDKHFMDSQASTPGSVELQHN
FT                   SSSGSDDTSSRKKKSLRLTRFFKKIHNDYHDNHHHHHHHNRGSTPTKPKLNLNTNENIV
FT                   ESNGKALYETDNPVELLEKYGIPGRKLGEGASGSVSVVERTDGKLFACKMFRKPHLNNE
FT                   GTNQSQLANYSKKVTTEFCIGSTLHHENIVETLDMLTEGDTYLLVMEYAPYDFFNLVMS
FT                   NLMTQDEVNCYFKQLCHGVNYLHSMGLAHRDLKLDNCVVTKDGILKLIDFGSAVVFQYP
FT                   YEDTIVKSHGIVGSDPYLAPELLKQTSYDPRVADVWSIAIIFYCMVLKRFPWKAPKKSF
FT                   NSFRLFTEEPEDEDDIVRGPNKILRLLPRHSRTIIGRMLALEPKQRVLMNDVVKDDWLV
FT                   SVPSCEVDPTSGDLVEKPKNHKHHLVTEEELNELTKQHGNKDSN"
FT   rep_origin      408075..408316
FT                   /note="ARS414; Autonomously Replicating Sequence"
FT   gene            complement(408451..409857)
FT                   /gene="DIA3"
FT                   /locus_tag="YDL024C"
FT   mRNA            complement(408451..409857)
FT                   /gene="DIA3"
FT                   /locus_tag="YDL024C"
FT                   /product="putative acid phosphatase DIA3"
FT   CDS_pept        complement(408451..409857)
FT                   /codon_start=1
FT                   /gene="DIA3"
FT                   /locus_tag="YDL024C"
FT                   /product="putative acid phosphatase DIA3"
FT                   /EC_number="3.1.3.2"
FT                   /note="hypothetical protein; involved in invasive and
FT                   pseudohyphal growth"
FT                   /db_xref="GOA:P52290"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR016274"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="InterPro:IPR033379"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52290"
FT                   /experiment="EXISTENCE:direct assay:GO:0009277 fungal-type
FT                   cell wall [PMID:11935221]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0001403
FT                   invasive growth in response to glucose limitation
FT                   [PMID:11063681]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007124
FT                   pseudohyphal growth [PMID:11063681]"
FT                   /protein_id="DAA11827.1"
FT                   /translation="MVKPVIFAICLGVLLSKALSIPLRSFADIELIGSQKSLFPFLGGS
FT                   APYFSFPANYGIPTDIPEGCRLTQVQMIGRHGERYPTRSEAKDIFEVWYKISNYTGKYE
FT                   GSLSFLNNGYEFFIPDESLLEMETTLQNSIDVLNPYTGEMNAKRHAREFLAKYGKLMEN
FT                   CTNFPIFTTNSKRIYDTAQYFAEALGDGFNISLQTLSENSSSGANTLAAKSSCPNWNSN
FT                   ANNDILMSYSRDYLENISDRLNDENKGLNLSRKDAAALFSWCAFELNAKGYSNICDIFS
FT                   AAELIHYSYETDLTSFYQNGPGYKLIKSIGANLFNATVKLIRQSAHLDQKVWLSFTHDT
FT                   DILNYLTTAGLIDDTRNLTTNHVPFRDHSYHRSWYIPQGARVYTEKFQCSNDSYVRYVV
FT                   NDAVVPIESCSSGPGFSCEEGTFYEYAKDRLRGVSFYEDCDVSKVSKEKELTFYWDWNT
FT                   TRYNASLVNQ"
FT   gene            complement(409808..410056)
FT                   /locus_tag="YDL022C-A"
FT   mRNA            complement(409808..410056)
FT                   /locus_tag="YDL022C-A"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(409808..410056)
FT                   /codon_start=1
FT                   /locus_tag="YDL022C-A"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; SWAT-GFP and mCherry fusion
FT                   proteins localize to the cytosol; partially overlaps the
FT                   verified gene DIA3; identified by fungal homology and
FT                   RT-PCR; mRNA identified as translated by ribosome profiling
FT                   data"
FT                   /db_xref="GOA:P0C5L6"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C5L6"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:26928762]"
FT                   /protein_id="DAA35098.1"
FT                   /translation="MYYLVPKTTYGNLQCSSLAMTFHERGESGDVLSCACRLYLYIMPL
FT                   FFNTFLRQKYFQLCSNTPYRNNGEARYFCHLFRCSII"
FT   gene            410379..410451
FT                   /locus_tag="tA(AGC)D"
FT   tRNA            410379..410451
FT                   /locus_tag="tA(AGC)D"
FT                   /product="tRNA-Ala"
FT                   /note="tA(AGC)D; Alanine tRNA (tRNA-Ala), predicted by
FT                   tRNAscan-SE analysis; one of 11 nuclear tRNA genes
FT                   containing the tDNA-anticodon AGC (converted to IGC in the
FT                   mature tRNA), decodes GCU and GCC codons into alanine, one
FT                   of 16 nuclear tRNAs for alanine"
FT                   /experiment="EXISTENCE:curator inference:GO:0005829 cytosol
FT                   [PMID:9023104]"
FT                   /experiment="EXISTENCE:curator inference:GO:0006414
FT                   translational elongation [PMID:9023104]"
FT   gene            411825..413000
FT                   /gene="GPD1"
FT                   /gene_synonym="DAR1"
FT                   /gene_synonym="HOR1"
FT                   /gene_synonym="OSG1"
FT                   /gene_synonym="OSR5"
FT                   /locus_tag="YDL022W"
FT   mRNA            411825..413000
FT                   /gene="GPD1"
FT                   /gene_synonym="DAR1"
FT                   /gene_synonym="HOR1"
FT                   /gene_synonym="OSG1"
FT                   /gene_synonym="OSR5"
FT                   /locus_tag="YDL022W"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD(+)) GPD1"
FT   CDS_pept        411825..413000
FT                   /codon_start=1
FT                   /gene="GPD1"
FT                   /gene_synonym="DAR1"
FT                   /gene_synonym="HOR1"
FT                   /gene_synonym="OSG1"
FT                   /gene_synonym="OSR5"
FT                   /locus_tag="YDL022W"
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD(+)) GPD1"
FT                   /EC_number="1.1.1.8"
FT                   /note="NAD-dependent glycerol-3-phosphate dehydrogenase;
FT                   key enzyme of glycerol synthesis, essential for growth
FT                   under osmotic stress; expression regulated by
FT                   high-osmolarity glycerol response pathway; protein
FT                   abundance increases in response to DNA replication stress;
FT                   constitutively inactivated via phosphorylation by the
FT                   protein kinases Ypk1p and Ypk2p, dephosphorylation
FT                   increases catalytic activity; forms a heterodimer with
FT                   Pnc1p to facilitate its peroxisomal import"
FT                   /db_xref="GOA:Q00055"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR017751"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:4FGW"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00055"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:20026609]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005777 peroxisome
FT                   [PMID:15210723]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:15210723]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004367
FT                   glycerol-3-phosphate dehydrogenase [NAD+] activity
FT                   [PMID:8196651]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006116 NADH
FT                   oxidation [PMID:9171333]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006973
FT                   intracellular accumulation of glycerol [PMID:8196651]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016558 protein
FT                   import into peroxisome matrix [PMID:26276932]"
FT                   /protein_id="DAA11828.1"
FT                   /translation="MSAAADRLNLTSGHLNAGRKRSSSSVSLKAAEKPFKVTVIGSGNW
FT                   GTTIAKVVAENCKGYPEVFAPIVQMWVFEEEINGEKLTEIINTRHQNVKYLPGITLPDN
FT                   LVANPDLIDSVKDVDIIVFNIPHQFLPRICSQLKGHVDSHVRAISCLKGFEVGAKGVQL
FT                   LSSYITEELGIQCGALSGANIATEVAQEHWSETTVAYHIPKDFRGEGKDVDHKVLKALF
FT                   HRPYFHVSVIEDVAGISICGALKNVVALGCGFVEGLGWGNNASAAIQRVGLGEIIRFGQ
FT                   MFFPESREETYYQESAGVADLITTCAGGRNVKVARLMATSGKDAWECEKELLNGQSAQG
FT                   LITCKEVHEWLETCGSVEDFPLFEAVYQIVYNNYPMKNLPDMIEELDLHED"
FT   gene            413953..414888
FT                   /gene="GPM2"
FT                   /locus_tag="YDL021W"
FT   mRNA            413953..414888
FT                   /gene="GPM2"
FT                   /locus_tag="YDL021W"
FT                   /product="phosphoglycerate mutase family protein GPM2"
FT   CDS_pept        413953..414888
FT                   /codon_start=1
FT                   /gene="GPM2"
FT                   /locus_tag="YDL021W"
FT                   /product="phosphoglycerate mutase family protein GPM2"
FT                   /EC_number="5.4.2.11"
FT                   /note="Nonfunctional homolog of Gpm1p phosphoglycerate
FT                   mutase; if functional, would convert 3-phosphoglycerate to
FT                   2-phosphoglycerate in glycolysis; GPM2 has a paralog, GPM3,
FT                   that arose from the whole genome duplication"
FT                   /db_xref="GOA:Q12008"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12008"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:24146988|PMID:11914276]"
FT                   /protein_id="DAA11829.1"
FT                   /translation="MTASTPSNVMTLFLLRHGQSELNHENIFCGWIDAKLTEKGKEQAR
FT                   HSAELIEQYCKANNLRLPQIGYTSRLIRTQQTIETMCEEFKLKPQLQVVYDFNKIKLGD
FT                   EFGSDDKDNMKIPILQTWRLNERHYGSWQGQRKPNVLKEYGKDKYMFIRRDYEGKPPPV
FT                   DLDREMIQQENEKGSSTGYEFKEPNRQIKYELECSNHDIVLPDSESLREVVYRLNPFLQ
FT                   NVILKLANQYDESSCLIVGHGSSVRSLLKILEGISDDDIKNVDIPNGIPLVVELDKNNG
FT                   LKFIRKFYLDPESAKINAEKVRNEGFIKNP"
FT   gene            complement(415113..416708)
FT                   /gene="RPN4"
FT                   /gene_synonym="SON1"
FT                   /gene_synonym="UFD5"
FT                   /locus_tag="YDL020C"
FT   mRNA            complement(415113..416708)
FT                   /gene="RPN4"
FT                   /gene_synonym="SON1"
FT                   /gene_synonym="UFD5"
FT                   /locus_tag="YDL020C"
FT                   /product="stress-regulated transcription factor RPN4"
FT   CDS_pept        complement(415113..416708)
FT                   /codon_start=1
FT                   /gene="RPN4"
FT                   /gene_synonym="SON1"
FT                   /gene_synonym="UFD5"
FT                   /locus_tag="YDL020C"
FT                   /product="stress-regulated transcription factor RPN4"
FT                   /note="Transcription factor that stimulates expression of
FT                   proteasome genes; Rpn4p levels are in turn regulated by the
FT                   26S proteasome in a negative feedback control mechanism;
FT                   RPN4 is transcriptionally regulated by various stress
FT                   responses; relative distribution to the nucleus increases
FT                   upon DNA replication stress"
FT                   /db_xref="GOA:Q03465"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03465"
FT                   /experiment="EXISTENCE:direct assay:GO:0000978 RNA
FT                   polymerase II proximal promoter sequence-specific DNA
FT                   binding [PMID:10350051]"
FT                   /experiment="EXISTENCE:direct assay:GO:0001228 DNA-binding
FT                   transcription activator activity, RNA polymerase
FT                   II-specific [PMID:10350051]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:19914394|PMID:8514125|PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0045944 positive
FT                   regulation of transcription by RNA polymerase II
FT                   [PMID:10350051|PMID:19914394]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0045944
FT                   positive regulation of transcription by RNA polymerase II
FT                   [PMID:15178333]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000122 negative
FT                   regulation of transcription by RNA polymerase II
FT                   [PMID:20376190|PMID:11027285]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006282
FT                   regulation of DNA repair [PMID:11027285|PMID:20376190]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0036003 positive
FT                   regulation of transcription from RNA polymerase II promoter
FT                   in response to stress
FT                   [PMID:11027285|PMID:16556235|PMID:18086556|PMID:18627600]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045944 positive
FT                   regulation of transcription by RNA polymerase II
FT                   [PMID:10350051|PMID:11248031|PMID:15178333|PMID:18804109|P
FT                   MID:19914394|PMID:11027285]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0061395 positive
FT                   regulation of transcription from RNA polymerase II promoter
FT                   in response to arsenic-containing substance
FT                   [PMID:27226598|PMID:15575969]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0097201 negative
FT                   regulation of transcription from RNA polymerase II promoter
FT                   in response to stress [PMID:11027285]"
FT                   /protein_id="DAA11830.1"
FT                   /translation="MASTELSLKRTLTDILEDELYHTNPGHSQFTSHYQNYHPNASITP
FT                   YKLVNKNKENNTFTWNHSLQHQNESSAASIPPQQTYHFPIFNKYADPTLTTTTSFTTSE
FT                   ATANDRQINNVHLIPNEIKGASETPLQKTVNLKNIMKVSDPYVPTRNTFNYDVKISNDF
FT                   FDNGDNLYGNDEEVLFYEDNYNPKMQWSLQDNSAAINNEDARAIFNNEFDSDDDDISDD
FT                   EEDEIEENCLQQEQHQEEPLLSLDVTPISMFGSDQKTGRAKSSSHLFNEYSYVDSNMDS
FT                   ISSVVSEDLLDERGHEKIEDEDEDNDLDEDDIYDISLLKNRRKQSFVLNKNTIDFERFP
FT                   SPSTSANVPSTATTGKRKPAKSSSNRSCVSNSNENGTLERIKKPTSAVVSSNASRRKLI
FT                   NYTKKHLSSHSSTNSNSKPSTASPSAHTSSSDGNNEIFTCQIMNLITNEPCGAQFSRSY
FT                   DLTRHQNTIHAKRKIVFRCSECIKILGSEGYQKTFSRLDALTRHIKSKHEDLSLEQRQE
FT                   VTKFAKANIGYVMG"
FT   gene            complement(417663..421514)
FT                   /gene="OSH2"
FT                   /locus_tag="YDL019C"
FT   mRNA            complement(417663..421514)
FT                   /gene="OSH2"
FT                   /locus_tag="YDL019C"
FT                   /product="oxysterol-binding protein related protein OSH2"
FT   CDS_pept        complement(417663..421514)
FT                   /codon_start=1
FT                   /gene="OSH2"
FT                   /locus_tag="YDL019C"
FT                   /product="oxysterol-binding protein related protein OSH2"
FT                   /note="Member of an oxysterol-binding protein family with
FT                   seven members; in S. cerevisiae, family members have
FT                   overlapping, redundant functions in sterol metabolism and
FT                   collectively perform a function essential for viability;
FT                   contains FFAT motif; interacts with ER anchor Scs2p at
FT                   patches at the plasma membrane and at the nuclear envelope;
FT                   regulated by sterol binding; OSH2 has a paralog, SWH1, that
FT                   arose from the whole genome duplication"
FT                   /db_xref="GOA:Q12451"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12451"
FT                   /experiment="EXISTENCE:direct assay:GO:0005635 nuclear
FT                   envelope [PMID:25420878]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:12727870]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:11408574|PMID:25420878]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005935 cellular bud
FT                   neck [PMID:11408574]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008289 lipid
FT                   binding [PMID:20008566]"
FT                   /experiment="EXISTENCE:direct assay:GO:0015918 sterol
FT                   transport [PMID:20008566]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032541 cortical
FT                   endoplasmic reticulum [PMID:20008566]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0120015 sterol
FT                   transfer activity [PMID:20008566]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006887
FT                   exocytosis [PMID:17004323]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006897
FT                   endocytosis [PMID:15173322]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0015918
FT                   sterol transport [PMID:16585271]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0030011
FT                   maintenance of cell polarity [PMID:17004323]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0034727
FT                   piecemeal microautophagy of the nucleus [PMID:15367582]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0035621 ER to
FT                   Golgi ceramide transport [PMID:24213531]"
FT                   /protein_id="DAA11831.1"
FT                   /translation="MSREDLSIAEDLNQVSKPLLKVKLLEVLGQGDFKHLKALVDNEFQ
FT                   PKDDPSVQQVLNLILHYAVQVAPILLIKEIVAHWVDQVGDEKSSSKSDDGIHLDLNYQD
FT                   ENGNTPLHLAAAQSRSDVISFLLSQKSINDCVKNKAHQQPLDMCKDLNVAQMIQLKRDD
FT                   YFLETVHSLRAAMNKRDFSKLDSIWKNPRNLNLLDINGIDPETGTTLLYEYSQKKDIEM
FT                   CQWLLKHGAEATVKDGKGRSPLDLVKNIKLPAKPSNNVTPEIKLKNLLEKNLREQAIVH
FT                   EDVASSKPPTYKGFLKKWTNFAHGYKLRWFILSGDGNLSYYKDQSHVDRPRGTLKVSTC
FT                   RLHIDSSEKLNFELLGGITGTTRWRLKGNHPIETTRWVNAIQSAIRFAKDKEILNKKKA
FT                   VPPSLALKNKSPALISHSKTQGSLPEASQYYQHTLHKEVIQPSSVSLYRRPSNNLSVVS
FT                   SEIQLNDNLTESGKRFVSKMIENRLDGSKTPVGVHTGSALQRVRSSNTLKSNRSMQSGS
FT                   GVASPIDKVPNGANLSQSNTTTGSTASLSDNNYIDNFEGDEANSDDEEEDLGINFDRDE
FT                   EYIKAQYGPYKEKLDMYEQAISIELSSLIELIEQEEPSPEVWLTIKKSLINTSTIFGKL
FT                   KDLTYKRDKRLVDMVSKQGDVNNVWVQSVKELEMELSNKTERLASIDKERRGLKKILHK
FT                   KLLESHATAGNKESLENDKEQESDTTASTLGQIAKFISATKEEDEASDADEFYDAAELV
FT                   DEVTELTEAHPEISTAAAPKHAPPPVPNETDNDSQYVQDEKSKIESNVEKTSQKFEKQN
FT                   NLVTEDEPKTDQSLKNFKAEDKESQVKEKTKEIASSVIGEKTIVAVTTVQKRKEEYLLK
FT                   EGSYLGYEDGIRKRLSMDKDDRPKISLWAVLKSMVGKDMTRMTLPVTFNEPTSLLQRVA
FT                   EDLEYSELLDQAATFEDSTLRTLYVAAFTASSYASTTKRVAKPFNPLLGETFEYSRPDK
FT                   QYRFFTEQVSHHPPISATWTESPRWDFWGESFVDTKFNGRSFNVKHLGLWHIKLRPNDN
FT                   EKEELYTWKKPNNTVIGILIGNPQVDNHGEVNVVNHTTGDHCKLYFKARGWRSSGAYEI
FT                   TGEVYNKKKQKVWILGGHWNEAIFAKKVVKDGDLSLEKTRTAASAGNGPTDDGTKFLIW
FT                   KANDRPEEPFNLTPFAITLNAPQPHLLPWLPPTDTRLRPDQRAMEDGRYDEAGDEKFRV
FT                   EEKQRAARRKREENNLEYHPQWFVRDTHPITKAKYWRYTGKYWVKRRDHDLKDCGDIF"
FT   gene            complement(422833..423510)
FT                   /gene="ERP3"
FT                   /locus_tag="YDL018C"
FT   mRNA            complement(422833..423510)
FT                   /gene="ERP3"
FT                   /locus_tag="YDL018C"
FT                   /product="Erp3p"
FT   CDS_pept        complement(422833..423510)
FT                   /codon_start=1
FT                   /gene="ERP3"
FT                   /locus_tag="YDL018C"
FT                   /product="Erp3p"
FT                   /note="Protein with similarity to Emp24p and Erv25p; member
FT                   of the p24 family involved in ER to Golgi transport"
FT                   /db_xref="GOA:Q12403"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12403"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:26928762]"
FT                   /protein_id="DAA11832.1"
FT                   /translation="MSNLCVLFFQFFFLAQFFAEASPLTFELNKGRKECLYTLTPEIDC
FT                   TISYYFAVQQGESNDFDVNYEIFAPDDKNKPIIERSGERQGEWSFIGQHKGEYAICFYG
FT                   GKAHDKIVDLDFKYNCERQDDIRNERRKARKAQRNLRDSKTDPLQDSVENSIDTIERQL
FT                   HVLERNIQYYKSRNTRNHHTVCSTEHRIVMFSIYGILLIIGMSCAQIAILEFIFRESRK
FT                   HNV"
FT   gene            424209..425732
FT                   /gene="CDC7"
FT                   /gene_synonym="LSD6"
FT                   /gene_synonym="SAS1"
FT                   /locus_tag="YDL017W"
FT   mRNA            424209..425732
FT                   /gene="CDC7"
FT                   /gene_synonym="LSD6"
FT                   /gene_synonym="SAS1"
FT                   /locus_tag="YDL017W"
FT                   /product="serine/threonine protein kinase CDC7"
FT   CDS_pept        424209..425732
FT                   /codon_start=1
FT                   /gene="CDC7"
FT                   /gene_synonym="LSD6"
FT                   /gene_synonym="SAS1"
FT                   /locus_tag="YDL017W"
FT                   /product="serine/threonine protein kinase CDC7"
FT                   /EC_number="2.7.11.1"
FT                   /note="Ser/Thr kinase and catalytic subunit of DDK
FT                   (Dbf4-dependent kinase); required for origin firing and
FT                   replication initiation; phosphorylates MCM subunits and
FT                   Cdc45p to drive assembly of the pre-IC and the replicative
FT                   CMG helicase (Cdc45-MCM-GINS); regulates pre-meiotic DNA
FT                   replication, meiotic DSB formation, monopolar attachment of
FT                   homologs during MI by recruiting monopolin to kinetochores,
FT                   and regulation of middle meiotic genes including NDT80;
FT                   complemented by co-expression of human CDC7 and DBF4"
FT                   /db_xref="GOA:P06243"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="PDB:5T2S"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06243"
FT                   /experiment="EXISTENCE:direct assay:GO:0000775 chromosome,
FT                   centromeric region [PMID:23746350]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000785 chromatin
FT                   [PMID:10508166]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004674 protein
FT                   serine/threonine kinase activity
FT                   [PMID:23314252|PMID:10508166|PMID:10805723|PMID:18245450|P
FT                   MID:19692334|PMID:9407029|PMID:25602519]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:2023904]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006468 protein
FT                   phosphorylation
FT                   [PMID:10508166|PMID:10805723|PMID:9407029|PMID:25602519]"
FT                   /experiment="EXISTENCE:direct assay:GO:0018105
FT                   peptidyl-serine phosphorylation
FT                   [PMID:23314252|PMID:18245450|PMID:19692334|PMID:25602519]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031334 positive
FT                   regulation of protein complex assembly [PMID:26912723]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031431
FT                   Dbf4-dependent protein kinase complex [PMID:19692334]"
FT                   /experiment="EXISTENCE:direct assay:GO:0046777 protein
FT                   autophosphorylation [PMID:10508166]"
FT                   /experiment="EXISTENCE:direct assay:GO:1902977 mitotic DNA
FT                   replication preinitiation complex assembly
FT                   [PMID:21729781|PMID:26338774]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006468
FT                   protein phosphorylation [PMID:19013276]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0010673
FT                   positive regulation of transcription from RNA polymerase II
FT                   promoter involved in meiotic cell cycle
FT                   [PMID:18245451|PMID:22106412]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0018105
FT                   peptidyl-serine phosphorylation [PMID:18245451]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0031431
FT                   Dbf4-dependent protein kinase complex [PMID:8474449]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0033314
FT                   mitotic DNA replication checkpoint [PMID:18372119]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0034629
FT                   cellular protein-containing complex localization
FT                   [PMID:19013276]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0060903
FT                   positive regulation of meiosis I [PMID:18245451]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:1904968
FT                   positive regulation of attachment of spindle microtubules
FT                   to kinetochore involved in homologous chromosome
FT                   segregation [PMID:19013276]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:1905263
FT                   positive regulation of meiotic DNA double-strand break
FT                   formation involved in reciprocal meiotic recombination
FT                   [PMID:18245451|PMID:19013276]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000727
FT                   double-strand break repair via break-induced replication
FT                   [PMID:20516198]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004674 protein
FT                   serine/threonine kinase activity
FT                   [PMID:2023904|PMID:2166954|PMID:10508166|PMID:10805723|PMI
FT                   D:18245450]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006270 DNA
FT                   replication initiation [PMID:9472018]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006279
FT                   premeiotic DNA replication [PMID:16319063]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006468 protein
FT                   phosphorylation
FT                   [PMID:2023904|PMID:2166954|PMID:10508166|PMID:10805723]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0010673 positive
FT                   regulation of transcription from RNA polymerase II promoter
FT                   involved in meiotic cell cycle [PMID:22106412]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0018105
FT                   peptidyl-serine phosphorylation
FT                   [PMID:18245450|PMID:22106412]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0018107
FT                   peptidyl-threonine phosphorylation [PMID:22106412]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031938
FT                   regulation of chromatin silencing at telomere
FT                   [PMID:16980387]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034629 cellular
FT                   protein-containing complex localization [PMID:19013276]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0046777 protein
FT                   autophosphorylation [PMID:10508166]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1902977 mitotic
FT                   DNA replication preinitiation complex assembly
FT                   [PMID:21729781]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1904968 positive
FT                   regulation of attachment of spindle microtubules to
FT                   kinetochore involved in homologous chromosome segregation
FT                   [PMID:19013276]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1905263 positive
FT                   regulation of meiotic DNA double-strand break formation
FT                   involved in reciprocal meiotic recombination
FT                   [PMID:18245450]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0001100
FT                   negative regulation of exit from mitosis [PMID:19478884]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0031431
FT                   Dbf4-dependent protein kinase complex [PMID:8474449]"
FT                   /protein_id="DAA11833.1"
FT                   /translation="MTSKTKNIDDIPPEIKEEMIQLYHDLPGIENEYKLIDKIGEGTFS
FT                   SVYKAKDITGKITKKFASHFWNYGSNYVALKKIYVTSSPQRIYNELNLLYIMTGSSRVA
FT                   PLCDAKRVRDQVIAVLPYYPHEEFRTFYRDLPIKGIKKYIWELLRALKFVHSKGIIHRD
FT                   IKPTNFLFNLELGRGVLVDFGLAEAQMDYKSMISSQNDYDNYANTNHDGGYSMRNHEQF
FT                   CPCIMRNQYSPNSHNQTPPMVTIQNGKVVHLNNVNGVDLTKGYPKNETRRIKRANRAGT
FT                   RGFRAPEVLMKCGAQSTKIDIWSVGVILLSLLGRRFPMFQSLDDADSLLELCTIFGWKE
FT                   LRKCAALHGLGFEASGLIWDKPNGYSNGLKEFVYDLLNKECTIGTFPEYSVAFETFGFL
FT                   QQELHDRMSIEPQLPDPKTNMDAVDAYELKKYQEEIWSDHYWCFQVLEQCFEMDPQKRS
FT                   SAEDLLKTPFFNELNENTYLLDGESTDEDDVVSSSEADLLDKDVLLISE"
FT   gene            complement(426002..426934)
FT                   /gene="TSC13"
FT                   /locus_tag="YDL015C"
FT   mRNA            complement(426002..426934)
FT                   /gene="TSC13"
FT                   /locus_tag="YDL015C"
FT                   /product="trans-2-enoyl-CoA reductase (NADPH) TSC13"
FT   CDS_pept        complement(426002..426934)
FT                   /codon_start=1
FT                   /gene="TSC13"
FT                   /locus_tag="YDL015C"
FT                   /product="trans-2-enoyl-CoA reductase (NADPH) TSC13"
FT                   /EC_number="1.3.1.93"
FT                   /note="Enoyl reductase; catalyzes last step in each cycle
FT                   of very long chain fatty acid elongation; localizes to ER,
FT                   highly enriched in a structure marking nuclear-vacuolar
FT                   junctions; coimmunoprecipitates with elongases Elo2p and
FT                   Elo3p; protein increases in abundance and relative
FT                   distribution to ER foci increases upon DNA replication
FT                   stress; human homolog TECR implicated in nonsyndromic
FT                   mental retardation, can complement yeast mutant"
FT                   /db_xref="GOA:Q99190"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR039357"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99190"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:22842922|PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005789 endoplasmic
FT                   reticulum membrane [PMID:11113186]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000038 very
FT                   long-chain fatty acid metabolic process [PMID:11113186]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016491
FT                   oxidoreductase activity [PMID:11113186]"
FT                   /protein_id="DAA11834.1"
FT                   /translation="MPITIKSRSKGLRDTEIDLSKKPTLDDVLKKISANNHNISKYRIR
FT                   LTYKKESKQVPVISESFFQEEADDSMEFFIKDLGPQISWRLVFFCEYLGPVLVHSLFYY
FT                   LSTIPTVVDRWHSASSDYNPFLNRVAYFLILGHYGKRLFETLFVHQFSLATMPIFNLFK
FT                   NCFHYWVLSGLISFGYFGYGFPFGNAKLFKYYSYLKLDDLSTLIGLFVLSELWNFYCHI
FT                   KLRLWGDYQKKHGNAKIRVPLNQGIFNLFVAPNYTFEVWSWIWFTFVFKFNLFAVLFLT
FT                   VSTAQMYAWAQKKNKKYHTRRAFLIPFVF"
FT   gene            427364..428347
FT                   /gene="NOP1"
FT                   /gene_synonym="LOT3"
FT                   /locus_tag="YDL014W"
FT   mRNA            427364..428347
FT                   /gene="NOP1"
FT                   /gene_synonym="LOT3"
FT                   /locus_tag="YDL014W"
FT                   /product="rRNA methyltransferase NOP1"
FT   CDS_pept        427364..428347
FT                   /codon_start=1
FT                   /gene="NOP1"
FT                   /gene_synonym="LOT3"
FT                   /locus_tag="YDL014W"
FT                   /product="rRNA methyltransferase NOP1"
FT                   /note="Histone glutamine methyltransferase, modifies H2A at
FT                   Q105 in nucleolus; component of the small subunit
FT                   processome complex, which is required for processing of
FT                   pre-18S rRNA; ortholog of mammalian fibrillarin;
FT                   inviability of the null mutant is functionally complemented
FT                   by human FBL"
FT                   /db_xref="GOA:P15646"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="InterPro:IPR020813"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:5WLC"
FT                   /db_xref="PDB:5WYJ"
FT                   /db_xref="PDB:5WYK"
FT                   /db_xref="PDB:6ND4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15646"
FT                   /experiment="EXISTENCE:direct assay:GO:0005730 nucleolus
FT                   [PMID:11932453|PMID:2686980]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008649 rRNA
FT                   methyltransferase activity [PMID:12215523]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030686 90S
FT                   preribosome [PMID:12150911]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031167 rRNA
FT                   methylation [PMID:12215523]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031428 box C/D
FT                   snoRNP complex [PMID:11081632]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032040
FT                   small-subunit processome [PMID:12068309]"
FT                   /experiment="EXISTENCE:direct assay:GO:1990258 histone
FT                   glutamine methylation [PMID:24352239]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000494 box C/D
FT                   snoRNA 3'-end processing [PMID:10733567|PMID:15167896]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006364 rRNA
FT                   processing [PMID:1825809]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0008649 rRNA
FT                   methyltransferase activity [PMID:12215523]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031167 rRNA
FT                   methylation [PMID:12215523|PMID:8431947]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043144 snoRNA
FT                   processing [PMID:1825809]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1990258 histone
FT                   glutamine methylation [PMID:24352239]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1990259
FT                   histone-glutamine methyltransferase activity
FT                   [PMID:24352239]"
FT                   /protein_id="DAA11835.1"
FT                   /translation="MSFRPGSRGGSRGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRG
FT                   GARGGSRGGFGGRGGSRGGARGGSRGGRGGAAGGARGGAKVVIEPHRHAGVYIARGKED
FT                   LLVTKNMAPGESVYGEKRISVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELF
FT                   IAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNIIPIIE
FT                   DARHPQKYRMLIGMVDCVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVD
FT                   AETVFAREVQKLREERIKPLEQLTLEPYERDHCIVVGRYMRSGLKK"
FT   gene            429067..430926
FT                   /gene="SLX5"
FT                   /gene_synonym="HEX3"
FT                   /gene_synonym="ULS2"
FT                   /locus_tag="YDL013W"
FT   mRNA            429067..430926
FT                   /gene="SLX5"
FT                   /gene_synonym="HEX3"
FT                   /gene_synonym="ULS2"
FT                   /locus_tag="YDL013W"
FT                   /product="SUMO-targeted ubiquitin ligase complex subunit
FT                   SLX5"
FT   CDS_pept        429067..430926
FT                   /codon_start=1
FT                   /gene="SLX5"
FT                   /gene_synonym="HEX3"
FT                   /gene_synonym="ULS2"
FT                   /locus_tag="YDL013W"
FT                   /product="SUMO-targeted ubiquitin ligase complex subunit
FT                   SLX5"
FT                   /EC_number="2.3.2.27"
FT                   /note="Subunit of the Slx5-Slx8 SUMO-targeted Ub ligase
FT                   (STUbL) complex; role in Ub-mediated degradation of histone
FT                   variant Cse4p preventing mislocalization to euchromatin;
FT                   role in proteolysis of spindle positioning protein Kar9p,
FT                   and DNA repair proteins Rad52p and Rad57p; forms
FT                   SUMO-dependent nuclear foci, including DNA repair centers;
FT                   contains a RING domain and two SIM motifs; associates with
FT                   the centromere; required for maintenance of genome
FT                   integrity like human ortholog RNF4"
FT                   /db_xref="GOA:P32828"
FT                   /db_xref="InterPro:IPR038886"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32828"
FT                   /experiment="EXISTENCE:direct assay:GO:0000775 chromosome,
FT                   centromeric region [PMID:23785440]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004842
FT                   ubiquitin-protein transferase activity
FT                   [PMID:17728242|PMID:17848550|PMID:18032921|PMID:26906737]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:19270524|PMID:23785440]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016567 protein
FT                   ubiquitination
FT                   [PMID:17728242|PMID:17848550|PMID:18032921|PMID:26906737]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032183 SUMO binding
FT                   [PMID:17848550]"
FT                   /experiment="EXISTENCE:direct assay:GO:0033768
FT                   SUMO-targeted ubiquitin ligase complex [PMID:17848550]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006974
FT                   cellular response to DNA damage stimulus [PMID:11139495]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0016567
FT                   protein ubiquitination [PMID:26906737]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0016925
FT                   protein sumoylation [PMID:16387868]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000723 telomere
FT                   maintenance [PMID:16428246]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006511
FT                   ubiquitin-dependent protein catabolic process
FT                   [PMID:26960795]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006974 cellular
FT                   response to DNA damage stimulus
FT                   [PMID:11139495|PMID:16325482]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016567 protein
FT                   ubiquitination [PMID:26906737]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016925 protein
FT                   sumoylation [PMID:16387868]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0032183 SUMO
FT                   binding [PMID:17728242]"
FT                   /protein_id="DAA11836.1"
FT                   /translation="MHSDTNGRTKSNNSPSDNNPNETVILIDSDKEEDASIREANLPVR
FT                   LYPDRRVGRRRDALNRFVRSDSRSRNSQRTHITASSERPDFQANNDDITIIREVGRFFG
FT                   DDGPIDPSAHYVDLDQEPGSETLETPRTIQVDNTNGYLNDNGNNNESDDGLTIVEERTT
FT                   RPRVTLNLPGGERLEVTATTTDIPIRRSFEFQEDLGASRRQLLRRSATRARNLFVDRSD
FT                   ENDEDWTDDTHNLPEAIQRARRESRMRMSRRIAERQRRVQQQRVSSDENISTSIRLQSI
FT                   RERIQSYTPDIRSAFHRAESLHEFRSILQNVAPITLQECEEELMALFTEFRNQLLQNWA
FT                   IDRVRNTQEEALRLHREALERQERTAGRVFHRGTLRESITNYLNFNGEDGFLSRLWSGP
FT                   ALSDADEERHTQNIIDMIQEREERERDVVMKNLMNKTRAQQEEFEARAASLPEGYSASF
FT                   DTTPKMKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDR
FT                   GVSFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAKKKSK
FT                   MPKKKLAQLKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF"
FT   gene            complement(431108..431517)
FT                   /locus_tag="YDL012C"
FT   mRNA            complement(join(431108..431386,431473..431517))
FT                   /locus_tag="YDL012C"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(431108..431386,431473..431517))
FT                   /codon_start=1
FT                   /locus_tag="YDL012C"
FT                   /product="hypothetical protein"
FT                   /note="Tail-anchored plasma membrane protein with a
FT                   conserved CYSTM module; possibly involved in response to
FT                   stress; may contribute to non-homologous end-joining (NHEJ)
FT                   based on ydl012c htz1 double null phenotype; YDL012C has a
FT                   paralog, YBR016W, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:Q12489"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12489"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:12514182]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005933 cellular bud
FT                   [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /protein_id="DAA11837.1"
FT                   /translation="MSAQDYYGNSASKQSYSRPSAPPPGYETASRGYAPSQSQQNYYPP
FT                   QQQQQQYQQQPQYYQQQQPQYYQQHPQQPIYVQQQPASSGNEDCLAGCLAGLCLCCTLD
FT                   MLF"
FT   gene            432330..433025
FT                   /gene="GRX6"
FT                   /locus_tag="YDL010W"
FT   mRNA            432330..433025
FT                   /gene="GRX6"
FT                   /locus_tag="YDL010W"
FT                   /product="glutathione-disulfide reductase GRX6"
FT   CDS_pept        432330..433025
FT                   /codon_start=1
FT                   /gene="GRX6"
FT                   /locus_tag="YDL010W"
FT                   /product="glutathione-disulfide reductase GRX6"
FT                   /note="Cis-golgi localized monothiol glutaredoxin, binds
FT                   Fe-S cluster; more similar in activity to dithiol than
FT                   other monothiol glutaredoxins; involved in the oxidative
FT                   stress response; GRX6 has a paralog, GRX7, that arose from
FT                   the whole genome duplication"
FT                   /db_xref="GOA:Q12438"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:3L4N"
FT                   /db_xref="PDB:5J3R"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12438"
FT                   /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
FT                   vacuole [PMID:23708375|PMID:14562095|PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004362
FT                   glutathione-disulfide reductase activity [PMID:18400945]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005506 iron ion
FT                   binding [PMID:18503006]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005789 endoplasmic
FT                   reticulum membrane [PMID:18503006]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005794 Golgi
FT                   apparatus [PMID:18503006]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005796 Golgi lumen
FT                   [PMID:18400945]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005801 cis-Golgi
FT                   network [PMID:18400945]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016021 integral
FT                   component of membrane [PMID:18503006]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051537 2 iron, 2
FT                   sulfur cluster binding [PMID:18171082]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0034599
FT                   cellular response to oxidative stress [PMID:18400945]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004362
FT                   glutathione-disulfide reductase activity [PMID:18400945]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034599 cellular
FT                   response to oxidative stress [PMID:18400945]"
FT                   /protein_id="DAA11838.1"
FT                   /translation="MIPSNKRNARILSITTLLLLLVFFVAQNANFLTVEIKEETSKAFS
FT                   TNMDNMAGGSSREYAAMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKND
FT                   KGSRITKAFNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDK
FT                   HGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSV
FT                   EQREKPSNN"
FT   gene            complement(432925..433248)
FT                   /locus_tag="YDL009C"
FT   mRNA            complement(432925..433248)
FT                   /locus_tag="YDL009C"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(432925..433248)
FT                   /codon_start=1
FT                   /locus_tag="YDL009C"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; mRNA identified as translated
FT                   by ribosome profiling data; SWAT-GFP and mCherry fusion
FT                   proteins localize to the cytosol; partially overlaps the
FT                   verified ORF YDL010W; YDL009C is not an essential gene"
FT                   /db_xref="GOA:Q12210"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12210"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:26928762]"
FT                   /protein_id="DAA35099.1"
FT                   /translation="MKALSVLCFHNPFKRCLGQKSFFVGDSFFIPTPKRLVLGKLRLSN
FT                   YTAFHDLIIHDLFIYIFILNFFFFPFCNNFNYWKVFHVAQPRIYHHSRLVMILKVSLEC
FT                   AVS"
FT   gene            433497..433994
FT                   /gene="APC11"
FT                   /locus_tag="YDL008W"
FT   mRNA            433497..433994
FT                   /gene="APC11"
FT                   /locus_tag="YDL008W"
FT                   /product="anaphase promoting complex subunit 11"
FT   CDS_pept        433497..433994
FT                   /codon_start=1
FT                   /gene="APC11"
FT                   /locus_tag="YDL008W"
FT                   /product="anaphase promoting complex subunit 11"
FT                   /note="Catalytic core subunit, Anaphase-Promoting
FT                   Complex/Cyclosome (APC/C); which is a ubiquitin-protein
FT                   ligase required for degradation of anaphase inhibitors,
FT                   including mitotic cyclins, during the metaphase/anaphase
FT                   transition; contains a RING-H2 domain that is required for
FT                   activity"
FT                   /db_xref="GOA:Q12157"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024991"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12157"
FT                   /experiment="EXISTENCE:direct assay:GO:0005680
FT                   anaphase-promoting complex [PMID:9469814]"
FT                   /experiment="EXISTENCE:direct assay:GO:0061630 ubiquitin
FT                   protein ligase activity [PMID:10888670]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016567 protein
FT                   ubiquitination [PMID:16481473]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031145
FT                   anaphase-promoting complex-dependent catabolic process
FT                   [PMID:16481473]"
FT                   /protein_id="DAA11839.1"
FT                   /translation="MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICR
FT                   ASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGL
FT                   AINDAHVQKFVEIVSRRREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFL
FT                   LR"
FT   gene            complement(434264..434336)
FT                   /locus_tag="tT(AGU)D"
FT   tRNA            complement(434264..434336)
FT                   /locus_tag="tT(AGU)D"
FT                   /product="tRNA-Thr"
FT                   /note="tT(AGU)D; Threonine tRNA (tRNA-Thr), predicted by
FT                   tRNAscan-SE analysis"
FT                   /experiment="EXISTENCE:curator inference:GO:0005829 cytosol
FT                   [PMID:9023104]"
FT                   /experiment="EXISTENCE:curator inference:GO:0006414
FT                   translational elongation [PMID:9023104]"
FT   repeat_region   complement(434423..434739)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="Ty1 LTR"
FT   rep_origin      434971..435320
FT                   /note="ARS415; Putative replication origin; identified in
FT                   multiple array studies, not yet confirmed by plasmid-based
FT                   assay"
FT   gene            complement(436567..436824)
FT                   /locus_tag="YDL007C-A"
FT   mRNA            complement(436567..436824)
FT                   /locus_tag="YDL007C-A"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(436567..436824)
FT                   /codon_start=1
FT                   /locus_tag="YDL007C-A"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YDL007C-A"
FT                   /db_xref="EnsemblGenomes-Tr:YDL007C-A"
FT                   /db_xref="GOA:Q2V2Q0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q2V2Q0"
FT                   /protein_id="DAA11840.1"
FT                   /translation="MFLPIIFHTILTLLNFGKYYCLPIQEDDDKSGKEIEQILDNNIES
FT                   LGLLLNSMSLSSNFTTGDPELDSLFQDDLIPELYSVLDGF"
FT   repeat_region   437149..437518
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="Ty4 LTR"
FT   gene            437772..437853
FT                   /locus_tag="tS(AGA)D1"
FT   tRNA            437772..437853
FT                   /locus_tag="tS(AGA)D1"
FT                   /product="tRNA-Ser"
FT                   /note="tS(AGA)D1; Serine tRNA (tRNA-Ser), predicted by
FT                   tRNAscan-SE analysis"
FT                   /experiment="EXISTENCE:curator inference:GO:0005829 cytosol
FT                   [PMID:9023104]"
FT                   /experiment="EXISTENCE:curator inference:GO:0006414
FT                   translational elongation [PMID:9023104]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030371 translation
FT                   repressor activity [PMID:27609601]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043022 ribosome
FT                   binding [PMID:27609601]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043555 regulation
FT                   of translation in response to stress [PMID:27609601]"
FT   gene            438047..439360
FT                   /gene="RPT2"
FT                   /gene_synonym="YHS4"
FT                   /gene_synonym="YTA5"
FT                   /locus_tag="YDL007W"
FT   mRNA            438047..439360
FT                   /gene="RPT2"
FT                   /gene_synonym="YHS4"
FT                   /gene_synonym="YTA5"
FT                   /locus_tag="YDL007W"
FT                   /product="proteasome regulatory particle base subunit RPT2"
FT   CDS_pept        438047..439360
FT                   /codon_start=1
FT                   /gene="RPT2"
FT                   /gene_synonym="YHS4"
FT                   /gene_synonym="YTA5"
FT                   /locus_tag="YDL007W"
FT                   /product="proteasome regulatory particle base subunit RPT2"
FT                   /note="ATPase of the 19S regulatory particle of the 26S
FT                   proteasome; one of six ATPases of the regulatory particle;
FT                   involved in the degradation of ubiquitinated substrates;
FT                   required for normal peptide hydrolysis by the core 20S
FT                   particle; N-myristoylation of Rpt2p at Gly2 is involved in
FT                   regulating the proper intracellular distribution of
FT                   proteasome activity by controlling the nuclear localization
FT                   of the 26S proteasome"
FT                   /db_xref="GOA:P40327"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR035244"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="PDB:3JCO"
FT                   /db_xref="PDB:3JCP"
FT                   /db_xref="PDB:4CR2"
FT                   /db_xref="PDB:4CR3"
FT                   /db_xref="PDB:4CR4"
FT                   /db_xref="PDB:5A5B"
FT                   /db_xref="PDB:5MP9"
FT                   /db_xref="PDB:5MPA"
FT                   /db_xref="PDB:5MPB"
FT                   /db_xref="PDB:5MPC"
FT                   /db_xref="PDB:5WVI"
FT                   /db_xref="PDB:5WVK"
FT                   /db_xref="PDB:6EF0"
FT                   /db_xref="PDB:6EF1"
FT                   /db_xref="PDB:6EF2"
FT                   /db_xref="PDB:6EF3"
FT                   /db_xref="PDB:6FVT"
FT                   /db_xref="PDB:6FVU"
FT                   /db_xref="PDB:6FVV"
FT                   /db_xref="PDB:6FVW"
FT                   /db_xref="PDB:6FVX"
FT                   /db_xref="PDB:6FVY"
FT                   /db_xref="PDB:6J2C"
FT                   /db_xref="PDB:6J2N"
FT                   /db_xref="PDB:6J2Q"
FT                   /db_xref="PDB:6J2X"
FT                   /db_xref="PDB:6J30"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40327"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:15210724]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008540 proteasome
FT                   regulatory particle, base subcomplex [PMID:9741626]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016887 ATPase
FT                   activity [PMID:7721833]"
FT                   /experiment="EXISTENCE:direct assay:GO:0045732 positive
FT                   regulation of protein catabolic process [PMID:15135049]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0036402
FT                   proteasome-activating ATPase activity [PMID:11430818]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006511
FT                   ubiquitin-dependent protein catabolic process
FT                   [PMID:9724628]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034629 cellular
FT                   protein-containing complex localization [PMID:23102099]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0036402
FT                   proteasome-activating ATPase activity [PMID:11430818]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043171 peptide
FT                   catabolic process [PMID:9724628]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0070651
FT                   nonfunctional rRNA decay [PMID:22505030]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0070682
FT                   proteasome regulatory particle assembly [PMID:19412160]"
FT                   /protein_id="DAA11841.1"
FT                   /translation="MGQGVSSGQDKKKKKGSNQKPKYEPPVQSKFGRKKRKGGPATAEK
FT                   LPNIYPSTRCKLKLLRMERIKDHLLLEEEFVSNSEILKPFEKKQEEEKKQLEEIRGNPL
FT                   SIGTLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDD
FT                   ADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILY
FT                   GAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFI
FT                   DEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIR
FT                   PGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEA
FT                   GLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYL"
FT   gene            439909..440754
FT                   /gene="PTC1"
FT                   /gene_synonym="CWH47"
FT                   /gene_synonym="KCS2"
FT                   /gene_synonym="TPD1"
FT                   /locus_tag="YDL006W"
FT   mRNA            439909..440754
FT                   /gene="PTC1"
FT                   /gene_synonym="CWH47"
FT                   /gene_synonym="KCS2"
FT                   /gene_synonym="TPD1"
FT                   /locus_tag="YDL006W"
FT                   /product="type 2C protein phosphatase PTC1"
FT   CDS_pept        439909..440754
FT                   /codon_start=1
FT                   /gene="PTC1"
FT                   /gene_synonym="CWH47"
FT                   /gene_synonym="KCS2"
FT                   /gene_synonym="TPD1"
FT                   /locus_tag="YDL006W"
FT                   /product="type 2C protein phosphatase PTC1"
FT                   /EC_number="3.1.3.16"
FT                   /note="Type 2C protein phosphatase (PP2C); dephosphorylates
FT                   Hog1p, inactivating osmosensing MAPK cascade; involved in
FT                   Fus3p activation during pheromone response; deletion
FT                   affects precursor tRNA splicing, mitochondrial inheritance,
FT                   and sporulation"
FT                   /db_xref="GOA:P35182"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35182"
FT                   /experiment="EXISTENCE:direct assay:GO:0000188 inactivation
FT                   of MAPK activity [PMID:11113180]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004722 protein
FT                   serine/threonine phosphatase activity
FT                   [PMID:26546002|PMID:10580002]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:11113180]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:11113180]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006470 protein
FT                   dephosphorylation [PMID:26546002|PMID:10580002]"
FT                   /experiment="EXISTENCE:direct assay:GO:0035970
FT                   peptidyl-threonine dephosphorylation [PMID:11113180]"
FT                   /experiment="EXISTENCE:direct assay:GO:1990439 MAP kinase
FT                   serine/threonine phosphatase activity [PMID:11113180]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000188
FT                   inactivation of MAPK activity [PMID:11113180]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0043409
FT                   negative regulation of MAPK cascade [PMID:26546002]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0051389
FT                   inactivation of MAPKK activity [PMID:26546002]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000001
FT                   mitochondrion inheritance [PMID:9529388]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000188
FT                   inactivation of MAPK activity
FT                   [PMID:11113180|PMID:14685261]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000750
FT                   pheromone-dependent signal transduction involved in
FT                   conjugation with cellular fusion [PMID:20400943]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006388 tRNA
FT                   splicing, via endonucleolytic cleavage and ligation
FT                   [PMID:8196609]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043409 negative
FT                   regulation of MAPK cascade [PMID:26546002]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0005515
FT                   protein binding [PMID:14685261]"
FT                   /protein_id="DAA11842.1"
FT                   /translation="MSNHSEILERPETPYDITYRVGVAENKNSKFRRTMEDVHTYVKNF
FT                   ASRLDWGYFAVFDGHAGIQASKWCGKHLHTIIEQNILADETRDVRDVLNDSFLAIDEEI
FT                   NTKLVGNSGCTAAVCVLRWELPDSVSDDSMDLAQHQRKLYTANVGDSRIVLFRNGNSIR
FT                   LTYDHKASDTLEMQRVEQAGGLIMKSRVNGMLAVTRSLGDKFFDSLVVGSPFTTSVEIT
FT                   SEDKFLILACDGLWDVIDDQDACELIKDITEPNEAAKVLVRYALENGTTDNVTVMVVFL
FT                   "
FT   gene            complement(441014..442309)
FT                   /gene="MED2"
FT                   /locus_tag="YDL005C"
FT   mRNA            complement(441014..442309)
FT                   /gene="MED2"
FT                   /locus_tag="YDL005C"
FT                   /product="Med2p"
FT   CDS_pept        complement(441014..442309)
FT                   /codon_start=1
FT                   /gene="MED2"
FT                   /locus_tag="YDL005C"
FT                   /product="Med2p"
FT                   /note="Subunit of the RNA polymerase II mediator complex;
FT                   associates with core polymerase subunits to form the RNA
FT                   polymerase II holoenzyme; essential for transcriptional
FT                   regulation; relocalizes to the cytosol in response to
FT                   hypoxia"
FT                   /db_xref="GOA:Q12124"
FT                   /db_xref="InterPro:IPR021017"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12124"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:22932476]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:22932476]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016592 mediator
FT                   complex [PMID:9891034]"
FT                   /experiment="EXISTENCE:direct assay:GO:0045944 positive
FT                   regulation of transcription by RNA polymerase II
FT                   [PMID:12468546]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051123 RNA
FT                   polymerase II preinitiation complex assembly
FT                   [PMID:12482986]"
FT                   /experiment="EXISTENCE:direct assay:GO:0070847 core
FT                   mediator complex [PMID:9891034]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001135 RNA
FT                   polymerase II transcription regulator recruiting activity
FT                   [PMID:15254252]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0000122
FT                   negative regulation of transcription by RNA polymerase II
FT                   [PMID:11470794]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0001103 RNA
FT                   polymerase II repressing transcription factor binding
FT                   [PMID:11470794]"
FT                   /protein_id="DAA11843.1"
FT                   /translation="MVVQNSPVSSVHTANFSERGSNTRTMTYKNKLTVCFDDILKVGAE
FT                   MMMQQQLKNVQLDSYLVNGFSQSQQKLLKEKVKLFHGILDDLETSLSQSSSYLETLTAL
FT                   GKEKEKEREEAEKKRAEQENMRKVREQEELKKRQELEEASQQQQLQQNSKEKNGLGLNF
FT                   STTAPANTTDANGSKENYQELGSLQSSSQTQLENANAANNGAAFSPLTTTRIQSQQAQP
FT                   SDVMFNDLNSMDISMFSGLDSTGFDSTAFNATVDETKGFDDNDSGNNYNDINISSIENN
FT                   INNNINSTKNGKDNNNESNKNNNGDEKNKNNNEDNENNNNSSEKNNNNNNNNNNNNDDN
FT                   GNNNNNNSGNDNNNTTNNDSNNKNNSITTGNDNENIVNNDLPTTVVSNPGDNPPPADNG
FT                   EEYLTLNDFNDLNIDWSTTGDNGELDLSGFNI"
FT   gene            443029..443511
FT                   /gene="ATP16"
FT                   /locus_tag="YDL004W"
FT   mRNA            443029..443511
FT                   /gene="ATP16"
FT                   /locus_tag="YDL004W"
FT                   /product="F1F0 ATP synthase subunit delta"
FT   CDS_pept        443029..443511
FT                   /codon_start=1
FT                   /gene="ATP16"
FT                   /locus_tag="YDL004W"
FT                   /product="F1F0 ATP synthase subunit delta"
FT                   /note="Delta subunit of the central stalk of mitochondrial
FT                   F1F0 ATP synthase; F1F0 ATP synthase is a large,
FT                   evolutionarily conserved enzyme complex required for ATP
FT                   synthesis; F1 translationally regulates ATP6 and ATP8
FT                   expression to achieve a balanced output of ATP synthase
FT                   genes encoded in nucleus and mitochondria; phosphorylated"
FT                   /db_xref="GOA:Q12165"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="PDB:2HLD"
FT                   /db_xref="PDB:2WPD"
FT                   /db_xref="PDB:2XOK"
FT                   /db_xref="PDB:3FKS"
FT                   /db_xref="PDB:3OE7"
FT                   /db_xref="PDB:3OEE"
FT                   /db_xref="PDB:3OEH"
FT                   /db_xref="PDB:3OFN"
FT                   /db_xref="PDB:3ZIA"
FT                   /db_xref="PDB:3ZRY"
FT                   /db_xref="PDB:4B2Q"
FT                   /db_xref="PDB:6B8H"
FT                   /db_xref="PDB:6CP3"
FT                   /db_xref="PDB:6CP6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12165"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005756
FT                   mitochondrial proton-transporting ATP synthase, central
FT                   stalk [PMID:17082766]"
FT                   /experiment="EXISTENCE:direct assay:GO:0015986 ATP
FT                   synthesis coupled proton transport [PMID:20691145]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016887 ATPase
FT                   activity [PMID:15294286|PMID:18722382]"
FT                   /experiment="EXISTENCE:direct assay:GO:0046933
FT                   proton-transporting ATP synthase activity, rotational
FT                   mechanism [PMID:20691145]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005756
FT                   mitochondrial proton-transporting ATP synthase, central
FT                   stalk [PMID:8026496]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0015986 ATP
FT                   synthesis coupled proton transport [PMID:8026496]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0046933
FT                   proton-transporting ATP synthase activity, rotational
FT                   mechanism [PMID:8026496]"
FT                   /protein_id="DAA11844.1"
FT                   /translation="MLRSIIGKSASRSLNFVAKRSYAEAAAASSGLKLQFALPHETLYS
FT                   GSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPDSQ
FT                   LCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK"
FT   gene            444683..446383
FT                   /gene="MCD1"
FT                   /gene_synonym="PDS3"
FT                   /gene_synonym="RHC21"
FT                   /gene_synonym="SCC1"
FT                   /locus_tag="YDL003W"
FT   mRNA            444683..446383
FT                   /gene="MCD1"
FT                   /gene_synonym="PDS3"
FT                   /gene_synonym="RHC21"
FT                   /gene_synonym="SCC1"
FT                   /locus_tag="YDL003W"
FT                   /product="kleisin alpha"
FT   CDS_pept        444683..446383
FT                   /codon_start=1
FT                   /gene="MCD1"
FT                   /gene_synonym="PDS3"
FT                   /gene_synonym="RHC21"
FT                   /gene_synonym="SCC1"
FT                   /locus_tag="YDL003W"
FT                   /product="kleisin alpha"
FT                   /note="Essential alpha-kleisin subunit of the cohesin
FT                   complex; required for sister chromatid cohesion in mitosis;
FT                   subject to proteolytic cleavage by separate Esp1p,
FT                   resulting in dissociation of cohesin from chromatin and the
FT                   separation of sister chromatids at the mitotic
FT                   metaphase-to-anaphase transition; apoptosis induces
FT                   cleavage and translocation of a C-terminal fragment to
FT                   mitochondria; expression peaks in S phase"
FT                   /db_xref="GOA:Q12158"
FT                   /db_xref="InterPro:IPR006909"
FT                   /db_xref="InterPro:IPR006910"
FT                   /db_xref="InterPro:IPR023093"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039781"
FT                   /db_xref="PDB:1W1W"
FT                   /db_xref="PDB:4UX3"
FT                   /db_xref="PDB:5FRP"
FT                   /db_xref="PDB:5FRS"
FT                   /db_xref="PDB:6H8Q"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12158"
FT                   /experiment="EXISTENCE:direct assay:GO:0000794 condensed
FT                   nuclear chromosome [PMID:18614046]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003682 chromatin
FT                   binding [PMID:18614046|PMID:9990856]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:15282802]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:18321989]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034990 nuclear
FT                   mitotic cohesin complex [PMID:9990856]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006974
FT                   cellular response to DNA damage stimulus [PMID:27325700]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006302
FT                   double-strand break repair [PMID:11448778|PMID:23178808]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006915
FT                   apoptotic process [PMID:18321989]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006974 cellular
FT                   response to DNA damage stimulus [PMID:18614046]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007076 mitotic
FT                   chromosome condensation [PMID:9335334]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034087
FT                   establishment of mitotic sister chromatid cohesion
FT                   [PMID:16962805]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1990414
FT                   replication-born double-strand break repair via sister
FT                   chromatid exchange [PMID:16888651]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0019901
FT                   protein kinase binding [PMID:27325700]"
FT                   /protein_id="DAA11845.1"
FT                   /translation="MVTENPQRLTVLRLATNKGPLAQIWLASNMSNIPRGSVIQTHIAE
FT                   SAKEIAKASGCDDESGDNEYITLRTSGELLQGIVRVYSKQATFLLTDIKDTLTKISMLF
FT                   KTSQKMTSTVNRLNTVTRVHQLMLEDAVTEREVLVTPGLEFLDDTTIPVGLMAQENSME
FT                   RKVQGAAPWDTSLEVGRRFSPDEDFEHNNLSSMNLDFDIEEGPITSKSWEEGTRQSSRN
FT                   FDTHENYIQDDDFPLDDAGTIGWDLGITEKNDQNNDDDDNSVEQGRRLGESIMSEEPTD
FT                   FGFDLDIEKEAPAGNIDTITDAMTESQPKQTGTRRNSKLLNTKSIQIDEETENSESIAS
FT                   SNTYKEERSNNLLTPQPTNFTTKRLWSEITESMSYLPDPILKNFLSYESLKKRKIHNGR
FT                   EGSIEEPELNVSLNLTDDVISNAGTNDNSFNELTDNMSDFVPIDAGLNEAPFPEENIID
FT                   AKTRNEQTTIQTEKVRPTPGEVASKAIVQMAKILRKELSEEKEVIFTDVLKSQANTEPE
FT                   NITKREASRGFFDILSLATEGCIGLSQTEAFGNIKIDAKPALFERFINA"
FT   gene            complement(446967..447578)
FT                   /gene="NHP10"
FT                   /gene_synonym="HMO2"
FT                   /locus_tag="YDL002C"
FT   mRNA            complement(446967..447578)
FT                   /gene="NHP10"
FT                   /gene_synonym="HMO2"
FT                   /locus_tag="YDL002C"
FT                   /product="Nhp10p"
FT   CDS_pept        complement(446967..447578)
FT                   /codon_start=1
FT                   /gene="NHP10"
FT                   /gene_synonym="HMO2"
FT                   /locus_tag="YDL002C"
FT                   /product="Nhp10p"
FT                   /note="Non-essential INO80 chromatin remodeling complex
FT                   subunit; preferentially binds DNA ends, protecting them
FT                   from exonucleatic cleavage; deletion affects telomere
FT                   maintenance via recombination; related to mammalian high
FT                   mobility group proteins"
FT                   /db_xref="GOA:Q03435"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR030483"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03435"
FT                   /experiment="EXISTENCE:direct assay:GO:0000404 heteroduplex
FT                   DNA loop binding [PMID:19726587]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031011 Ino80
FT                   complex [PMID:12887900]"
FT                   /experiment="EXISTENCE:direct assay:GO:0042766 nucleosome
FT                   mobilization [PMID:12887900]"
FT                   /experiment="EXISTENCE:direct assay:GO:0045027 DNA end
FT                   binding [PMID:19726587]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000722
FT                   telomere maintenance via recombination [PMID:23390378]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006302
FT                   double-strand break repair [PMID:15607974]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006302
FT                   double-strand break repair [PMID:17762868]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0031011
FT                   Ino80 complex [PMID:24034245]"
FT                   /protein_id="DAA11846.1"
FT                   /translation="MSVEEKKRRLEELKDQNVVLGLAIQRSRLSVKRLKLEYGVLLERL
FT                   ESRIELDPELNCEDPLPTLASFKQELLTKPFRKSKTKRHKVKERDPNMPKRPTNAYLLY
FT                   CEMNKERIRQNGSLDVTRDLAEGWKNLNEQDRKPYYKLYSEDRERYQMEMEIYNKKISN
FT                   IDADDDKEENEQKIKNNEEGSSTKVADSKGGEDGSLVSSN"
FT   gene            447984..449276
FT                   /gene="RMD1"
FT                   /locus_tag="YDL001W"
FT   mRNA            447984..449276
FT                   /gene="RMD1"
FT                   /locus_tag="YDL001W"
FT                   /product="Rmd1p"
FT   CDS_pept        447984..449276
FT                   /codon_start=1
FT                   /gene="RMD1"
FT                   /locus_tag="YDL001W"
FT                   /product="Rmd1p"
FT                   /note="Cytoplasmic protein required for sporulation"
FT                   /db_xref="GOA:Q03441"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03441"
FT                   /experiment="EXISTENCE:direct assay:GO:0000329 fungal-type
FT                   vacuole membrane [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /protein_id="DAA11847.1"
FT                   /translation="MVDSNDDQPERHALLHNDIQTSNNSRPSLVQKKYLPTPQDTRKSR
FT                   ASYTGSAMINPTSKQSRTGSGAQRTSRTAQKLKLLPEEPFQRDSERLTDLKNQEVYSQV
FT                   NRIKDKPARRDAEKLGKAHRHLLPRSTAYCTASSYNMKELVRWLKDCRKLHHTHPKLFD
FT                   ECLYTPFIYNDWRGDKRFEDEDVIRLDDEGGEIIVSDKHPDLFIFEYGVVVMWGFTERE
FT                   EKAFLNDIEKFEKEKLAEEDIQVEEFNYYVTKSYQPRIYNDFITLRDGSNYMVKLSISH
FT                   AIAQSVKISLFEELVDNTIEDTQDIPQEIAYSGKVSMSKEDIMKSIGELFILRININLH
FT                   GSVLDSPEIMWSEPQLEPIYQATRGYLEINQRVSLLNQRLEVISDLLQMLKEQLGHSHE
FT                   EYLEFIVILLVGVEVLISVINIVVDMLASQH"
FT   centromere      449711..449821
FT                   /note="CEN4; Chromosome IV centromere"
FT   centromere      449711..449720
FT                   /note="CEN4_CDEI of CEN4"
FT   centromere      449721..449796
FT                   /note="CEN4_CDEII of CEN4"
FT   centromere      449797..449821
FT                   /note="CEN4_CDEIII of CEN4"
FT   gene            complement(450220..452475)
FT                   /gene="NTH1"
FT                   /locus_tag="YDR001C"
FT   mRNA            complement(450220..452475)
FT                   /gene="NTH1"
FT                   /locus_tag="YDR001C"
FT                   /product="alpha,alpha-trehalase NTH1"
FT   CDS_pept        complement(450220..452475)
FT                   /codon_start=1
FT                   /gene="NTH1"
FT                   /locus_tag="YDR001C"
FT                   /product="alpha,alpha-trehalase NTH1"
FT                   /EC_number="3.2.1.28"
FT                   /note="Neutral trehalase, degrades trehalose; required for
FT                   thermotolerance and may mediate resistance to other
FT                   cellular stresses; phosphorylated and activated by Cdc28p
FT                   at the G1/S phase transition to coordinately regulate
FT                   carbohydrate metabolism and the cell cycle; inhibited by
FT                   Dcs1p; NTH1 has a paralog, NTH2, that arose from the whole
FT                   genome duplication"
FT                   /db_xref="GOA:P32356"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011120"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="PDB:5JTA"
FT                   /db_xref="PDB:5M4A"
FT                   /db_xref="PDB:5N6N"
FT                   /db_xref="PDB:5NIS"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32356"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005993
FT                   trehalose catabolic process [PMID:23597844]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0071465 cellular
FT                   response to desiccation [PMID:25456447]"
FT                   /protein_id="DAA11848.1"
FT                   /translation="MSQVNTSQGPVAQGRQRRLSSLSEFNDPFSNAEVYYGPPTDPRKQ
FT                   KQAKPAKINRTRTMSVFDNVSPFKKTGFGKLQQTRRGSEDDTYSSSQGNRRFFIEDVDK
FT                   TLNELLAAEDTDKNYQITIEDTGPKVLKVGTANSYGYKHINIRGTYMLSNLLQELTIAK
FT                   SFGRHQIFLDEARINENPVNRLSRLINTQFWNSLTRRVDLNNVGEIAKDTKIDTPGAKN
FT                   PRIYVPYDCPEQYEFYVQASQMHPSLKLEVEYLPKKITAEYVKSVNDTPGLLALAMEEH
FT                   FNPSTGEKTLIGYPYAVPGGRFNELYGWDSYMMALGLLEANKTDVARGMVEHFIFEINH
FT                   YGKILNANRSYYLCRSQPPFLTEMALVVFKKLGGRSNPDAVDLLKRAFQASIKEYKTVW
FT                   TASPRLDPETGLSRYHPNGLGIPPETESDHFDTVLLPYASKHGVTLDEFKQLYNDGKIK
FT                   EPKLDEFFLHDRGVRESGHDTTYRFEGVCAYLATIDLNSLLYKYEIDIADFIKEFCDDK
FT                   YEDPLDHSITTSAMWKEMAKIRQEKITKYMWDDESGFFFDYNTKIKHRTSYESATTFWA
FT                   LWAGLATKEQAQKMVEKALPKLEMLGGLAACTERSRGPISISRPIRQWDYPFGWAPHQI
FT                   LAWEGLRSYGYLTVTNRLAYRWLFMMTKAFVDYNGIVVEKYDVTRGTDPHRVEAEYGNQ
FT                   GADFKGAATEGFGWVNASYILGLKYMNSHARRALGACIPPISFFSSLRPQERNLYGL"
FT   gene            453045..453650
FT                   /gene="YRB1"
FT                   /gene_synonym="CST20"
FT                   /gene_synonym="HTN1"
FT                   /gene_synonym="SFO1"
FT                   /gene_synonym="STP52"
FT                   /locus_tag="YDR002W"
FT   mRNA            453045..453650
FT                   /gene="YRB1"
FT                   /gene_synonym="CST20"
FT                   /gene_synonym="HTN1"
FT                   /gene_synonym="SFO1"
FT                   /gene_synonym="STP52"
FT                   /locus_tag="YDR002W"
FT                   /product="Ran GTPase-binding protein YRB1"
FT   CDS_pept        453045..453650
FT                   /codon_start=1
FT                   /gene="YRB1"
FT                   /gene_synonym="CST20"
FT                   /gene_synonym="HTN1"
FT                   /gene_synonym="SFO1"
FT                   /gene_synonym="STP52"
FT                   /locus_tag="YDR002W"
FT                   /product="Ran GTPase-binding protein YRB1"
FT                   /note="Ran GTPase binding protein; involved in nuclear
FT                   protein import and RNA export, ubiquitin-mediated protein
FT                   degradation during the cell cycle; shuttles between the
FT                   nucleus and cytoplasm; is essential; homolog of human
FT                   RanBP1"
FT                   /db_xref="GOA:P41920"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="PDB:3M1I"
FT                   /db_xref="PDB:4GMX"
FT                   /db_xref="PDB:4GPT"
FT                   /db_xref="PDB:4HAT"
FT                   /db_xref="PDB:4HAU"
FT                   /db_xref="PDB:4HAV"
FT                   /db_xref="PDB:4HAW"
FT                   /db_xref="PDB:4HAX"
FT                   /db_xref="PDB:4HAY"
FT                   /db_xref="PDB:4HAZ"
FT                   /db_xref="PDB:4HB0"
FT                   /db_xref="PDB:4HB2"
FT                   /db_xref="PDB:4HB3"
FT                   /db_xref="PDB:4HB4"
FT                   /db_xref="PDB:4WVF"
FT                   /db_xref="PDB:5DH9"
FT                   /db_xref="PDB:5DHA"
FT                   /db_xref="PDB:5DHF"
FT                   /db_xref="PDB:5DI9"
FT                   /db_xref="PDB:5DIF"
FT                   /db_xref="PDB:5JLJ"
FT                   /db_xref="PDB:5UWH"
FT                   /db_xref="PDB:5UWI"
FT                   /db_xref="PDB:5UWJ"
FT                   /db_xref="PDB:5UWO"
FT                   /db_xref="PDB:5UWP"
FT                   /db_xref="PDB:5UWQ"
FT                   /db_xref="PDB:5UWR"
FT                   /db_xref="PDB:5UWS"
FT                   /db_xref="PDB:5UWT"
FT                   /db_xref="PDB:5UWU"
FT                   /db_xref="PDB:5UWW"
FT                   /db_xref="PDB:5YRO"
FT                   /db_xref="PDB:5YST"
FT                   /db_xref="PDB:5YSU"
FT                   /db_xref="PDB:5YTB"
FT                   /db_xref="PDB:5ZPU"
FT                   /db_xref="PDB:6A38"
FT                   /db_xref="PDB:6A3A"
FT                   /db_xref="PDB:6A3B"
FT                   /db_xref="PDB:6A3C"
FT                   /db_xref="PDB:6A3E"
FT                   /db_xref="PDB:6CIT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41920"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:10825193]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:10825193]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008536 Ran GTPase
FT                   binding [PMID:7836422]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000082 G1/S
FT                   transition of mitotic cell cycle [PMID:10991951]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006405 RNA
FT                   export from nucleus [PMID:7489726]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006511
FT                   ubiquitin-dependent protein catabolic process
FT                   [PMID:10991951]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006606 protein
FT                   import into nucleus [PMID:7489726]"
FT                   /protein_id="DAA11849.1"
FT                   /translation="MSSEDKKPVVDKKEEAAPKPPSSAVFSMFGGKKAEKPETKKDEED
FT                   TKEETKKEGDDAPESPDIHFEPVVHLEKVDVKTMEEDEEVLYKVRAKLFRFDADAKEWK
FT                   ERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTAD
FT                   IAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKKA"
FT   gene            454122..454754
FT                   /gene="RCR2"
FT                   /gene_synonym="SSH5"
FT                   /locus_tag="YDR003W"
FT   mRNA            454122..454754
FT                   /gene="RCR2"
FT                   /gene_synonym="SSH5"
FT                   /locus_tag="YDR003W"
FT                   /product="Rcr2p"
FT   CDS_pept        454122..454754
FT                   /codon_start=1
FT                   /gene="RCR2"
FT                   /gene_synonym="SSH5"
FT                   /locus_tag="YDR003W"
FT                   /product="Rcr2p"
FT                   /note="Vacuolar protein; presumably functions within the
FT                   endosomal-vacuolar trafficking pathway, affecting events
FT                   that determine whether plasma membrane proteins are
FT                   degraded or routed to the plasma membrane; RCR2 has a
FT                   paralog, RCR1, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:Q03446"
FT                   /db_xref="InterPro:IPR020999"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03446"
FT                   /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
FT                   vacuole [PMID:17287526|PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000329 fungal-type
FT                   vacuole membrane [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031982 vesicle
FT                   [PMID:17287526]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0016192
FT                   vesicle-mediated transport [PMID:17287526]"
FT                   /protein_id="DAA11850.1"
FT                   /translation="MILREQIDFLIHKRQDDNNNNGEAITDDDPFSSSSWRWGRWIFFI
FT                   FFIVALLILLFSTAKVNRRRRIMGQAPIRGTAWLTPPTYRQSERDYNGTQRCVEDYVPE
FT                   YTETANENDLGFYDERGEFHPNGKTEYLAPPPLSEEQASSTDKDLQRPVAAVVRIPSES
FT                   EFDFNLLRPTMNNFVNGQSNRNEQHSPTVESSSFDVNNAPARAKVSK"
FT   gene            454782..454904
FT                   /locus_tag="YDR003W-A"
FT   mRNA            454782..454904
FT                   /locus_tag="YDR003W-A"
FT                   /product="hypothetical protein"
FT   CDS_pept        454782..454904
FT                   /codon_start=1
FT                   /locus_tag="YDR003W-A"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; identified by expression
FT                   profiling and mass spectrometry"
FT                   /db_xref="EnsemblGenomes-Gn:YDR003W-A"
FT                   /db_xref="EnsemblGenomes-Tr:YDR003W-A"
FT                   /db_xref="GOA:Q3E7Z7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3E7Z7"
FT                   /protein_id="DAA11851.1"
FT                   /translation="MTCGIENSYKSAEKKKKYRSFRFFESRDYSELCIIVGTYY"
FT   gene            455201..456583
FT                   /gene="RAD57"
FT                   /locus_tag="YDR004W"
FT   mRNA            455201..456583
FT                   /gene="RAD57"
FT                   /locus_tag="YDR004W"
FT                   /product="putative DNA-dependent ATPase RAD57"
FT   CDS_pept        455201..456583
FT                   /codon_start=1
FT                   /gene="RAD57"
FT                   /locus_tag="YDR004W"
FT                   /product="putative DNA-dependent ATPase RAD57"
FT                   /note="Protein that stimulates strand exchange; stimulates
FT                   strand exchange by stabilizing the binding of Rad51p to
FT                   single-stranded DNA; involved in the recombinational repair
FT                   of double-strand breaks in DNA during vegetative growth and
FT                   meiosis; forms heterodimer with Rad55p"
FT                   /db_xref="GOA:P25301"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25301"
FT                   /experiment="EXISTENCE:direct assay:GO:0030491 heteroduplex
FT                   formation [PMID:9159392]"
FT                   /experiment="EXISTENCE:direct assay:GO:0033062 Rhp55-Rhp57
FT                   complex [PMID:9159392]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000707 meiotic
FT                   DNA recombinase assembly [PMID:9679065]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000722 telomere
FT                   maintenance via recombination [PMID:11238918]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0000730 DNA
FT                   recombinase assembly [PMID:11459983]"
FT                   /protein_id="DAA11852.1"
FT                   /translation="MPRALSIKFDNTYMDLYDELPESKLLYDEEFSYLLDAVRQNGVCV
FT                   VDFLTLTPKELARLIQRSINEVFRFQQLLVHEYNEKYLEICEKNSISPDNGPECFTTAD
FT                   VAMDELLGGGIFTHGITEIFGESSTGKSQLLMQLALSVQLSEPAGGLGGKCVYITTEGD
FT                   LPTQRLESMLSSRPAYEKLGITQSNIFTVSCNDLINQEHIINVQLPILLERSKGSIKLV
FT                   IIDSISHHLRVELQNKSFRESQENKNYLDRMAEKLQILAHDYSLSVVVANQVGDKPLAN
FT                   SPVAHRTYVTDYDYQLGWLVGWKNSTILYRQMNSLLGASSNNDEILSDDEDYMLIERVM
FT                   STVNDRNYDFFSKKKPPIIENKTVERNSSSPISRQSKKRKFDYRVPNLGLTWSNHVSTR
FT                   ILLQKSFKASTIIQRGEAHLYKGGDSASFWQVKRTMKVVYSTFAKPGQIAYQITKRGIE
FT                   TA"
FT   gene            complement(456836..458103)
FT                   /gene="MAF1"
FT                   /locus_tag="YDR005C"
FT   mRNA            complement(join(456836..458017,458098..458103))
FT                   /gene="MAF1"
FT                   /locus_tag="YDR005C"
FT                   /product="RNA polymerase III-inhibiting protein MAF1"
FT   CDS_pept        complement(join(456836..458017,458098..458103))
FT                   /codon_start=1
FT                   /gene="MAF1"
FT                   /locus_tag="YDR005C"
FT                   /product="RNA polymerase III-inhibiting protein MAF1"
FT                   /note="Highly conserved negative regulator of RNA
FT                   polymerase III; involved in tRNA processing and stability;
FT                   inhibits tRNA degradation via rapid tRNA decay (RTD)
FT                   pathway; binds N-terminal domain of Rpc160p subunit of Pol
FT                   III to prevent closed-complex formation; regulated by
FT                   phosphorylation mediated by TORC1, protein kinase A, Sch9p,
FT                   casein kinase 2; localizes to cytoplasm during vegetative
FT                   growth and translocates to nucleus and nucleolus under
FT                   stress conditions"
FT                   /db_xref="GOA:P41910"
FT                   /db_xref="InterPro:IPR015257"
FT                   /db_xref="InterPro:IPR038564"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41910"
FT                   /experiment="EXISTENCE:direct assay:GO:0000994 RNA
FT                   polymerase III core binding [PMID:16762835|PMID:20887893]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:16762835|PMID:19574957|PMID:19684113]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005730 nucleolus
FT                   [PMID:19574957]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:16762835|PMID:19574957|PMID:19684113]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016480 negative
FT                   regulation of transcription by RNA polymerase III
FT                   [PMID:16762835]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0016480
FT                   negative regulation of transcription by RNA polymerase III
FT                   [PMID:11438659]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0016480 negative
FT                   regulation of transcription by RNA polymerase III
FT                   [PMID:11438659|PMID:16762835]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0061587 transfer
FT                   RNA gene-mediated silencing [PMID:23707796]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0016480
FT                   negative regulation of transcription by RNA polymerase III
FT                   [PMID:11438659|PMID:16762835]"
FT                   /protein_id="DAA11853.1"
FT                   /translation="MKFIDELDIERVNQTLNFETNDCKIVGSCDIFTTKAVASDRKLYK
FT                   TIDQHLDTILQENENYNATLQQQLAAPETNQSPCSSPFYSNRRDSNSFWEQKRRISFSE
FT                   YNSNNNTNNSNGNSSNNNNYSGPNGSSPATFPKSAKLNDQNLKELVSNYDSGSMSSSSL
FT                   DSSSKNDERIRRRSSSSISSFKSGKSSNNNYSSGTATNNVNKRRKSSINERPSNLSLGP
FT                   FGPINEPSSRKIFAYLIAILNASYPDHDFSSVEPTDFVKTSLKTFISKFENTLYSLGRQ
FT                   PEEWVWEVINSHMTLSDCVLFQYSPSNSFLEDEPGYLWNLIGFLYNRKRKRVAYLYLIC
FT                   SRLNSSTGEVEDALAKKPQGKLIIDDGSNEYEGEYDFTYDENVIDDKSDQEESLQ"
FT   gene            complement(458542..461247)
FT                   /gene="SOK1"
FT                   /locus_tag="YDR006C"
FT   mRNA            complement(458542..461247)
FT                   /gene="SOK1"
FT                   /locus_tag="YDR006C"
FT                   /product="Sok1p"
FT   CDS_pept        complement(458542..461247)
FT                   /codon_start=1
FT                   /gene="SOK1"
FT                   /locus_tag="YDR006C"
FT                   /product="Sok1p"
FT                   /note="hypothetical protein; overexpression suppresses the
FT                   growth defect of mutants lacking protein kinase A activity;
FT                   involved in cAMP-mediated signaling; localized to the
FT                   nucleus; similar to the mouse testis-specific protein
FT                   PBS13"
FT                   /db_xref="GOA:P40317"
FT                   /db_xref="InterPro:IPR008862"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40317"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:8065298]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0010737
FT                   protein kinase A signaling [PMID:8065298]"
FT                   /protein_id="DAA11854.1"
FT                   /translation="MDQPRTHSGPTTASNPAPSSTNSSSAPSATNSKQERSSSSLSKPS
FT                   SVVPSKDSPDGDAIAKTQAAALKNDMKSGDTSTLDGSSQNIIPNRASMQKYIDQSSDLL
FT                   SRSSGVITPSMSLNASTNATNNDSSGNSANSSDLKIPIDRDNTIFKTFDTKTGQFLKND
FT                   DNEEEIRRNNKVDSIPPKNIYTNINNPSPSPPPSSKQPPSASAPQLPPATEPHKEQAAQ
FT                   QQPPGNASNFLRIFSNKKMRSHSVPTILHSSLRKLSSHNQYYRNQNILLNHPTPSGISK
FT                   KKFSRNHHQPYLHSNNPLSSNPLSLKRAIFLNQQISGNASTNANNDNINNSTATSMTNQ
FT                   SFLSSSNFDLTLEDRINYIKATPTPVPFPPINLQGLKEIDLQEILKNPQLRHDIIFDPL
FT                   LQFRPNLDGERGNKKRQLANIYWNDVQNEIYVYSKRPEIFQYNRSRLVPLFDTLRDVLL
FT                   TIVPQKESPMINNVLDTELNIQELLKGSLIMSNLSGWLADLFKHHCAPMRDPWVDKMSN
FT                   KFKEAERDSSLTRLIEGLRLVFQILETMKLDIANHQIRILRPALLSNAVEFEKQYFNTL
FT                   IASKRVNLNTSLLWFDKKFNENVTAGLVRNPSSITIPDVYNICIRSIINLLSCRKMVRE
FT                   YPTPLSFDHARLILLRADIRQIVCILVCRLLFQQLVANDPSMDKATKEYVIHTYSTKRL
FT                   KNEIISIITDEHGNCRWTKNTMSIAVHLCKVIDDLHREYDNNGSCEQARRPQLPSLDNS
FT                   KITFAKSWLSKQTQPLSEVYGVLENRVFKSLEDAIFNRSECTIDGRVKQDFVYLYNTNN
FT                   GNVGSTNTLSTTTDTASVKISPSLMSPSKTSTTTPTGNAIASRGLFAATELEEFENVYR
FT                   HLYALINLHWSVFGPHYIEMLGDKVNKKGI"
FT   gene            461842..462516
FT                   /gene="TRP1"
FT                   /locus_tag="YDR007W"
FT   mRNA            461842..462516
FT                   /gene="TRP1"
FT                   /locus_tag="YDR007W"
FT                   /product="phosphoribosylanthranilate isomerase TRP1"
FT   CDS_pept        461842..462516
FT                   /codon_start=1
FT                   /gene="TRP1"
FT                   /locus_tag="YDR007W"
FT                   /product="phosphoribosylanthranilate isomerase TRP1"
FT                   /EC_number="5.3.1.24"
FT                   /note="Phosphoribosylanthranilate isomerase; catalyzes the
FT                   third step in tryptophan biosynthesis; in 2004, the
FT                   sequence of TRP1 from strain S228C was updated by changing
FT                   the previously annotated internal STOP (TAA) to serine
FT                   (TCA); enhances vegetative growth at low and high
FT                   temperatures when used as an auxotrophic marker in strains
FT                   such as W303"
FT                   /db_xref="GOA:P00912"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P00912"
FT                   /experiment="EXISTENCE:direct assay:GO:0000162 tryptophan
FT                   biosynthetic process [PMID:3286643]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004640
FT                   phosphoribosylanthranilate isomerase activity
FT                   [PMID:3286643]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000162
FT                   tryptophan biosynthetic process
FT                   [PMID:10790693|PMID:348687]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004640
FT                   phosphoribosylanthranilate isomerase activity
FT                   [PMID:348687]"
FT                   /protein_id="DAA11855.1"
FT                   /translation="MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRK
FT                   RTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDES
FT                   WQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDW
FT                   VGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNA
FT                   KK"
FT   rep_origin      462567..462622
FT                   /note="ARS1; Early-firing autonomously replicating
FT                   sequence; highly efficient chromosomal replicator active in
FT                   nearly every cell cycle"
FT   gene            463434..464996
FT                   /gene="GAL3"
FT                   /locus_tag="YDR009W"
FT   mRNA            463434..464996
FT                   /gene="GAL3"
FT                   /locus_tag="YDR009W"
FT                   /product="transcriptional regulator GAL3"
FT   CDS_pept        463434..464996
FT                   /codon_start=1
FT                   /gene="GAL3"
FT                   /locus_tag="YDR009W"
FT                   /product="transcriptional regulator GAL3"
FT                   /note="Transcriptional regulator; involved in activation of
FT                   the GAL genes in response to galactose; forms a complex
FT                   with Gal80p to relieve Gal80p inhibition of Gal4p; binds
FT                   galactose and ATP but does not have galactokinase activity;
FT                   GAL3 has a paralog, GAL1, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:P13045"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="PDB:3V2U"
FT                   /db_xref="PDB:3V5R"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13045"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:18952899]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:10866670|PMID:18952899]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000435 positive
FT                   regulation of transcription from RNA polymerase II promoter
FT                   by galactose [PMID:3013721]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006012
FT                   galactose metabolic process [PMID:4577139]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045185
FT                   maintenance of protein location [PMID:19651897]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0005515
FT                   protein binding [PMID:8628318]"
FT                   /protein_id="DAA11856.1"
FT                   /translation="MNTNVPIFSSPVRDLPRSFEQKHLAVVDAFFQTYHVKPDFIARSP
FT                   GRVNLIGEHIDYCDFSVLPLAIDVDMLCAVKILDEKNPSITLTNADPKFAQRKFDLPLD
FT                   GSYMAIDPSVSEWSNYFKCGLHVAHSYLKKIAPERFNNTPLVGAQIFCQSDIPTGGGLS
FT                   SAFTCAAALATIRANMGKNFDISKKDLTRITAVAEHYVGVNNGGMDQATSVYGEEDHAL
FT                   YVEFRPKLKATPFKFPQLKNHEISFVIANTLVKSNKFETAPTNYNLRVIEVTVAANALA
FT                   TRYSVALPSHKDNSNSERGNLRDFMDAYYARYENQAQPWNGDIGTGIERLLKMLQLVEE
FT                   SFSRKKSGFTVHEASTALNCSREEFTRDYLTTFPVRFQVLKLYQRAKHVYSESLRVLKA
FT                   LKMMTSATFHTDEDFFTDFGRLMNESQASCDKLYECSCIETNQICSIALANGSFGSRLT
FT                   GAGWGGCTIHLVPSGANGNVEQVRKALIEKFYNVRYPDLTDEELKDAIIVSKPALGTCL
FT                   YEQ"
FT   gene            complement(465051..465383)
FT                   /locus_tag="YDR010C"
FT   mRNA            complement(465051..465383)
FT                   /locus_tag="YDR010C"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(465051..465383)
FT                   /codon_start=1
FT                   /locus_tag="YDR010C"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; conserved across S. cerevisiae
FT                   strains"
FT                   /db_xref="GOA:Q12426"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12426"
FT                   /protein_id="DAA80274.1"
FT                   /translation="MCAEPDDWERIERHPRKLKIAPRMLDFYESYIVWREGNFFLCLRS
FT                   FPNGVIRGGRCFFRATSLPWKNVYGYHGHITSVCGATLTRINRAMVASDAGMGSIGLTN
FT                   LFLYRV"
FT   gene            465919..470424
FT                   /gene="SNQ2"
FT                   /locus_tag="YDR011W"
FT   mRNA            465919..470424
FT                   /gene="SNQ2"
FT                   /locus_tag="YDR011W"
FT                   /product="ATP-binding cassette transporter SNQ2"
FT   CDS_pept        465919..470424
FT                   /codon_start=1
FT                   /gene="SNQ2"
FT                   /locus_tag="YDR011W"
FT                   /product="ATP-binding cassette transporter SNQ2"
FT                   /note="Plasma membrane ATP-binding cassette (ABC)
FT                   transporter; multidrug transporter involved in multidrug
FT                   resistance and resistance to singlet oxygen species"
FT                   /db_xref="GOA:P32568"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005285"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029481"
FT                   /db_xref="InterPro:IPR034001"
FT                   /db_xref="InterPro:IPR034003"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32568"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:12469340]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0030003
FT                   cellular cation homeostasis [PMID:8985171]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030003 cellular
FT                   cation homeostasis [PMID:8985171]"
FT                   /protein_id="DAA11857.1"
FT                   /translation="MSNIKSTQDSSHNAVARSSSASFAASEESFTGITHDKDEQSDTPA
FT                   DKLTKMLTGPARDTASQISATVSEMAPDVVSKVESFADALSRHTTRSGAFNMDSDSDDG
FT                   FDAHAIFESFVRDADEQGIHIRKAGVTIEDVSAKGVDASALEGATFGNILCLPLTIFKG
FT                   IKAKRHQKMRQIISNVNALAEAGEMILVLGRPGAGCSSFLKVTAGEIDQFAGGVSGEVA
FT                   YDGIPQEEMMKRYKADVIYNGELDVHFPYLTVKQTLDFAIACKTPALRVNNVSKKEYIA
FT                   SRRDLYATIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLD
FT                   ASTALEYAKAIRIMTNLLKSTAFVTIYQASENIYETFDKVTVLYSGKQIYFGLIHEAKP
FT                   YFAKMGYLCPPRQATAEFLTALTDPNGFHLIKPGYENKVPRTAEEFETYWLNSPEFAQM
FT                   KKDIAAYKEKVNTEKTKEVYDESMAQEKSKYTRKKSYYTVSYWEQVKLCTQRGFQRIYG
FT                   NKSYTVINVCSAIIQSFITGSLFYNTPSSTSGAFSRGGVLYFALLYYSLMGLANISFEH
FT                   RPILQKHKGYSLYHPSAEAIGSTLASFPFRMIGLTCFFIILFFLSGLHRTAGSFFTIYL
FT                   FLTMCSEAINGLFEMVSSVCDTLSQANSISGILMMSISMYSTYMIQLPSMHPWFKWISY
FT                   VLPIRYAFESMLNAEFHGRHMDCANTLVPSGGDYDNLSDDYKVCAFVGSKPGQSYVLGD
FT                   DYLKNQFQYVYKHTWRNFGILWCFLLGYVVLKVIFTEYKRPVKGGGDALIFKKGSKRFI
FT                   AHADEESPDNVNDIDAKEQFSSESSGANDEVFDDLEAKGVFIWKDVCFTIPYEGGKRML
FT                   LDNVSGYCIPGTMTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGRPIDASFERRTG
FT                   YVQQQDIHIAELTVRESLQFSARMRRPQHLPDSEKMDYVEKIIRVLGMEEYAEALVGEV
FT                   GCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRKLSKAGQSILC
FT                   TIHQPSATLFEEFDRLLLLRKGGQTVYFGDIGKNSATILNYFERNGARKCDSSENPAEY
FT                   ILEAIGAGATASVKEDWHEKWLNSVEFEQTKEKVQDLINDLSKQETKSEVGDKPSKYAT
FT                   SYAYQFRYVLIRTSTSFWRSLNYIMSKMMLMLVGGLYIGFTFFNVGKSYVGLQNAMFAA
FT                   FISIILSAPAMNQIQGRAIASRELFEVRESQSNMFHWSLVLITQYLSELPYHLFFSTIF
FT                   FVSSYFPLRIFFEASRSAVYFLNYCIMFQLYYVGLGLMILYMSPNLPSANVILGLCLSF
FT                   MLSFCGVTQPVSLMPGFWTFMWKASPYTYFVQNLVGIMLHKKPVVCKKKELNYFNPPNG
FT                   STCGEYMKPFLEKATGYIENPDATSDCAYCIYEVGDNYLTHISSKYSYLWRNFGIFWIY
FT                   IFFNIIAMVCVYYLFHVRQSSFLSPVSILNKIKNIRKKKQ"
FT   gene            471853..472941
FT                   /gene="RPL4B"
FT                   /locus_tag="YDR012W"
FT   mRNA            471853..472941
FT                   /gene="RPL4B"
FT                   /locus_tag="YDR012W"
FT                   /product="ribosomal 60S subunit protein L4B"
FT   CDS_pept        471853..472941
FT                   /codon_start=1
FT                   /gene="RPL4B"
FT                   /locus_tag="YDR012W"
FT                   /product="ribosomal 60S subunit protein L4B"
FT                   /note="Ribosomal 60S subunit protein L4B; homologous to
FT                   mammalian ribosomal protein L4 and bacterial L4; RPL4B has
FT                   a paralog, RPL4A, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:P49626"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013000"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="InterPro:IPR025755"
FT                   /db_xref="PDB:2WW9"
FT                   /db_xref="PDB:2WWA"
FT                   /db_xref="PDB:2WWB"
FT                   /db_xref="PDB:4V4B"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49626"
FT                   /experiment="EXISTENCE:curator inference:GO:0002181
FT                   cytoplasmic translation [PMID:22096102]"
FT                   /experiment="EXISTENCE:curator inference:GO:0003735
FT                   structural constituent of ribosome [PMID:22096102]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:11914276]"
FT                   /experiment="EXISTENCE:direct assay:GO:0022625 cytosolic
FT                   large ribosomal subunit [PMID:22096102]"
FT                   /protein_id="DAA11858.1"
FT                   /translation="MSRPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKN
FT                   KRQAYAVSEKAGHQTSAESWGTGRAVARIPRVGGGGTGRSGQGAFGNMCRGGRMFAPTK
FT                   TWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLVVSTDLESIQKTK
FT                   EAVAALKAVGAHSDLLKVLKSKKLRAGKGKYRNRRWTQRRGPLVVYAEDNGIVKALRNV
FT                   PGVETANVASLNLLQLAPGAHLGRFVIWTEAAFTKLDQVWGSETVASSKVGYTLPSHII
FT                   STSDVTRIINSSEIQSAIRPAGQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLG
FT                   SKKAEKTGTKPAAVFAETLKHD"
FT   gene            473157..473783
FT                   /gene="PSF1"
FT                   /gene_synonym="CDC101"
FT                   /locus_tag="YDR013W"
FT   mRNA            473157..473783
FT                   /gene="PSF1"
FT                   /gene_synonym="CDC101"
FT                   /locus_tag="YDR013W"
FT                   /product="DNA replication protein PSF1"
FT   CDS_pept        473157..473783
FT                   /codon_start=1
FT                   /gene="PSF1"
FT                   /gene_synonym="CDC101"
FT                   /locus_tag="YDR013W"
FT                   /product="DNA replication protein PSF1"
FT                   /note="Subunit of the GINS complex (Sld5p, Psf1p, Psf2p,
FT                   Psf3p); complex is localized to DNA replication origins and
FT                   implicated in assembly of the DNA replication machinery"
FT                   /db_xref="GOA:Q12488"
FT                   /db_xref="InterPro:IPR005339"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="InterPro:IPR036224"
FT                   /db_xref="PDB:3JC5"
FT                   /db_xref="PDB:3JC6"
FT                   /db_xref="PDB:3JC7"
FT                   /db_xref="PDB:5U8S"
FT                   /db_xref="PDB:5U8T"
FT                   /db_xref="PDB:6HV9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12488"
FT                   /experiment="EXISTENCE:direct assay:GO:0031298 replication
FT                   fork protection complex [PMID:16531994]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071162 CMG complex
FT                   [PMID:26524492]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0031261 DNA
FT                   replication preinitiation complex [PMID:12730134]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000727
FT                   double-strand break repair via break-induced replication
FT                   [PMID:20516198]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006261
FT                   DNA-dependent DNA replication
FT                   [PMID:12730134|PMID:12768207]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031261 DNA
FT                   replication preinitiation complex [PMID:12730134]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0000811 GINS
FT                   complex [PMID:12730134|PMID:12768207]"
FT                   /protein_id="DAA11859.1"
FT                   /translation="MYGDLGNKLVLEAKRTKQLYARSNQDVNLPMYHEDIIRNILKEVS
FT                   NLRKNTEYLKEQQQLGMLDDKVAKCQYFVTLLCMERNKRCLLAYQRLRTDILDSMAWNN
FT                   NGLDLMSSITFSQQDTNNLSHQEQEYLKEYCDLITDLKSGDLVDIDLSGSLVPPSDVFI
FT                   DVRVLKDAGEIQTEYGVFNLIKDSQFFVRQSDVERLIQQGYLQKI"
FT   gene            474046..475989
FT                   /gene="RAD61"
FT                   /gene_synonym="WPL1"
FT                   /locus_tag="YDR014W"
FT   mRNA            474046..475989
FT                   /gene="RAD61"
FT                   /gene_synonym="WPL1"
FT                   /locus_tag="YDR014W"
FT                   /product="Rad61p"
FT   CDS_pept        474046..475989
FT                   /codon_start=1
FT                   /gene="RAD61"
FT                   /gene_synonym="WPL1"
FT                   /locus_tag="YDR014W"
FT                   /product="Rad61p"
FT                   /note="Subunit of a complex that inhibits sister chromatid
FT                   cohesion; also negatively regulates chromosome
FT                   condensation; inhibited by Eco1p-acetylated cohesin
FT                   subunits Smc3p and Mcd1p; binds Smc3p ATPase head of
FT                   cohesin; related to the human Wapl protein that controls
FT                   the association of cohesin with chromatin"
FT                   /db_xref="GOA:Q99359"
FT                   /db_xref="InterPro:IPR031550"
FT                   /db_xref="InterPro:IPR038496"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99359"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0007064
FT                   mitotic sister chromatid cohesion [PMID:18653893]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0034183
FT                   negative regulation of maintenance of mitotic sister
FT                   chromatid cohesion [PMID:22901742]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034183 negative
FT                   regulation of maintenance of mitotic sister chromatid
FT                   cohesion [PMID:22901742|PMID:23219725]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1902340 negative
FT                   regulation of chromosome condensation [PMID:23219725]"
FT                   /protein_id="DAA11860.1"
FT                   /translation="MRAYGKRGPVLRTPFRSNKGLPSSSDVEFSDDDVNSVIPDVSSTI
FT                   SSSIADHPIEGLLDEPRKAQDSSSSFDGANEKPSSQLDSKRNDQNVKIITSSDTSMAFM
FT                   KDEKLSAFNFLDGSKASKRKRRRTYQKHDANITSSIEPDVQDEDSITMHNEFESIRKIY
FT                   NDINEFILKLPRADDDILNKMLENEMKMDDSIENNSIRTSKDKKYGKFRTILINKNKEN
FT                   EIMGEEVDQKANTLSLNNADNSNAEKEGLTSTNHYNELKNMGDTIKYQDDIEFLLSNSK
FT                   SNDNTTVPINEYFKKLLNLSLMIINDEEFFQYAKRYFKKEIIKLSFAQFRSDFPELILL
FT                   QGYLLHKVSESQSDFPPSFDNFSIELSKDDGKIRTKKNKHIKKLSHLNFEDFLRKTQFK
FT                   TGLYYSLSLWEMHGNLSLDIIKRISILASNKDLFSRHVKTFIPLLEKLITASEFCHMYI
FT                   EQPEMFDSLISNLNNQFKDMLDDDSLIKILILLTNMEVHNYTLWKEADMIFQSSMNTIL
FT                   ESIHPLTDAKVDNILLHLGLCLNICSRENSRLKLDGKLWYDMKTIFVKMIRDGSDTENR
FT                   LVQGLFYLNFSFLIKQRKENSNLDPGELNLLLVELEAFKSETSQFNEGISNKIEIALNY
FT                   LKSIYTSERITI"
FT   gene            477797..478285
FT                   /gene="HED1"
FT                   /locus_tag="YDR014W-A"
FT   mRNA            477797..478285
FT                   /gene="HED1"
FT                   /locus_tag="YDR014W-A"
FT                   /product="Hed1p"
FT   CDS_pept        477797..478285
FT                   /codon_start=1
FT                   /gene="HED1"
FT                   /locus_tag="YDR014W-A"
FT                   /product="Hed1p"
FT                   /note="Meiosis-specific protein; down-regulates
FT                   Rad51p-mediated mitotic recombination when the meiotic
FT                   recombination machinery is impaired; promotes synapsis and
FT                   required for the normal morphogenesis of synaptonemal
FT                   complex; prevents the recruitment of Rad54p to
FT                   site-specific DNA double-strand breaks in vivo; early
FT                   meiotic gene, transcribed specifically during meiotic
FT                   prophase"
FT                   /db_xref="GOA:Q03937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03937"
FT                   /experiment="EXISTENCE:direct assay:GO:0000794 condensed
FT                   nuclear chromosome [PMID:16818607]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004857 enzyme
FT                   inhibitor activity [PMID:18347097]"
FT                   /experiment="EXISTENCE:direct assay:GO:0045950 negative
FT                   regulation of mitotic recombination [PMID:16818607]"
FT                   /experiment="EXISTENCE:direct assay:GO:1903873 negative
FT                   regulation of DNA recombinase mediator complex assembly
FT                   [PMID:18347097]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0007130
FT                   synaptonemal complex assembly [PMID:24367271]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0045950
FT                   negative regulation of mitotic recombination
FT                   [PMID:16818607]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004857 enzyme
FT                   inhibitor activity [PMID:27483004]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045950 negative
FT                   regulation of mitotic recombination [PMID:16818607]"
FT                   /protein_id="DAA11861.1"
FT                   /translation="MQQRSNRRSCSYIPLGVHNNAEKSLCTEVAPARKNKRSITTSPIV
FT                   NINVVERRLFNLELEKQQLRAKNLSENTGGGSPNGGAYLDAKKGVREQDQYQGGPSKEL
FT                   DRLQPPPSMKKSPPRKKKSLKDLIYETNKTFYQVDSNKVKYKVGLSKKQLLPSKTVDN"
FT   gene            complement(478474..478758)
FT                   /gene="DAD1"
FT                   /locus_tag="YDR016C"
FT   mRNA            complement(478474..478758)
FT                   /gene="DAD1"
FT                   /locus_tag="YDR016C"
FT                   /product="Dad1p"
FT   CDS_pept        complement(478474..478758)
FT                   /codon_start=1
FT                   /gene="DAD1"
FT                   /locus_tag="YDR016C"
FT                   /product="Dad1p"
FT                   /note="Essential subunit of the Dam1 complex (aka DASH
FT                   complex); complex couples kinetochores to the force
FT                   produced by MT depolymerization thereby aiding in
FT                   chromosome segregation; is transferred to the kinetochore
FT                   prior to mitosis"
FT                   /db_xref="GOA:Q12248"
FT                   /db_xref="InterPro:IPR013958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12248"
FT                   /experiment="EXISTENCE:direct assay:GO:0008017 microtubule
FT                   binding [PMID:15664196|PMID:16777964]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008608 attachment
FT                   of spindle microtubules to kinetochore [PMID:17620411]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031116 positive
FT                   regulation of microtubule polymerization [PMID:15664196]"
FT                   /experiment="EXISTENCE:direct assay:GO:0042729 DASH complex
FT                   [PMID:15640796|PMID:15664196]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051010 microtubule
FT                   plus-end binding [PMID:17620411|PMID:20479465]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051987 positive
FT                   regulation of attachment of spindle microtubules to
FT                   kinetochore [PMID:20479465|PMID:20479468]"
FT                   /protein_id="DAA11862.1"
FT                   /translation="MMASTSNDEEKLISTTDKYFIEQRNIVLQEINETMNSILNGLNGL
FT                   NISLESSIAVGREFQSVSDLWKTLYDGLESLSDEAPIDEQPTLSQSKTK"
FT   gene            complement(479115..482267)
FT                   /gene="KCS1"
FT                   /locus_tag="YDR017C"
FT   mRNA            complement(479115..482267)
FT                   /gene="KCS1"
FT                   /locus_tag="YDR017C"
FT                   /product="inositol polyphosphate kinase KCS1"
FT   CDS_pept        complement(479115..482267)
FT                   /codon_start=1
FT                   /gene="KCS1"
FT                   /locus_tag="YDR017C"
FT                   /product="inositol polyphosphate kinase KCS1"
FT                   /EC_number="2.7.4.21"
FT                   /note="Inositol hexakisphosphate and inositol
FT                   heptakisphosphate kinase; generation of high energy
FT                   inositol pyrophosphates by Kcs1p is required for many
FT                   processes such as vacuolar biogenesis, stress response, RNA
FT                   polymerase I-mediated rRNA transcription and telomere
FT                   maintenance; inositol hexakisphosphate is also known as
FT                   IP6; inositol heptakisphosphate is also known as IP7"
FT                   /db_xref="GOA:Q12494"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="InterPro:IPR038286"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12494"
FT                   /experiment="EXISTENCE:direct assay:GO:0000827
FT                   inositol-1,3,4,5,6-pentakisphosphate kinase activity
FT                   [PMID:10827188]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000828 inositol
FT                   hexakisphosphate kinase activity
FT                   [PMID:10574768|PMID:11956213]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000829 inositol
FT                   heptakisphosphate kinase activity [PMID:11956213]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0032958 inositol
FT                   phosphate biosynthetic process
FT                   [PMID:10574768|PMID:17412958]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0010919
FT                   regulation of inositol phosphate biosynthetic process
FT                   [PMID:23824185]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0032958 inositol
FT                   phosphate biosynthetic process [PMID:11956213]"
FT                   /protein_id="DAA11863.1"
FT                   /translation="MDTSHEIHDKIPDTLREQQQHLRQKESEGCITTLKDLNVPETKKL
FT                   SSVLHGRKASTYLRIFRDDECLADNNNGVDSNNGGSVTCADKITRSEATPKSVPEGLQV
FT                   SEKKNNPDTLSSSLSSFILSNHEEPAIKPNKHVAHRNNITETGQGSGEDIAKQQSHQPQ
FT                   VLHHQTSLKPIQNVDEGCISPKSTYQESLHGISEDLTLKPVSSATYYPHKSKADSGYEE
FT                   KDKMENDIDTIQPATINCASGIATLPSSYNRHTFKVKTYSTLSQSLRQENVNNRSNEKK
FT                   PQQFVPHSESIKEKPNTFEQDKEGEQADEEEDEGDNEHREYPLAVELKPFTNRVGGHTA
FT                   IFRFSKRAVCKALVNRENRWYENIELCHKELLQFMPRYIGVLNVRQHFQSKDDFLSDLD
FT                   QENNGKNDTSNENKDIEVNHNNNDDIALNTEPTGTPLTHIHSFPLEHSSRQVLEKEHPE
FT                   IESVHPHVKRSLSSSNQPSLLPEVVLNDNRHIIPESLWYKYSDSPNSAPNDSYFSSSSS
FT                   HNSCSFGERGNTNKLKRRDSGSTMINTELKNLVIREVFAPKCFRRKRNSNTTTMGNHNA
FT                   RLGSSPSFLTQKSRASSHDASNTSMKTLGDSSSQASLQMDDSKVNPNLQDPFLKKSLHE
FT                   KISNALDGSHSVMDLKQFHKNEQIKHKNSFCNSLSPILTATNSRDDGEFATSPNYISNA
FT                   QDGVFDMDEDTGNETINMDNHGCHLDSGKNMIIKSLAYNVSNDYSHHDIESITFEETSH
FT                   TIVSKFILLEDLTRNMNKPCALDLKMGTRQYGVDAKRAKQLSQRAKCLKTTSRRLGVRI
FT                   CGLKVWNKDYYITRDKYFGRRVKVGWQFARVLARFLYDGKTIESLIRQIPRLIKQLDTL
FT                   YSEIFNLKGYRLYGASLLLMYDGDANKSNSKRKKAANVKVNLIDFARCVTKEDAMECMD
FT                   KFRIPPKSPNIEDKGFLRGVKSLRFYLLLIWNYLTSDMPLIFDEVEMNDMISEEADSNS
FT                   FTSATGSKINFNSKWDWLDEFDKEDEEMYNDPNSKLRQKWRKYELIFDAEPRYNDDAQV
FT                   SD"
FT   gene            complement(482670..483860)
FT                   /locus_tag="YDR018C"
FT   mRNA            complement(482670..483860)
FT                   /locus_tag="YDR018C"
FT                   /product="putative acyltransferase"
FT   CDS_pept        complement(482670..483860)
FT                   /codon_start=1
FT                   /locus_tag="YDR018C"
FT                   /product="putative acyltransferase"
FT                   /note="Probable membrane protein with three predicted
FT                   transmembrane domains; similar to C. elegans F55A11.5 and
FT                   maize 1-acyl-glycerol-3-phosphate acyltransferase; YDR018C
FT                   has a paralog, CST26, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:Q12185"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR032098"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12185"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:24390141]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:26928762]"
FT                   /protein_id="DAA11864.1"
FT                   /translation="MKHSQKYRRYGIYEKTGNPFIKGLQRLLIACLFISGSLSIVVFQI
FT                   CLQVLLPWSKIRFQNGINQSKKAFIVLLCMILNMVAPSSLNVTFETSRPLKNSSNAKPC
FT                   FRFKDRAIIIANHQMYADWIYLWWLSFVSNLGGNVYIILKKALQYIPLLGFGMRNFKFI
FT                   FLSRNWQKDEKALTNSLVSMDLNARCKGPLTNYKSCYSKTNESIAAYNLIMFPEGTNLS
FT                   LKTREKSEAFCQRAHLDHVQLRHLLLPHSKGLKFAVEKLAPSLDAIYDVTIGYSPALRT
FT                   EYVGTKFTLKKIFLMGVYPEKVDFYIREFRVNEIPLQDDEVFFNWLLGVWKEKDQLLED
FT                   YYNTGQFKSNAKNDNQSIVVTTQTTGFQHETLTPRILSYYGFFAFLILVFVMKKNH"
FT   rep_origin      484006..484059
FT                   /note="ARS417; Autonomously Replicating Sequence"
FT   gene            complement(484163..485365)
FT                   /gene="GCV1"
FT                   /gene_synonym="GSD1"
FT                   /locus_tag="YDR019C"
FT   mRNA            complement(484163..485365)
FT                   /gene="GCV1"
FT                   /gene_synonym="GSD1"
FT                   /locus_tag="YDR019C"
FT                   /product="glycine decarboxylase subunit T"
FT   CDS_pept        complement(484163..485365)
FT                   /codon_start=1
FT                   /gene="GCV1"
FT                   /gene_synonym="GSD1"
FT                   /locus_tag="YDR019C"
FT                   /product="glycine decarboxylase subunit T"
FT                   /EC_number="2.1.2.10"
FT                   /note="T subunit of the mitochondrial glycine decarboxylase
FT                   complex; glycine decarboxylase is required for the
FT                   catabolism of glycine to 5,10-methylene-THF; expression is
FT                   regulated by levels of levels of 5,10-methylene-THF in the
FT                   cytoplasm"
FT                   /db_xref="GOA:P48015"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48015"
FT                   /experiment="EXISTENCE:curator inference:GO:0006546 glycine
FT                   catabolic process [PMID:9047339]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion
FT                   [PMID:14562095|PMID:14576278|PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006730
FT                   one-carbon metabolic process [PMID:10871621]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004375 glycine
FT                   dehydrogenase (decarboxylating) activity [PMID:9047339]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006544 glycine
FT                   metabolic process [PMID:9047339]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006730
FT                   one-carbon metabolic process [PMID:10871621]"
FT                   /protein_id="DAA11865.1"
FT                   /translation="MSIIKKIVFKRFNSTLKKTALHDLHVSLGGTMVPYAGYSMPVLYK
FT                   GQTHIESHNWTRTNAGLFDVSHMLQSKLSGPHSVKFLQRVTPTDFNALPVGSGTLSVLL
FT                   NPQGGVVDDTIITKENDDNEFYIVTNAGCAERDTEFFHDELQNGSTLDCQWKIIEGRSL
FT                   LALQGPKAKDVLEPLLSKTAPGKDLKELFFGQRHEFALKDGSLVQIARGGYTGEDGFEI
FT                   SIANEKAVEFAEQLLANPVMKPIGLAARDSLRLEAGMCLYGHELDESITPVEAALNWVI
FT                   SKSRRDLVDQKYWFNGYAKIMDQLNNKTYSKVRVGFKYLKKGPAARNGVKIFLPDAETE
FT                   VGLVTSGSASPTLNNINIGQAYVQKGYHKKGTKLLVQVRNKFYPIELAKMPLVPTHYYK
FT                   Q"
FT   gene            complement(485746..486444)
FT                   /gene="DAS2"
FT                   /gene_synonym="RRT3"
FT                   /locus_tag="YDR020C"
FT   mRNA            complement(485746..486444)
FT                   /gene="DAS2"
FT                   /gene_synonym="RRT3"
FT                   /locus_tag="YDR020C"
FT                   /product="putative uridine kinase DAS2"
FT   CDS_pept        complement(485746..486444)
FT                   /codon_start=1
FT                   /gene="DAS2"
FT                   /gene_synonym="RRT3"
FT                   /locus_tag="YDR020C"
FT                   /product="putative uridine kinase DAS2"
FT                   /EC_number="2.7.1.48"
FT                   /note="hypothetical protein; non-essential gene identified
FT                   in a screen for mutants with increased levels of rDNA
FT                   transcription; weak similarity with uridine kinases and
FT                   with phosphoribokinases"
FT                   /db_xref="GOA:Q12084"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12084"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /protein_id="DAA11866.1"
FT                   /translation="MDRKAVEEKRIVISIGGGHATGVGAIALDLQNTFKSLYNSINIRV
FT                   INLDNMIEGNIKSYNNNDYDFDNILNLVYEKHAVTSQNDMIQHDYEDPIDLIIVCGCYA
FT                   LYDKRINEISQLKVFLDSDADKRLISLIKKKNVGSNEQLAQLITEYMDHLRPEMQQYIE
FT                   PTRTFADLIIPSTNENLGRAVLVDGIVKAIEDTKSQIEGNNTNNKIRPRLWDFEAETMD
FT                   LEKDRYYDLS"
FT   gene            486804..488003
FT                   /gene="FAL1"
FT                   /locus_tag="YDR021W"
FT   mRNA            486804..488003
FT                   /gene="FAL1"
FT                   /locus_tag="YDR021W"
FT                   /product="ATP-dependent RNA helicase FAL1"
FT   CDS_pept        486804..488003
FT                   /codon_start=1
FT                   /gene="FAL1"
FT                   /locus_tag="YDR021W"
FT                   /product="ATP-dependent RNA helicase FAL1"
FT                   /EC_number="3.6.4.13"
FT                   /note="Nucleolar protein required for maturation of 18S
FT                   rRNA; member of the eIF4A subfamily of DEAD-box
FT                   ATP-dependent RNA helicases; 18S rRNA biogenesis defect of
FT                   the null mutant is functionally complemented by human
FT                   EIF4A3"
FT                   /db_xref="GOA:Q12099"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12099"
FT                   /experiment="EXISTENCE:direct assay:GO:0005730 nucleolus
FT                   [PMID:9372960]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030688 preribosome,
FT                   small subunit precursor [PMID:15167894]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000462
FT                   maturation of SSU-rRNA from tricistronic rRNA transcript
FT                   (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:16449634]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0097078
FT                   FAL1-SGD1 complex [PMID:21576267]"
FT                   /protein_id="DAA11867.1"
FT                   /translation="MSFDREEDQKLKFKTSKKLKVSSTFESMNLKDDLLRGIYSYGFEA
FT                   PSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGLLQAIDLRKKDLQALILSPTRELA
FT                   SQIGQVVKNLGDYMNVNAFAITGGKTLKDDLKKMQKHGCQAVSGTPGRVLDMIKKQMLQ
FT                   TRNVQMLVLDEADELLSETLGFKQQIYDIFAKLPKNCQVVVVSATMNKDILEVTRKFMN
FT                   DPVKILVKRDEISLEGIKQYVVNVDKEEWKFDTLCDIYDSLTITQCVIFCNTKKKVDWL
FT                   SQRLIQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINY
FT                   DLPEIIENYIHRIGRSGRFGRKGVAINFITKADLAKLREIEKFYSIKINPMPANFAELS
FT                   "
FT   gene            complement(488072..488662)
FT                   /gene="ATG31"
FT                   /gene_synonym="CIS1"
FT                   /locus_tag="YDR022C"
FT   mRNA            complement(488072..488662)
FT                   /gene="ATG31"
FT                   /gene_synonym="CIS1"
FT                   /locus_tag="YDR022C"
FT                   /product="Atg31p"
FT   CDS_pept        complement(488072..488662)
FT                   /codon_start=1
FT                   /gene="ATG31"
FT                   /gene_synonym="CIS1"
FT                   /locus_tag="YDR022C"
FT                   /product="Atg31p"
FT                   /note="Autophagy-specific protein required for
FT                   autophagosome formation; forms a complex with Atg17p and
FT                   Atg29p that localizes other proteins to the
FT                   pre-autophagosomal structure; constitutively
FT                   phosphorylated, and phosphorylation of residue S174 is
FT                   required for function; high-copy suppressor of CIK1
FT                   deletion"
FT                   /db_xref="GOA:Q12421"
FT                   /db_xref="InterPro:IPR018621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12421"
FT                   /experiment="EXISTENCE:direct assay:GO:0000407 phagophore
FT                   assembly site [PMID:17362880|PMID:18497569]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:1990316 Atg1/ULK1
FT                   kinase complex [PMID:26753620]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000422
FT                   autophagy of mitochondrion [PMID:19793921]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006914
FT                   autophagy [PMID:17362880]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034727
FT                   piecemeal microautophagy of the nucleus [PMID:18701704]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0044805 late
FT                   nucleophagy [PMID:22768199]"
FT                   /protein_id="DAA11868.1"
FT                   /translation="MNVTVTVYDKNVKYRLEENIKNNKGPSNDDQPAYNNESKSTDGSD
FT                   YAMFPTNIKYIFEDNNDELVDSSDAALTAGIDKVGDELENVIIVQLDESGSLEDITLIS
FT                   DQYELLSHRTNSLSLEENQMRTLSSHGDDKSNDEEEELSVDSDRFRVDSDIELDVISQF
FT                   CDLSPFLRDLSLNDLIKLYVTQNEQLQMLSNSV"
FT   gene            complement(488797..488870)
FT                   /locus_tag="tV(UAC)D"
FT   tRNA            complement(488797..488870)
FT                   /locus_tag="tV(UAC)D"
FT                   /product="tRNA-Val"
FT                   /note="tV(UAC)D; Valine tRNA (tRNA-Val), predicted by
FT                   tRNAscan-SE analysis"
FT                   /experiment="EXISTENCE:curator inference:GO:0005829 cytosol
FT                   [PMID:9023104]"
FT                   /experiment="EXISTENCE:curator inference:GO:0006414
FT                   translational elongation [PMID:9023104]"
FT   gene            489508..490896
FT                   /gene="SES1"
FT                   /locus_tag="YDR023W"
FT   mRNA            489508..490896
FT                   /gene="SES1"
FT                   /locus_tag="YDR023W"
FT                   /product="serine--tRNA ligase SES1"
FT   CDS_pept        489508..490896
FT                   /codon_start=1
FT                   /gene="SES1"
FT                   /locus_tag="YDR023W"
FT                   /product="serine--tRNA ligase SES1"
FT                   /EC_number="6.1.1.11"
FT                   /note="Cytosolic seryl-tRNA synthetase; class II
FT                   aminoacyl-tRNA synthetase that aminoacylates tRNA(Ser),
FT                   displays tRNA-dependent amino acid recognition which
FT                   enhances discrimination of the serine substrate, interacts
FT                   with peroxin Pex21p"
FT                   /db_xref="GOA:P07284"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07284"
FT                   /experiment="EXISTENCE:direct assay:GO:0004828 serine-tRNA
FT                   ligase activity [PMID:3031581]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:11914276|PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006434 seryl-tRNA
FT                   aminoacylation [PMID:3031581]"
FT                   /experiment="EXISTENCE:direct assay:GO:0010494 cytoplasmic
FT                   stress granule [PMID:26777405]"
FT                   /protein_id="DAA11869.1"
FT                   /translation="MLDINQFIEDKGGNPELIRQSQKARNASVEIVDEIISDYKDWVKT
FT                   RFELDELNKKFNKLQKDIGLKFKNKEDASGLLAEKEKLTQQKKELTEKEQQEDKDLKKK
FT                   VFQVGNIVHPSVVVSNDEENNELVRTWKPEDLEAVGPIASVTGKPASLSHHEILLRLDG
FT                   YDPDRGVKICGHRGYFFRNYGVFLNQALINYGLQFLAAKGYIPLQAPVMMNKELMSKTA
FT                   QLSEFDEELYKVIDGEDEKYLIATSEQPISAYHSGEWFEKPQEQLPIHYVGYSSCFRRE
FT                   AGSHGKDAWGVFRVHAFEKIEQFVITEPEKSWEEFEKMISYSEEFYKSLKLPYRIVGIV
FT                   SGELNNAAAKKYDLEAWFPYQKEYKELVSCSNCTDYQSRNLEIRCGIKKMGDREKKYVH
FT                   CLNSTLAATQRALCCILENYQTEDGLVVPEVLRKYIPGEPEFLPFVNELPKNSTSSKDK
FT                   KKKN"
FT   gene            491515..492324
FT                   /gene="RPS11A"
FT                   /locus_tag="YDR025W"
FT   mRNA            join(491515..491559,491899..492324)
FT                   /gene="RPS11A"
FT                   /locus_tag="YDR025W"
FT                   /product="ribosomal 40S subunit protein S11A"
FT   CDS_pept        join(491515..491559,491899..492324)
FT                   /codon_start=1
FT                   /gene="RPS11A"
FT                   /locus_tag="YDR025W"
FT                   /product="ribosomal 40S subunit protein S11A"
FT                   /note="Protein component of the small (40S) ribosomal
FT                   subunit; homologous to mammalian ribosomal protein S11 and
FT                   bacterial S17; N-terminally propionylated in vivo; RPS11A
FT                   has a paralog, RPS11B, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:P0CX47"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR028333"
FT                   /db_xref="InterPro:IPR032440"
FT                   /db_xref="PDB:1K5X"
FT                   /db_xref="PDB:3J6X"
FT                   /db_xref="PDB:3J6Y"
FT                   /db_xref="PDB:3J77"
FT                   /db_xref="PDB:3J78"
FT                   /db_xref="PDB:4U3M"
FT                   /db_xref="PDB:4U3N"
FT                   /db_xref="PDB:4U3U"
FT                   /db_xref="PDB:4U4N"
FT                   /db_xref="PDB:4U4O"
FT                   /db_xref="PDB:4U4Q"
FT                   /db_xref="PDB:4U4R"
FT                   /db_xref="PDB:4U4U"
FT                   /db_xref="PDB:4U4Y"
FT                   /db_xref="PDB:4U4Z"
FT                   /db_xref="PDB:4U50"
FT                   /db_xref="PDB:4U51"
FT                   /db_xref="PDB:4U52"
FT                   /db_xref="PDB:4U53"
FT                   /db_xref="PDB:4U55"
FT                   /db_xref="PDB:4U56"
FT                   /db_xref="PDB:4U6F"
FT                   /db_xref="PDB:4V4B"
FT                   /db_xref="PDB:4V6I"
FT                   /db_xref="PDB:4V7R"
FT                   /db_xref="PDB:4V88"
FT                   /db_xref="PDB:4V8Y"
FT                   /db_xref="PDB:4V8Z"
FT                   /db_xref="PDB:4V92"
FT                   /db_xref="PDB:5DAT"
FT                   /db_xref="PDB:5DC3"
FT                   /db_xref="PDB:5DGE"
FT                   /db_xref="PDB:5DGV"
FT                   /db_xref="PDB:5FCI"
FT                   /db_xref="PDB:5FCJ"
FT                   /db_xref="PDB:5I4L"
FT                   /db_xref="PDB:5JUO"
FT                   /db_xref="PDB:5JUP"
FT                   /db_xref="PDB:5JUS"
FT                   /db_xref="PDB:5JUT"
FT                   /db_xref="PDB:5JUU"
FT                   /db_xref="PDB:5LL6"
FT                   /db_xref="PDB:5LYB"
FT                   /db_xref="PDB:5M1J"
FT                   /db_xref="PDB:5MC6"
FT                   /db_xref="PDB:5MEI"
FT                   /db_xref="PDB:5NDG"
FT                   /db_xref="PDB:5NDV"
FT                   /db_xref="PDB:5NDW"
FT                   /db_xref="PDB:5OBM"
FT                   /db_xref="PDB:5ON6"
FT                   /db_xref="PDB:5TBW"
FT                   /db_xref="PDB:5TGA"
FT                   /db_xref="PDB:5TGM"
FT                   /db_xref="PDB:5TZS"
FT                   /db_xref="PDB:5WLC"
FT                   /db_xref="PDB:5WYJ"
FT                   /db_xref="PDB:5WYK"
FT                   /db_xref="PDB:6EML"
FT                   /db_xref="PDB:6FAI"
FT                   /db_xref="PDB:6GQ1"
FT                   /db_xref="PDB:6GQB"
FT                   /db_xref="PDB:6GQV"
FT                   /db_xref="PDB:6HHQ"
FT                   /db_xref="PDB:6I7O"
FT                   /db_xref="PDB:6Q8Y"
FT                   /db_xref="PDB:6RBD"
FT                   /db_xref="PDB:6RBE"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CX47"
FT                   /experiment="EXISTENCE:curator inference:GO:0002181
FT                   cytoplasmic translation [PMID:6814480]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003735 structural
FT                   constituent of ribosome [PMID:6814480]"
FT                   /experiment="EXISTENCE:direct assay:GO:0022627 cytosolic
FT                   small ribosomal subunit [PMID:6814480]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030686 90S
FT                   preribosome [PMID:12150911]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000462
FT                   maturation of SSU-rRNA from tricistronic rRNA transcript
FT                   (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:16246728]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000028
FT                   ribosomal small subunit assembly [PMID:8070651]"
FT                   /protein_id="DAA11870.1"
FT                   /translation="MSTELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTP
FT                   KTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRH
FT                   KNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAGKANKQFAKF"
FT   gene            complement(492556..494268)
FT                   /gene="NSI1"
FT                   /gene_synonym="YTT1"
FT                   /locus_tag="YDR026C"
FT   mRNA            complement(492556..494268)
FT                   /gene="NSI1"
FT                   /gene_synonym="YTT1"
FT                   /locus_tag="YDR026C"
FT                   /product="Nsi1p"
FT   CDS_pept        complement(492556..494268)
FT                   /codon_start=1
FT                   /gene="NSI1"
FT                   /gene_synonym="YTT1"
FT                   /locus_tag="YDR026C"
FT                   /product="Nsi1p"
FT                   /note="RNA polymerase I termination factor; binds to rDNA
FT                   terminator element, required for efficient Pol I
FT                   termination; required for rDNA silencing at NTS1;
FT                   facilities association of Sir2p with NTS1, contributes to
FT                   rDNA stability and cell longevity; interacts physically
FT                   with Fob1p and RENT subunits, Sir2p and Net1p; may interact
FT                   with ribosomes, based on co-purification experiments;
FT                   Myb-like DNA-binding protein; NSI1 has a paralog, REB1,
FT                   that arose from the whole genome duplication"
FT                   /db_xref="GOA:Q12457"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12457"
FT                   /experiment="EXISTENCE:direct assay:GO:0003677 DNA binding
FT                   [PMID:25092870]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005730 nucleolus
FT                   [PMID:22362748|PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006363 termination
FT                   of RNA polymerase I transcription [PMID:22805593]"
FT                   /experiment="EXISTENCE:direct assay:GO:0033553 rDNA
FT                   heterochromatin [PMID:22362748]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000183
FT                   chromatin silencing at rDNA [PMID:22362748]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006363
FT                   termination of RNA polymerase I transcription
FT                   [PMID:22805593]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1900008 negative
FT                   regulation of extrachromosomal rDNA circle accumulation
FT                   involved in replicative cell aging [PMID:22362748]"
FT                   /protein_id="DAA11871.1"
FT                   /translation="MDSVSNLKSTNFQNNNDPKESVEEAVLRYVGVDLKNHIKKTKKKL
FT                   KKQKKRKHGSKMSHEDEDTDMDWYLKTSGSKDLRKVDDIEPNSVAVAAVAAAYNSSMRE
FT                   KDKRSCHKKSSNSRSERKKHRKRKSSKERKAKIKMVLDPQLTTLDDGITTTAFLPDDLI
FT                   AETAFDKYVDTEKAYLAKHPSKSLEVNEDDKENNFNNNSSTLVRIYTDLEGIPNDGSYI
FT                   KRTPKIPEKDVKSDDLILAPEENNGDTALLRSDIVKASVIDGAITKSIGKKFTPSEENA
FT                   LDQFIEEYMKIRGLDRRQMCERIWSTDGVIRDGFWANISKVLPYRTRSSIYKHIRRKYH
FT                   IFEQRGKWTPEEDQELARLCLEKEGHWTEVGKLLGRMPEDCRDRWRNYMKCGSKRGSKR
FT                   WSKEEEELLTTVVNEMIEEAHQYQRMKALEAANKNDRYNQMYSRGPKGKRISDNPTFKD
FT                   MINWTVVSERMSGTRSRIQCRYKWNKLVTDEAARSMLSIPVSERKWLLERLKQLPKTSY
FT                   SNIDWNSIATYKPGYPRTGLELRLCYEQMREKIHDFKGRSTAEIIDSLLEQIN"
FT   gene            complement(494649..497318)
FT                   /gene="VPS54"
FT                   /gene_synonym="CGP1"
FT                   /gene_synonym="LUV1"
FT                   /gene_synonym="TCS3"
FT                   /locus_tag="YDR027C"
FT   mRNA            complement(494649..497318)
FT                   /gene="VPS54"
FT                   /gene_synonym="CGP1"
FT                   /gene_synonym="LUV1"
FT                   /gene_synonym="TCS3"
FT                   /locus_tag="YDR027C"
FT                   /product="Vps54p"
FT   CDS_pept        complement(494649..497318)
FT                   /codon_start=1
FT                   /gene="VPS54"
FT                   /gene_synonym="CGP1"
FT                   /gene_synonym="LUV1"
FT                   /gene_synonym="TCS3"
FT                   /locus_tag="YDR027C"
FT                   /product="Vps54p"
FT                   /note="Component of the GARP (Golgi-associated retrograde
FT                   protein) complex; GARP is required for the recycling of
FT                   proteins from endosomes to the late Golgi, and for mitosis
FT                   after DNA damage induced checkpoint arrest; potentially
FT                   phosphorylated by Cdc28p; members of the GARP complex are
FT                   Vps51p-Vps52p-Vps53p-Vps54p"
FT                   /db_xref="GOA:Q12071"
FT                   /db_xref="InterPro:IPR039745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12071"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005794 Golgi
FT                   apparatus [PMID:10637310]"
FT                   /experiment="EXISTENCE:direct assay:GO:0042147 retrograde
FT                   transport, endosome to Golgi [PMID:12686613]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006896 Golgi to
FT                   vacuole transport [PMID:10637310]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030476
FT                   ascospore wall assembly [PMID:17645731]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0090156 cellular
FT                   sphingolipid homeostasis [PMID:26357016]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0000938 GARP
FT                   complex [PMID:10637310]"
FT                   /protein_id="DAA11872.1"
FT                   /translation="MSISETPHNKSQGLQKAAGRPKIVVPEGSPSRNSDSGSFTIEGDT
FT                   SLNDDLLSISGSVTPRARRSSRLSLDSITPRRSFDSRTLSVANSRSFGFENETHSGSMD
FT                   FSPLGNNSIYEIVMNTRRKNWLNYPTVADIPQVSLSKNDLDDHWKTHVIEYVKNIKSDY
FT                   QIFQSTNNIRNMNQMEQLKELREGENMHEESFEANLRQGDAELINSIPDFYFSDKFQLD
FT                   NPRTFHKVLDAIDLFLTKLDMKRQAERDEAFSELRDRLNDFLDIVETLLVTEISKSSHK
FT                   FFHALSEVDNIQKRALDTMSELKELAQNIKTIDAENIRKKISHLEMIFKRKNVEKLEQG
FT                   LLQAKLVLNKTDECKSMYEENKLDNCLELIKSIDYLIKGDDSINEDVQSWTRCWPYKLS
FT                   NLRTIPALSATREFLTNMKIEIGGKFSLQLSILLIDDLRSFCKSIKPKETLHRIQTGSN
FT                   DKKQTIFTDNFSSKITELIVRLNRCEELTSAFDLYREKSITELKSIIKIYLPTENAHAD
FT                   NNHDEKHLNNGSTSGSKLSRLIKEQTPAEFQSMLVNIFTHALEALRRLYGHQKLLLDIS
FT                   LNELASVKSPNENQHNMITQLDIRTGINEIIRIIQLRTGKIIAVRRELNLSLRYDYFLK
FT                   FYAICVIFIQECEVLSGEFLTKYLSNVLASQIKHYANAQSSKNYRNIKKKIDAEEWIPY
FT                   IVDSSIQSDVNDIVSSIDIDPLSWTTILDMVGGSHDCENGRSEDKEKDEGNETYQGHRK
FT                   SVVVGDKTFVASSSLLATIEVIKELMVLSINLPSIYLSNFEKLCYDALQYYNSSAMASV
FT                   TQPGNSLLKTGRNLSIMGESLDCLAEFVIIVQRFYQRLSNSNRDFEPFDASHYTTLLGQ
FT                   FQASSNKIYMANAPPPPV"
FT   gene            complement(497835..500879)
FT                   /gene="REG1"
FT                   /gene_synonym="HEX2"
FT                   /gene_synonym="PZF240"
FT                   /gene_synonym="SPP43"
FT                   /gene_synonym="SRN1"
FT                   /locus_tag="YDR028C"
FT   mRNA            complement(497835..500879)
FT                   /gene="REG1"
FT                   /gene_synonym="HEX2"
FT                   /gene_synonym="PZF240"
FT                   /gene_synonym="SPP43"
FT                   /gene_synonym="SRN1"
FT                   /locus_tag="YDR028C"
FT                   /product="protein phosphatase regulator REG1"
FT   CDS_pept        complement(497835..500879)
FT                   /codon_start=1
FT                   /gene="REG1"
FT                   /gene_synonym="HEX2"
FT                   /gene_synonym="PZF240"
FT                   /gene_synonym="SPP43"
FT                   /gene_synonym="SRN1"
FT                   /locus_tag="YDR028C"
FT                   /product="protein phosphatase regulator REG1"
FT                   /note="Regulatory subunit of type 1 protein phosphatase
FT                   Glc7p; involved in negative regulation of
FT                   glucose-repressible genes; involved in regulation of the
FT                   nucleocytoplasmic shuttling of Hxk2p; REG1 has a paralog,
FT                   REG2, that arose from the whole genome duplication"
FT                   /db_xref="GOA:Q00816"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00816"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:10454550]"
FT                   /experiment="EXISTENCE:direct assay:GO:0007039 protein
FT                   catabolic process in the vacuole [PMID:14684743]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006986 response
FT                   to unfolded protein [PMID:25730376]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007039 protein
FT                   catabolic process in the vacuole [PMID:14684743]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0042149 cellular
FT                   response to glucose starvation [PMID:19723765]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043433 negative
FT                   regulation of DNA-binding transcription factor activity
FT                   [PMID:12167649]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0061587 transfer
FT                   RNA gene-mediated silencing [PMID:23707796]"
FT                   /protein_id="DAA11873.1"
FT                   /translation="MSTNLANYFAGKKDIENEHVNRNASHESNSKSDVKISGNDNDNDE
FT                   DMGPSVSMAVQAKNDDDFHKSTFNLKRTRSMGLLDEYIDPTKKLLGRSDDLYDNDNEYY
FT                   DNSSNNSSSNSSDDDYDDGYQEHSTSVSPPPADNDSYLIPQDDNDVVVEPERHVDYLSH
FT                   EWKESEISNSWKYIILKKKKRDVDLVNAARLENASWRTWAKARNNLKTVSPEVVNWSKD
FT                   SDVTWLYGPIVRDSEGNAQSEEEHDLERGYGSDDENSKRISMPTKNSKSIAAAPKPILK
FT                   KRTVTEIIEDNALWKLNEARKHMTEMKHASVIMDPNGNKNVHDDFDALAAQVNAQYYHY
FT                   PKESNSSVSLKSQHSDKKDNSTIPNPVGENSNGGGDKGEEDLHLKSALHVQNNRSTAQS
FT                   NKSILENSTNDRKANLDQNLNSPDNNRFPSSTSSSNRDNENNSMGLSSILTSNPSEKSN
FT                   KPTKNRHIHFNDRVEQCMALRYPASQSEDDESDDENKQYVDVNNNANVTTINNNRTPLL
FT                   AIQHKSIPINSATEHLNKNTSDDDTSSQSSSSSHSDDEEHGGLYINARFSRRSDSGVHS
FT                   PITDNSSVASSTTSRAHVRPIIKLLPDTTLNYGSDEESDNGEFNGYGNAVSHNVNTSRG
FT                   YDYIYDYNSVYTGDTSSFLPVDSCDIVDVPEGMDLQTAIADDNASNYEFNNAVESKEKH
FT                   VPQLHKASANNTTRQHGSHMLLYDDDNYSSSSDSEQQFIEDSQYNSSDDEEEEDDDDQE
FT                   VDDNHDEGLSLRRTLSLGKSGSTNSLYDLAQPSLSSATPQQKNPTNFTGGKTDVDKDAQ
FT                   LAVRPYPLKRNSSSGNFIFNSDSEEESSSEEEQRPLPANSQLVNRSVLKGSVTPANISS
FT                   QKKKALPKQPKASDSSQSFRIVNNTPSPAEVGASDVAIEGYFSPRNESIKSVVSGGNMM
FT                   DHQDHSEMDTLAKGFENCHINNASKLKDKKVDSVQTTRKEASLTDSSNESLHKVVQNAR
FT                   GMASKYLHSWKKSDVKPQENGNDSS"
FT   gene            501100..501414
FT                   /locus_tag="YDR029W"
FT   mRNA            501100..501414
FT                   /locus_tag="YDR029W"
FT                   /product="hypothetical protein"
FT   CDS_pept        501100..501414
FT                   /codon_start=1
FT                   /locus_tag="YDR029W"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; conserved among S. cerevisiae
FT                   strains; YDR029W is not an essential gene"
FT                   /db_xref="GOA:Q12111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12111"
FT                   /protein_id="DAA80275.1"
FT                   /translation="MSKYYILIELMNDKKNTNSSCDIFSFYLNFSDNPFSSFRLKSRLL
FT                   YGIFSCFLLFYSLKDLIGVFKQKYLYLSILLLWLLVLLFCLAKGLSHNLRADSFLQYPL
FT                   "
FT   gene            complement(501753..503273)
FT                   /gene="RAD28"
FT                   /locus_tag="YDR030C"
FT   mRNA            complement(501753..503273)
FT                   /gene="RAD28"
FT                   /locus_tag="YDR030C"
FT                   /product="Rad28p"
FT   CDS_pept        complement(501753..503273)
FT                   /codon_start=1
FT                   /gene="RAD28"
FT                   /locus_tag="YDR030C"
FT                   /product="Rad28p"
FT                   /note="Protein involved in DNA repair; related to the human
FT                   CSA protein that is involved in transcription-coupled
FT                   repair nucleotide excision repair"
FT                   /db_xref="GOA:Q12021"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR042238"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12021"
FT                   /experiment="EXISTENCE:curator inference:GO:0005634 nucleus
FT                   [PMID:8830695]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006281 DNA
FT                   repair [PMID:8830695]"
FT                   /protein_id="DAA11874.1"
FT                   /translation="MDPFLEFRVGNISLNEFYRRTIQSEFERILEDPLSNMKNYRFSKQ
FT                   SNYSTKEKTPLSIGVNCLDIDDTGQVLLGGGDDGSLSIWGLDESLHRNDEGEQELINKR
FT                   LNYIKRQPHQSDDEPAQIMGYKNKRTRINDNNTMRLVHSFQTQRNKYRMYRQSSAAVPV
FT                   QRSHISNKTDSPIGFSETLSETDSEASISHHKYGITTLKWYKADNGMFFTGSNDKTVKI
FT                   WDTNRFEAVQDINLGYKINQIDNNVVDDSSLLVVASEDYYPRLIDLRTMNSGVTALGMG
FT                   NQTRMQSEILCCKFNPVREQIIACGDMEGGVKLWDLRMRNRLYSELKRNKNRFKTINND
FT                   DNDDQSDVYFSSNQSKAHLRCCSDIVWNSEGSELCSVGMDGKLNVWRPFTEILQPEGLA
FT                   SYSQLGTQDLSRIKYKKRVSRRLLWFDKFLLCITDNGEVEIYNTEEKKLWNKLEYPMVN
FT                   QVKKNQASHCQFSSMIVQTNIMNSVGLKLFFGTNNNTVSDGGSIFECS"
FT   gene            503498..503863
FT                   /gene="MIX14"
FT                   /gene_synonym="MIC14"
FT                   /locus_tag="YDR031W"
FT   mRNA            503498..503863
FT                   /gene="MIX14"
FT                   /gene_synonym="MIC14"
FT                   /locus_tag="YDR031W"
FT                   /product="Mix14p"
FT   CDS_pept        503498..503863
FT                   /codon_start=1
FT                   /gene="MIX14"
FT                   /gene_synonym="MIC14"
FT                   /locus_tag="YDR031W"
FT                   /product="Mix14p"
FT                   /note="Mitochondrial intermembrane space hypothetical
FT                   protein; required for normal oxygen consumption; contains
FT                   twin cysteine-x9-cysteine motifs; protein abundance
FT                   increases in response to DNA replication stress"
FT                   /db_xref="GOA:Q04341"
FT                   /db_xref="InterPro:IPR016611"
FT                   /db_xref="InterPro:IPR031731"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04341"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005758
FT                   mitochondrial intermembrane space [PMID:17095012]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0009060 aerobic
FT                   respiration [PMID:19703468]"
FT                   /protein_id="DAA11875.1"
FT                   /translation="MSDILDEIVIEDVVANCPQEFLQYHKCIRDNEENPGKCKDGRMIL
FT                   STCIREKVPSVKSIMSECSEPMKKYDQCIRDNMGTRTINENCLGFLQDLRKCAELQVKN
FT                   KNIKPSINGVNLELIKD"
FT   gene            complement(504099..504695)
FT                   /gene="PST2"
FT                   /locus_tag="YDR032C"
FT   mRNA            complement(504099..504695)
FT                   /gene="PST2"
FT                   /locus_tag="YDR032C"
FT                   /product="flavodoxin-like fold family protein"
FT   CDS_pept        complement(504099..504695)
FT                   /codon_start=1
FT                   /gene="PST2"
FT                   /locus_tag="YDR032C"
FT                   /product="flavodoxin-like fold family protein"
FT                   /note="Protein with similarity to a family of
FT                   flavodoxin-like proteins; induced by oxidative stress in a
FT                   Yap1p dependent manner; the authentic, non-tagged protein
FT                   is detected in highly purified mitochondria in
FT                   high-throughput studies; protein abundance increases in
FT                   response to DNA replication stress; PST2 has a paralog,
FT                   RFS1, that arose from the whole genome duplication"
FT                   /db_xref="GOA:Q12335"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="PDB:5MP4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12335"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:16622836]"
FT                   /experiment="EXISTENCE:direct assay:GO:0045121 membrane
FT                   raft [PMID:19064668]"
FT                   /protein_id="DAA11876.1"
FT                   /translation="MPRVAIIIYTLYGHVAATAEAEKKGIEAAGGSADIYQVEETLSPE
FT                   VVKALGGAPKPDYPIATQDTLTEYDAFLFGIPTRFGNFPAQWKAFWDRTGGLWAKGALH
FT                   GKVAGCFVSTGTGGGNEATIMNSLSTLAHHGIIFVPLGYKNVFAELTNMDEVHGGSPWG
FT                   AGTIAGSDGSRSPSALELQVHEIQGKTFYETVAKF"
FT   rep_origin      505343..505584
FT                   /note="ARS450; Autonomously Replicating Sequence"
FT   gene            508147..509109
FT                   /gene="MRH1"
FT                   /locus_tag="YDR033W"
FT   mRNA            508147..509109
FT                   /gene="MRH1"
FT                   /locus_tag="YDR033W"
FT                   /product="Mrh1p"
FT   CDS_pept        508147..509109
FT                   /codon_start=1
FT                   /gene="MRH1"
FT                   /locus_tag="YDR033W"
FT                   /product="Mrh1p"
FT                   /note="Protein that localizes primarily to the plasma
FT                   membrane; also found at the nuclear envelope; long-lived
FT                   protein that is asymmetrically retained in the plasma
FT                   membrane of mother cells; the authentic, non-tagged protein
FT                   is detected in mitochondria in a phosphorylated state; null
FT                   mutation confers sensitivity to acetic acid"
FT                   /db_xref="GOA:Q12117"
FT                   /db_xref="InterPro:IPR001425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12117"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:10675524|PMID:12469340|PMID:16622836]"
FT                   /protein_id="DAA11877.1"
FT                   /translation="MSTFETLIKRGGNEAIKINPPTGADFHITSRGSDWFWTCFCCYLL
FT                   FGLILTFLMFRKPVNDRFFYLTGIAPNFFMCIAYFTMASNLGWIPVKAKYNHVQTSTQK
FT                   EHPGYRQIFYSRFVGWFLALPWPIIQICMLAGTPFWQMAFNVCITEFFTVCWLIAACVH
FT                   STYKWGYYTIGLGAAIVVSISVMTTSYNLVKQRDNDIRLTFLVFFSIIMFLWIIAYPTC
FT                   FGITDGGNVLQPDSAGIFYGIIDLILMCFIPTLLVPIANHFGADKLGYHFGPSDAEAVM
FT                   APKAPVASPRPAATPNLSKDKKKKSKKSKKSKKSKKSEE"
FT   gene            complement(509737..512109)
FT                   /gene="LYS14"
FT                   /locus_tag="YDR034C"
FT   mRNA            complement(509737..512109)
FT                   /gene="LYS14"
FT                   /locus_tag="YDR034C"
FT                   /product="Lys14p"
FT   CDS_pept        complement(509737..512109)
FT                   /codon_start=1
FT                   /gene="LYS14"
FT                   /locus_tag="YDR034C"
FT                   /product="Lys14p"
FT                   /note="Transcriptional activator involved in regulating
FT                   lysine biosynthesis; involved in the regulation of genes of
FT                   the lysine biosynthesis pathway; requires 2-aminoadipate
FT                   semialdehyde as co-inducer"
FT                   /db_xref="GOA:P40971"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40971"
FT                   /experiment="EXISTENCE:direct assay:GO:0000978 RNA
FT                   polymerase II proximal promoter sequence-specific DNA
FT                   binding [PMID:9701810]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:10975256]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043565
FT                   sequence-specific DNA binding [PMID:19158363]"
FT                   /experiment="EXISTENCE:direct assay:GO:0045944 positive
FT                   regulation of transcription by RNA polymerase II
FT                   [PMID:11952910|PMID:7935367]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045944 positive
FT                   regulation of transcription by RNA polymerase II
FT                   [PMID:3123231]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:2001196 positive
FT                   regulation of lysine biosynthetic process via
FT                   alpha-aminoadipate and saccharopine [PMID:3123231]"
FT                   /protein_id="DAA11878.1"
FT                   /translation="MFESVNLDENSPEDRELAKVLSPPGSYLSPASLDSGSSFTNSGTS
FT                   TSCFEPKNNLPSLSFLNARAGSLGGIFNHKQMTSPSNSNIGGENVESTTSSNDGSNENA
FT                   GHPTTSEQDQNADHPTISQADDNGHSSLTPNPAVTSTVTDKKGNTVKRKYSRNGCSECK
FT                   RRRMKCDETKPTCWQCARLNRQCVYVLNPKNKKRRTSNAQRVKEFRKHSTSLDNDHNNA
FT                   RKRQHSSCKAEKKKKVRQNLSEDTTDPKPITDNGKNVPLDEIESLEIPNLDLTTTMNGY
FT                   DVNLLMQNLNDMVNMKLHDSYLLNEELKGLDLPDLDIPELLPASNVNSSVPISFLVNNV
FT                   ITFNTKLSSFKLGGIHDKYLKIFYYDCLDSIAPFFQNQGNPLRDILLSFAKNEAYLLSS
FT                   ILATGASIAYRKSNNLEDERNYCAYLSHCLSLLGEQFKNESNVLNRIEPIILTVIMLAW
FT                   DCIYSMNSQWRSHLKGVTDLFKKINAGNSSKVLNVAKCWFKVMETFASISTVFGGSLID
FT                   NNDLDAIFDPYDYQYVDSLKFLNIMTPLNEFNLLRGHKEDFDLVIKEVFKSLNTIRSTE
FT                   KNYFSKEEGLFTKKLDYLLLSSQTSSEKSKDQISYFNTQKILVEIDKQLDYEFIDKSGI
FT                   IPSDNQSHPRISNIHDNAIDMVTLKNGEEVAISWYDISHQTQVLSFLLIVLLKLLGMPK
FT                   ESSTIQQVVKKIMSFFKFLDSDSPPQNSRTCYSNFAVLIAGLNAMDEETRAIVKRYYKI
FT                   NGGKFQKLTEHNLNRLEKVWYGKNQNYRLEEQDVLTW"
FT   repeat_region   complement(512986..513258)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="Ty1 LTR"
FT   repeat_region   complement(513259..513590)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="Ty1 LTR"
FT   mobile_element  complement(513692..519647)
FT                   /mobile_element_type="retrotransposon:YDRCTy2-1"
FT                   /note="YDRCTy2-1; Ty2 element, LTR retrotransposon of the
FT                   Copia (Pseudoviridae) group; contains co-transcribed genes
FT                   TYA Gag and TYB Pol, encoding proteins involved in
FT                   structure and function of virus-like particles, flanked by
FT                   two direct repeats"
FT   repeat_region   complement(513692..514020)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="Ty2 LTR"
FT   gene            complement(514043..519356)
FT                   /locus_tag="YDR034C-D"
FT   mRNA            complement(514043..519356)
FT                   /locus_tag="YDR034C-D"
FT                   /product="gag-pol fusion protein"
FT   CDS_pept        complement(join(514043..518062,518064..519356))
FT                   /codon_start=1
FT                   /ribosomal_slippage
FT                   /locus_tag="YDR034C-D"
FT                   /product="gag-pol fusion protein"
FT                   /EC_number="2.7.7.49"
FT                   /EC_number="3.1.26.4"
FT                   /EC_number="2.7.7.7"
FT                   /note="Retrotransposon TYA Gag and TYB Pol genes;
FT                   transcribed/translated as one unit; polyprotein is
FT                   processed to make a nucleocapsid-like protein (Gag),
FT                   reverse transcriptase (RT), protease (PR), and integrase
FT                   (IN); similar to retroviral genes"
FT                   /db_xref="GOA:Q12472"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="InterPro:IPR015820"
FT                   /db_xref="InterPro:IPR025724"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR039537"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12472"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:9448009]"
FT                   /protein_id="DAA11879.1"
FT                   /translation="MESQQLSQNSPNLHGSAYASVTSKEVPSNQDPLAVSASNLPEFDR
FT                   DSTKVNSQQETTPGTSAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKAMASNWAHY
FT                   QQPSMMTCSHYQTSPAYYQPDPHYPLPQYIPPLSTSSPDPIDLKNQHSEIPQAKTKVGN
FT                   NVLPPHTLTSEENFSTWVKFYIRFLKNSNLGDIIPNDQGEIKRQMTYEEHAYIYNTFQA
FT                   FAPFHLLPTWVKQILEINYADILTVLCKSVSKMQTNNQELKDWIALANLEYDGSTSADT
FT                   FEITVSTIIQRLKENNINVSDRLACQLILKGLSGDFKYLRNQYRTKTNMKLSQLFAEIQ
FT                   LIYDENKIMNLNKPSQYKQHSEYKNVSRTSPNTTNTKVTTRNYQRTNSSKPRAAKAHNI
FT                   ATSSKFSRVNNDHINESTVSSQYLSDDNELSLGQQQKESKPTHTIDSNDELPDHLLIDS
FT                   GASQTLVRSAHYLHHATPNSEINIVDAQKQDIPINAIGNLHFNFQNGTKTSIKALHTPN
FT                   IAYDLLSLSELANQNITACFTRNTLERSDGTVLAPIVKHGDFYWLSKKYLIPSHISKLT
FT                   INNVNKSKSVNKYPYPLIHRMLGHANFRSIQKSLKKNAVTYLKESDIEWSNASTYQCPD
FT                   CLIGKSTKHRHVKGSRLKYQESYEPFQYLHTDIFGPVHHLPKSAPSYFISFTDEKTRFQ
FT                   WVYPLHDRREESILNVFTSILAFIKNQFNARVLVIQMDRGSEYTNKTLHKFFTNRGITA
FT                   CYTTTADSRAHGVAERLNRTLLNDCRTLLHCSGLPNHLWFSAVEFSTIIRNSLVSPKND
FT                   KSARQHAGLAGLDITTILPFGQPVIVNNHNPDSKIHPRGIPGYALHPSRNSYGYIIYLP
FT                   SLKKTVDTTNYVILQDKQSKLDQFNYDTLTFDDDLNRLTAHNQSFIEKNETEQSYDQNT
FT                   ESDHDYQSEIEINSDPLVNDFSSQSINPLQLDKEPVQKVRAPKEVDADISEYNILPSTI
FT                   RSRTPHIINKESTEMGGTIESDTTSPRHSSTFTARNQKRPGSPNDMIDLTSQDRVNYGL
FT                   ENIKTTRLGGTEEPYIQRNSDTNIKYRTTNSTPSIDDRSSNSESTTPIISIETKAACDN
FT                   TPSIDTDPPEYRSSDHATPNIMPDKSSKNVTADSILDDLPLPDLTNKSPTDTSDVSKDI
FT                   PHIHSRQTNSSLGGMDDSNVLTTTKSKKRSLEDNETEIEVSRDTWNNKNMRSLEPPRSK
FT                   KRINLIAAIKGVKSIKPVRTTLRYDEAITYNEDNKEKDRYIEAYHKEINQLLRMNTWDT
FT                   NKYYDRNDIDPKKVINSMFIFNKKRDGTHKARFVARGDIQHPDTYDSDMQSNTVHHYAL
FT                   MTSLSIALDNDYYITQLDISSAYLYADIKEELYIRPPPHLGLNDKLLRLRKSLYGLKQS
FT                   GANWYETIKSYLINCCDMQEVRGWSCVFKNSQVTICLFVDDMILFSKDLNANKKIITTL
FT                   KKQYDTKIINLGEGDNEIQYDILGLEIKYQRSKYMKLGMEKSLTEKLPKLNVPLNPKGK
FT                   KLRAPGQPGHYIDQDELEIDEDEYKEKVHEMQKLIGLASYVGYKFRFDLLYYINTLAQH
FT                   ILFPSRQVLDMTYELIQFMWDTRDKQLIWHKNKPTKPDNKLVAISDASYGNQPYYKSQI
FT                   GNIFLLNGKVIGGKSTKASLTCTSTTEAEIHAVSEAIPLLNNLSHLVQELNKKPIIKGL
FT                   LTDSRSTISIIKSTNEEKFRNRFFGTKAMRLRDEVSGNNLYVYYIETKKNIADVMTKPL
FT                   PIKTFKLLTNKWIH"
FT   gene            complement(518040..519356)
FT                   /locus_tag="YDR034C-C"
FT   mRNA            complement(518040..519356)
FT                   /locus_tag="YDR034C-C"
FT                   /product="gag protein"
FT   CDS_pept        complement(518040..519356)
FT                   /codon_start=1
FT                   /locus_tag="YDR034C-C"
FT                   /product="gag protein"
FT                   /note="Retrotransposon TYA Gag gene co-transcribed with TYB
FT                   Pol; translated as TYA or TYA-TYB polyprotein; Gag is a
FT                   nucleocapsid protein that is the structural constituent of
FT                   virus-like particles (VLPs); similar to retroviral Gag"
FT                   /db_xref="GOA:Q12392"
FT                   /db_xref="InterPro:IPR015820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12392"
FT                   /protein_id="DAA11880.1"
FT                   /translation="MESQQLSQNSPNLHGSAYASVTSKEVPSNQDPLAVSASNLPEFDR
FT                   DSTKVNSQQETTPGTSAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKAMASNWAHY
FT                   QQPSMMTCSHYQTSPAYYQPDPHYPLPQYIPPLSTSSPDPIDLKNQHSEIPQAKTKVGN
FT                   NVLPPHTLTSEENFSTWVKFYIRFLKNSNLGDIIPNDQGEIKRQMTYEEHAYIYNTFQA
FT                   FAPFHLLPTWVKQILEINYADILTVLCKSVSKMQTNNQELKDWIALANLEYDGSTSADT
FT                   FEITVSTIIQRLKENNINVSDRLACQLILKGLSGDFKYLRNQYRTKTNMKLSQLFAEIQ
FT                   LIYDENKIMNLNKPSQYKQHSEYKNVSRTSPNTTNTKVTTRNYQRTNSSKPRAAKAHNI
FT                   ATSSKFSRVNNDHINESTVSSQYLSDDNELSLRPATERI"
FT   repeat_region   complement(519316..519647)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="Ty2 LTR"
FT   gene            519743..519826
FT                   /locus_tag="tL(UAA)D"
FT   tRNA            519743..519826
FT                   /locus_tag="tL(UAA)D"
FT                   /product="tRNA-Leu"
FT                   /note="tL(UAA)D; Leucine tRNA (tRNA-Leu), predicted by
FT                   tRNAscan-SE analysis"
FT                   /experiment="EXISTENCE:curator inference:GO:0005829 cytosol
FT                   [PMID:9023104]"
FT                   /experiment="EXISTENCE:curator inference:GO:0006414
FT                   translational elongation [PMID:9023104]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030371 translation
FT                   repressor activity [PMID:27609601]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043022 ribosome
FT                   binding [PMID:27609601]"
FT                   /experiment="EXISTENCE:direct assay:GO:0043555 regulation
FT                   of translation in response to stress [PMID:27609601]"
FT   repeat_region   complement(520173..520475)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="Ty1 LTR"
FT   repeat_region   520477..520805
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="Ty1 LTR"
FT   gene            complement(520516..520692)
FT                   /locus_tag="YDR034C-A"
FT   mRNA            complement(520516..520692)
FT                   /locus_tag="YDR034C-A"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(520516..520692)
FT                   /codon_start=1
FT                   /locus_tag="YDR034C-A"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; contained within the solo Ty1
FT                   LTR element YDRWdelta7"
FT                   /db_xref="EnsemblGenomes-Gn:YDR034C-A"
FT                   /db_xref="EnsemblGenomes-Tr:YDR034C-A"
FT                   /db_xref="GOA:P0C289"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C289"
FT                   /protein_id="DAA11881.1"
FT                   /translation="MESIFLHANITIIPHSVLYVSLSYYIINPCVSVSTNLDDYFSSFV
FT                   SSSNTVYDNILVT"
FT   repeat_region   complement(520806..520833)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="Ty1 LTR"
FT   gene            520972..521043
FT                   /locus_tag="tQ(UUG)D1"
FT   tRNA            520972..521043
FT                   /locus_tag="tQ(UUG)D1"
FT                   /product="tRNA-Gln"
FT                   /note="tQ(UUG)D1; Glutamine tRNA (tRNA-Gln), predicted by
FT                   tRNAscan-SE analysis; thiolation of uridine at wobble
FT                   position (34) requires Ncs6p"
FT                   /experiment="EXISTENCE:curator inference:GO:0006414
FT                   translational elongation [PMID:9023104]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:15706032]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:15706032]"
FT   gene            521314..521469
FT                   /locus_tag="YDR034W-B"
FT   mRNA            521314..521469
FT                   /locus_tag="YDR034W-B"
FT                   /product="hypothetical protein"
FT   CDS_pept        521314..521469
FT                   /codon_start=1
FT                   /locus_tag="YDR034W-B"
FT                   /product="hypothetical protein"
FT                   /note="Predicted tail-anchored plasma membrane protein;
FT                   contains conserved CYSTM module; related proteins in other
FT                   organisms may be involved in response to stress; N- and
FT                   C-terminal fusion proteins localize to the cell periphery;
FT                   YDR034W-B has a paralog, YBR056W-A, that arose from the
FT                   whole genome duplication"
FT                   /db_xref="GOA:Q6Q5X2"
FT                   /db_xref="InterPro:IPR028144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6Q5X2"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /protein_id="DAA11882.1"
FT                   /translation="MRHHQNMHYAPQQQPVYVQQPPPRRESGGCCRTCCHFLCCLCLIN
FT                   LCCDVF"
FT   gene            521816..522928
FT                   /gene="ARO3"
FT                   /locus_tag="YDR035W"
FT   mRNA            521816..522928
FT                   /gene="ARO3"
FT                   /locus_tag="YDR035W"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase ARO3"
FT   CDS_pept        521816..522928
FT                   /codon_start=1
FT                   /gene="ARO3"
FT                   /locus_tag="YDR035W"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase ARO3"
FT                   /EC_number="2.5.1.54"
FT                   /note="3-deoxy-D-arabino-heptulosonate-7-phosphate (DAHP)
FT                   synthase; catalyzes the first step in aromatic amino acid
FT                   biosynthesis and is feedback-inhibited by phenylalanine or
FT                   high concentration of tyrosine or tryptophan"
FT                   /db_xref="GOA:P14843"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14843"
FT                   /experiment="EXISTENCE:direct assay:GO:0003849
FT                   3-deoxy-7-phosphoheptulonate synthase activity
FT                   [PMID:2880280]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /protein_id="DAA11883.1"
FT                   /translation="MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENI
FT                   IKARDSVCDILNGKDDRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYL
FT                   EKPRTTVGWKGLINDPDMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSD
FT                   CFSLGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTK
FT                   PGVTAIVGTEGNKDTFLILRGGKNGTNFDKESVQNTKKQLEKAGLTDDSQKRIMIDCSH
FT                   GNSNKDFKNQPKVAKCIYDQLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSV
FT                   TDACIGWESTEQVLELLAEGVRNRRKALKK"
FT   gene            complement(523211..524713)
FT                   /gene="EHD3"
FT                   /gene_synonym="mS47"
FT                   /locus_tag="YDR036C"
FT   mRNA            complement(523211..524713)
FT                   /gene="EHD3"
FT                   /gene_synonym="mS47"
FT                   /locus_tag="YDR036C"
FT                   /product="3-hydroxyisobutyryl-CoA hydrolase"
FT   CDS_pept        complement(523211..524713)
FT                   /codon_start=1
FT                   /gene="EHD3"
FT                   /gene_synonym="mS47"
FT                   /locus_tag="YDR036C"
FT                   /product="3-hydroxyisobutyryl-CoA hydrolase"
FT                   /EC_number="3.1.2.4"
FT                   /note="3-hydroxyisobutyryl-CoA hydrolase; member of a
FT                   family of enoyl-CoA hydratase/isomerases; non-tagged
FT                   protein is detected in highly purified mitochondria in
FT                   high-throughput studies; phosphorylated; mutation affects
FT                   fluid-phase endocytosis"
FT                   /db_xref="GOA:P28817"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="PDB:5MRC"
FT                   /db_xref="PDB:5MRE"
FT                   /db_xref="PDB:5MRF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28817"
FT                   /experiment="EXISTENCE:curator inference:GO:0032543
FT                   mitochondrial translation [PMID:28154081]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003735 structural
FT                   constituent of ribosome [PMID:28154081]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003860
FT                   3-hydroxyisobutyryl-CoA hydrolase activity [PMID:12697341]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion
FT                   [PMID:17054397|PMID:14562095|PMID:14576278|PMID:16823961|P
FT                   MID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005763
FT                   mitochondrial small ribosomal subunit [PMID:28154081]"
FT                   /protein_id="DAA11884.1"
FT                   /translation="MLRNTLKCAQLSSKYGFKTTTRTFMTTQPQLNVTDAPPVLFTVQD
FT                   TARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCAGGDVAT
FT                   VAIFNFNKEFAKSIKFFTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHTPFRIAT
FT                   ENTKWAMPEMDIGFFPDVGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYMLGLA
FT                   SHYVSSENLDALQKRLGEISPPFNNDPQSAYFFGMVNESIDEFVSPLPKDYVFKYSNEK
FT                   LNVIEACFNLSKNGTIEDIMNNLRQYEGSAEGKAFAQEIKTKLLTKSPSSLQIALRLVQ
FT                   ENSRDHIESAIKRDLYTAANMCMNQDSLVEFSEATKHKLIDKQRVPYPWTKKEQLFVSQ
FT                   LTSITSPKPSLPMSLLRNTSNVTWTQYPYHSKYQLPTEQEIAAYIEKRTNDDTGAKVTE
FT                   REVLNHFANVIPSRRGKLGIQSLCKIVCERKCEEVNDGLRWK"
FT   gene            525440..527215
FT                   /gene="KRS1"
FT                   /gene_synonym="GCD5"
FT                   /locus_tag="YDR037W"
FT   mRNA            525440..527215
FT                   /gene="KRS1"
FT                   /gene_synonym="GCD5"
FT                   /locus_tag="YDR037W"
FT                   /product="lysine--tRNA ligase KRS1"
FT   CDS_pept        525440..527215
FT                   /codon_start=1
FT                   /gene="KRS1"
FT                   /gene_synonym="GCD5"
FT                   /locus_tag="YDR037W"
FT                   /product="lysine--tRNA ligase KRS1"
FT                   /EC_number="6.1.1.6"
FT                   /note="Lysyl-tRNA synthetase"
FT                   /db_xref="GOA:P15180"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15180"
FT                   /experiment="EXISTENCE:direct assay:GO:0003729 mRNA binding
FT                   [PMID:23222640]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004824 lysine-tRNA
FT                   ligase activity [PMID:3888626]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:330225]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006430 lysyl-tRNA
FT                   aminoacylation [PMID:3888626]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004824
FT                   lysine-tRNA ligase activity [PMID:7628447]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006430
FT                   lysyl-tRNA aminoacylation [PMID:7628447]"
FT                   /protein_id="DAA11885.1"
FT                   /translation="MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEAKK
FT                   AAKKAAAQPKPASKKKTDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNP
FT                   EFLAKYAHLKKGETLPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCD
FT                   PDSYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFG
FT                   FKDQETRYRKRYLDLIMNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGA
FT                   TAKPFITHHNDLDMDMYMRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTT
FT                   CEFYQAYADVYDLMDMTELMFSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRIN
FT                   MIEELEKVFNVKFPSGDQLHTAETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDT
FT                   CINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEE
FT                   QARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTL
FT                   KPDVLREEVKKEEEN"
FT   gene            complement(527422..530697)
FT                   /gene="ENA5"
FT                   /locus_tag="YDR038C"
FT   mRNA            complement(527422..530697)
FT                   /gene="ENA5"
FT                   /locus_tag="YDR038C"
FT                   /product="putative Na(+)-exporting P-type ATPase ENA5"
FT   CDS_pept        complement(527422..530697)
FT                   /codon_start=1
FT                   /gene="ENA5"
FT                   /locus_tag="YDR038C"
FT                   /product="putative Na(+)-exporting P-type ATPase ENA5"
FT                   /EC_number="7.2.2.3"
FT                   /note="Protein with similarity to P-type ATPase sodium
FT                   pumps; member of the Na+ efflux ATPase family"
FT                   /db_xref="GOA:Q12691"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006414"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12691"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:16622836]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /protein_id="DAA11886.1"
FT                   /translation="MSEGTVKENNNEEFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRR
FT                   LKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVN
FT                   VLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPAD
FT                   LRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKG
FT                   IVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHR
FT                   KLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVG
FT                   AAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDD
FT                   PFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETA
FT                   TLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSL
FT                   SQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYG
FT                   KDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATA
FT                   ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNL
FT                   YHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCA
FT                   MTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNI
FT                   QKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEK
FT                   AAPDLMDRPPNDSEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCDG
FT                   TYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGN
FT                   QFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIAFTIAFWIGAELYKCGKR
FT                   RYFKTQRAHNSENDLERSSKHDPFEAYSTSTTLQSEINISVKH"
FT   gene            complement(531307..534582)
FT                   /gene="ENA2"
FT                   /locus_tag="YDR039C"
FT   mRNA            complement(531307..534582)
FT                   /gene="ENA2"
FT                   /locus_tag="YDR039C"
FT                   /product="Na(+)-exporting P-type ATPase ENA2"
FT   CDS_pept        complement(531307..534582)
FT                   /codon_start=1
FT                   /gene="ENA2"
FT                   /locus_tag="YDR039C"
FT                   /product="Na(+)-exporting P-type ATPase ENA2"
FT                   /EC_number="7.2.2.3"
FT                   /note="P-type ATPase sodium pump; involved in Na+ efflux to
FT                   allow salt tolerance; likely not involved in Li+ efflux"
FT                   /db_xref="GOA:Q01896"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006414"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01896"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:7664728]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006814
FT                   sodium ion transport [PMID:10073572|PMID:1657642]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0008554
FT                   sodium transmembrane transporter activity, phosphorylative
FT                   mechanism [PMID:1657642]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0015662 ion
FT                   transmembrane transporter activity, phosphorylative
FT                   mechanism [PMID:1657642]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006813
FT                   potassium ion transport [PMID:11932440]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0008556
FT                   potassium transmembrane transporter activity,
FT                   phosphorylative mechanism [PMID:11932440]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0055085
FT                   transmembrane transport [PMID:11932440]"
FT                   /protein_id="DAA11887.1"
FT                   /translation="MSEGTVKENNNEEFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRR
FT                   LKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVN
FT                   VLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPAD
FT                   LRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKG
FT                   IVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHR
FT                   KLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVG
FT                   AAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDD
FT                   PFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETA
FT                   TLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSL
FT                   SQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYG
FT                   KDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATA
FT                   ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNL
FT                   YHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCA
FT                   MTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNI
FT                   QKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEK
FT                   AAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCDG
FT                   TYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGN
FT                   QFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIAFTIAFWIGAELYKCGKR
FT                   RYFKTQRAHNPENDLESNNKRDPFEAYSTSTTIHTEVNIGIKQ"
FT   gene            complement(535192..538467)
FT                   /gene="ENA1"
FT                   /gene_synonym="HOR6"
FT                   /gene_synonym="PMR2"
FT                   /locus_tag="YDR040C"
FT   mRNA            complement(535192..538467)
FT                   /gene="ENA1"
FT                   /gene_synonym="HOR6"
FT                   /gene_synonym="PMR2"
FT                   /locus_tag="YDR040C"
FT                   /product="Na(+)/Li(+)-exporting P-type ATPase ENA1"
FT   CDS_pept        complement(535192..538467)
FT                   /codon_start=1
FT                   /gene="ENA1"
FT                   /gene_synonym="HOR6"
FT                   /gene_synonym="PMR2"
FT                   /locus_tag="YDR040C"
FT                   /product="Na(+)/Li(+)-exporting P-type ATPase ENA1"
FT                   /EC_number="7.2.2.3"
FT                   /note="P-type ATPase sodium pump; involved in Na+ and Li+
FT                   efflux to allow salt tolerance"
FT                   /db_xref="GOA:P13587"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006414"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13587"
FT                   /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
FT                   vacuole [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:7664728|PMID:9315618|PMID:16622836]"
FT                   /experiment="EXISTENCE:direct assay:GO:0008554 sodium
FT                   transmembrane transporter activity, phosphorylative
FT                   mechanism [PMID:9315618]"
FT                   /experiment="EXISTENCE:direct assay:GO:0055085
FT                   transmembrane transport [PMID:9315618]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006814
FT                   sodium ion transport [PMID:1657642]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0006972
FT                   hyperosmotic response [PMID:8612770]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0008554
FT                   sodium transmembrane transporter activity, phosphorylative
FT                   mechanism [PMID:1657642]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0009268
FT                   response to pH [PMID:12453218]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0009651
FT                   response to salt stress [PMID:11457832]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006813
FT                   potassium ion transport [PMID:11932440]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0008556
FT                   potassium transmembrane transporter activity,
FT                   phosphorylative mechanism [PMID:11932440]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0042149 cellular
FT                   response to glucose starvation [PMID:9383192]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0055085
FT                   transmembrane transport [PMID:9315618]"
FT                   /protein_id="DAA11888.1"
FT                   /translation="MGEGTTKENNNAEFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHR
FT                   LKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLLISMIISFAMHDWITGGVISFVIAVN
FT                   VLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPAD
FT                   LRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKG
FT                   IVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHR
FT                   KLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVG
FT                   AAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDD
FT                   PFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETA
FT                   TLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSL
FT                   SQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYG
FT                   KDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATA
FT                   ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNL
FT                   YHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCT
FT                   MTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNI
FT                   QKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEK
FT                   AAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYGINSGRLGHDCDG
FT                   TYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSFFRMHPDTDSPVKEFFRSIWGN
FT                   QFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIAFTIAFWIGAELYKCGKR
FT                   RYFKTQRAHNPENDLESNNKRDPFEAYSTSTTIHTEVNIGIKQ"
FT   gene            539803..540414
FT                   /gene="RSM10"
FT                   /gene_synonym="uS10m"
FT                   /locus_tag="YDR041W"
FT   mRNA            539803..540414
FT                   /gene="RSM10"
FT                   /gene_synonym="uS10m"
FT                   /locus_tag="YDR041W"
FT                   /product="mitochondrial 37S ribosomal protein RSM10"
FT   CDS_pept        539803..540414
FT                   /codon_start=1
FT                   /gene="RSM10"
FT                   /gene_synonym="uS10m"
FT                   /locus_tag="YDR041W"
FT                   /product="mitochondrial 37S ribosomal protein RSM10"
FT                   /note="Mitochondrial ribosomal protein of the small
FT                   subunit; has similarity to E. coli S10 ribosomal protein;
FT                   essential for viability, unlike most other mitoribosomal
FT                   proteins"
FT                   /db_xref="GOA:Q03201"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="PDB:5MRC"
FT                   /db_xref="PDB:5MRE"
FT                   /db_xref="PDB:5MRF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03201"
FT                   /experiment="EXISTENCE:curator inference:GO:0032543
FT                   mitochondrial translation [PMID:11278769]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003735 structural
FT                   constituent of ribosome [PMID:11278769]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:16823961|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005763
FT                   mitochondrial small ribosomal subunit [PMID:11278769]"
FT                   /protein_id="DAA11889.1"
FT                   /translation="MLRNTIALRSFIRTQSTRPYPVNVEAVYYAPLKLPIKYGDLVADI
FT                   QLRSYDNENLDFYSDFILRTGYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFER
FT                   HTHKRLIRAWDTNPEVLQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSDANGLEKSL
FT                   SNIDELYSLRNDDKAQTSAVGQKVLELLDSPDFKKHLEKK"
FT   gene            complement(540601..541203)
FT                   /locus_tag="YDR042C"
FT   mRNA            complement(540601..541203)
FT                   /locus_tag="YDR042C"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(540601..541203)
FT                   /codon_start=1
FT                   /locus_tag="YDR042C"
FT                   /product="hypothetical protein"
FT                   /note="hypothetical protein; expression is increased in
FT                   ssu72-ts69 mutant"
FT                   /db_xref="GOA:Q03205"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03205"
FT                   /protein_id="DAA11890.1"
FT                   /translation="MEQILYNQSLKISTLSTFQGLKFLKVLIFSIFQQLFYNPVIQLFG
FT                   TKASIMESDSTTLLESSWSTERNFLNMNSDSISATKNVFILFFTIFRLAEYIVYKLSDQ
FT                   KYRLHTSLNVQHFRWNSKKNTNRKRTLSFSKAYLPRTNILPIFVADGLKNRFSGPLPGK
FT                   SLESFQKLNLLSDNNIKRYAVPGNKAVNTLLWQEQYS"
FT   gene            complement(541602..541700)
FT                   /locus_tag="snR47"
FT   ncRNA           complement(541602..541700)
FT                   /locus_tag="snR47"
FT                   /product="SNR47"
FT                   /note="C/D box small nucleolar RNA (snoRNA); guides
FT                   2'-O-methylation of large subunit (LSU) rRNA at position
FT                   A2220 and small subunit (SSU) rRNA at position A619"
FT                   /experiment="EXISTENCE:curator inference:GO:0005730
FT                   nucleolus [PMID:10024243]"
FT                   /experiment="EXISTENCE:curator inference:GO:0031428 box C/D
FT                   snoRNP complex [PMID:10024243]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030562 rRNA
FT                   2'-O-ribose methylation guide activity [PMID:10024243]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0031167 rRNA
FT                   methylation [PMID:10024243]"
FT                   /ncRNA_class="snoRNA"
FT   gene            complement(542674..543369)
FT                   /gene="NRG1"
FT                   /locus_tag="YDR043C"
FT   mRNA            complement(542674..543369)
FT                   /gene="NRG1"
FT                   /locus_tag="YDR043C"
FT                   /product="transcriptional regulator NRG1"
FT   CDS_pept        complement(542674..543369)
FT                   /codon_start=1
FT                   /gene="NRG1"
FT                   /locus_tag="YDR043C"
FT                   /product="transcriptional regulator NRG1"
FT                   /note="Transcriptional repressor; recruits the Cyc8p-Tup1p
FT                   complex to promoters; mediates glucose repression and
FT                   negatively regulates a variety of processes including
FT                   filamentous growth and alkaline pH response; activated in
FT                   stochastic pulses of nuclear localization in response to
FT                   low glucose"
FT                   /db_xref="GOA:Q03125"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03125"
FT                   /experiment="EXISTENCE:direct assay:GO:0000978 RNA
FT                   polymerase II proximal promoter sequence-specific DNA
FT                   binding [PMID:10022891|PMID:17023428]"
FT                   /experiment="EXISTENCE:direct assay:GO:0001227 DNA-binding
FT                   transcription repressor activity, RNA polymerase
FT                   II-specific [PMID:10022891]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:11404322]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000122
FT                   negative regulation of transcription by RNA polymerase II
FT                   [PMID:12024013|PMID:15466424]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000433
FT                   carbon catabolite repression of transcription from RNA
FT                   polymerase II promoter by glucose [PMID:16278455]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0043709 cell
FT                   adhesion involved in single-species biofilm formation
FT                   [PMID:12024013]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:1900464
FT                   negative regulation of cellular hyperosmotic salinity
FT                   response by negative regulation of transcription from RNA
FT                   polymerase II promoter [PMID:16278455]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:2000221
FT                   negative regulation of pseudohyphal growth [PMID:12024013]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000122 negative
FT                   regulation of transcription by RNA polymerase II
FT                   [PMID:18287536]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000433 carbon
FT                   catabolite repression of transcription from RNA polymerase
FT                   II promoter by glucose
FT                   [PMID:10022891|PMID:11281938|PMID:11404322]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001227
FT                   DNA-binding transcription repressor activity, RNA
FT                   polymerase II-specific [PMID:10022891]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0071475 cellular
FT                   hyperosmotic salinity response [PMID:12509465]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0090606
FT                   single-species surface biofilm formation [PMID:16556982]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1900463 negative
FT                   regulation of cellular response to alkaline pH by negative
FT                   regulation of transcription from RNA polymerase II promoter
FT                   [PMID:12509465|PMID:17023428]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0001103 RNA
FT                   polymerase II repressing transcription factor binding
FT                   [PMID:10022891]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0071475
FT                   cellular hyperosmotic salinity response [PMID:12509465]"
FT                   /experiment="EXISTENCE:physical interaction:GO:1900463
FT                   negative regulation of cellular response to alkaline pH by
FT                   negative regulation of transcription from RNA polymerase II
FT                   promoter [PMID:12509465]"
FT                   /protein_id="DAA11891.1"
FT                   /translation="MFYPYNYSNLNVSTMPALPGISAFDGMQDEENVEISPERKYQTLL
FT                   PVLTNSHVVENELKHKLNKTAFDFRYQTKSENGSEKWEPKYLITPNLQTRSVSFDNSSV
FT                   QYNSDSSEKSSLSQLTCNSSIIQQPENGIVSNDAYNKMANSRYSLKTRKQRTDPRNTLS
FT                   DEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQH
FT                   YRTHLKKGQ"
FT   gene            546642..547628
FT                   /gene="HEM13"
FT                   /locus_tag="YDR044W"
FT   mRNA            546642..547628
FT                   /gene="HEM13"
FT                   /locus_tag="YDR044W"
FT                   /product="coproporphyrinogen oxidase"
FT   CDS_pept        546642..547628
FT                   /codon_start=1
FT                   /gene="HEM13"
FT                   /locus_tag="YDR044W"
FT                   /product="coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="Coproporphyrinogen III oxidase; oxygen-requiring
FT                   enzyme that catalyzes sixth step in heme biosynthetic
FT                   pathway; transcription is repressed by oxygen and heme (via
FT                   Rox1p and Hap1p); human homolog CPOX can complement yeast
FT                   mutant and allow growth of haploid null after sporulation
FT                   of a heterozygous diploid"
FT                   /db_xref="GOA:P11353"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="PDB:1TK1"
FT                   /db_xref="PDB:1TKL"
FT                   /db_xref="PDB:1TLB"
FT                   /db_xref="PDB:1TXN"
FT                   /db_xref="UniProtKB/Swiss-Prot:P11353"
FT                   /experiment="EXISTENCE:direct assay:GO:0004109
FT                   coproporphyrinogen oxidase activity [PMID:3516695]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:3516695]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004109
FT                   coproporphyrinogen oxidase activity [PMID:2838478]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006783 heme
FT                   biosynthetic process [PMID:7035824]"
FT                   /protein_id="DAA11892.1"
FT                   /translation="MPAPQDPRNLPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWT
FT                   RGNDGGGGTSMVIQDGTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLP
FT                   VTDGVKFFACGLSMVIHPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPSYLY
FT                   EEDGQLFHQLHKDALDKHDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQ
FT                   EILKMVEDCFDAFLPSYLTIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGL
FT                   RTPGSRVESILMSLPEHASWLYNHHPAPGSREAKLLEVTTKPREWVK"
FT   gene            complement(547978..548310)
FT                   /gene="RPC11"
FT                   /locus_tag="YDR045C"
FT   mRNA            complement(547978..548310)
FT                   /gene="RPC11"
FT                   /locus_tag="YDR045C"
FT                   /product="DNA-directed RNA polymerase III core subunit
FT                   RPC11"
FT   CDS_pept        complement(547978..548310)
FT                   /codon_start=1
FT                   /gene="RPC11"
FT                   /locus_tag="YDR045C"
FT                   /product="DNA-directed RNA polymerase III core subunit
FT                   RPC11"
FT                   /note="RNA polymerase III subunit C11; mediates pol III RNA
FT                   cleavage activity and is important for termination of
FT                   transcription; homologous to TFIIS"
FT                   /db_xref="GOA:Q04307"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="InterPro:IPR034014"
FT                   /db_xref="PDB:3QT1"
FT                   /db_xref="PDB:5FJ8"
FT                   /db_xref="PDB:5FJ9"
FT                   /db_xref="PDB:5FJA"
FT                   /db_xref="PDB:6CNB"
FT                   /db_xref="PDB:6CNC"
FT                   /db_xref="PDB:6CND"
FT                   /db_xref="PDB:6CNF"
FT                   /db_xref="PDB:6EU0"
FT                   /db_xref="PDB:6EU1"
FT                   /db_xref="PDB:6EU2"
FT                   /db_xref="PDB:6EU3"
FT                   /db_xref="PDB:6F40"
FT                   /db_xref="PDB:6F41"
FT                   /db_xref="PDB:6F42"
FT                   /db_xref="PDB:6F44"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04307"
FT                   /experiment="EXISTENCE:direct assay:GO:0001056 RNA
FT                   polymerase III activity [PMID:3905793|PMID:9869639]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005666 RNA
FT                   polymerase III complex
FT                   [PMID:10611227|PMID:3905793|PMID:9869639]"
FT                   /experiment="EXISTENCE:direct assay:GO:0042797 tRNA
FT                   transcription by RNA polymerase III [PMID:3905793]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001056 RNA
FT                   polymerase III activity [PMID:9869639]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006386
FT                   termination of RNA polymerase III transcription
FT                   [PMID:9869639]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0042797 tRNA
FT                   transcription by RNA polymerase III [PMID:9869639]"
FT                   /protein_id="DAA11893.1"
FT                   /translation="MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKK
FT                   LPRKEVDDVLGGGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCG
FT                   HRWKEN"
FT   gene            complement(548762..550576)
FT                   /gene="BAP3"
FT                   /gene_synonym="PAP1"
FT                   /locus_tag="YDR046C"
FT   mRNA            complement(548762..550576)
FT                   /gene="BAP3"
FT                   /gene_synonym="PAP1"
FT                   /locus_tag="YDR046C"
FT                   /product="amino acid transporter BAP3"
FT   CDS_pept        complement(548762..550576)
FT                   /codon_start=1
FT                   /gene="BAP3"
FT                   /gene_synonym="PAP1"
FT                   /locus_tag="YDR046C"
FT                   /product="amino acid transporter BAP3"
FT                   /note="Amino acid permease; involved in uptake of cysteine,
FT                   leucine, isoleucine and valine; BAP3 has a paralog, BAP2,
FT                   that arose from the whole genome duplication"
FT                   /db_xref="GOA:P41815"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P41815"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006865 amino acid
FT                   transport [PMID:10654085]"
FT                   /experiment="EXISTENCE:direct assay:GO:0015171 amino acid
FT                   transmembrane transporter activity [PMID:10654085]"
FT                   /experiment="EXISTENCE:direct assay:GO:0055085
FT                   transmembrane transport [PMID:10654085]"
FT                   /protein_id="DAA11894.1"
FT                   /translation="MSDPIVTSSKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSE
FT                   ESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGI
FT                   GTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIF
FT                   ISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFG
FT                   VKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATR
FT                   FKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGF
FT                   NVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPR
FT                   LMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGL
FT                   SELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVA
FT                   LSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDP
FT                   EIMRQEDEENKERLKNSSIFVRVYKFWC"
FT   gene            551860..552948
FT                   /gene="HEM12"
FT                   /gene_synonym="HEM6"
FT                   /locus_tag="YDR047W"
FT   mRNA            551860..552948
FT                   /gene="HEM12"
FT                   /gene_synonym="HEM6"
FT                   /locus_tag="YDR047W"
FT                   /product="uroporphyrinogen decarboxylase HEM12"
FT   CDS_pept        551860..552948
FT                   /codon_start=1
FT                   /gene="HEM12"
FT                   /gene_synonym="HEM6"
FT                   /locus_tag="YDR047W"
FT                   /product="uroporphyrinogen decarboxylase HEM12"
FT                   /EC_number="4.1.1.37"
FT                   /note="Uroporphyrinogen decarboxylase; catalyzes the fifth
FT                   step in the heme biosynthetic pathway; localizes to both
FT                   the cytoplasm and nucleus; a hem12 mutant has phenotypes
FT                   similar to patients with porphyria cutanea tarda"
FT                   /db_xref="GOA:P32347"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32347"
FT                   /experiment="EXISTENCE:direct assay:GO:0004853
FT                   uroporphyrinogen decarboxylase activity [PMID:2180703]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004853
FT                   uroporphyrinogen decarboxylase activity [PMID:7035824]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006783 heme
FT                   biosynthetic process
FT                   [PMID:14559249|PMID:1471989|PMID:7035824]"
FT                   /protein_id="DAA11895.1"
FT                   /translation="MGNFPAPKNDLILRAAKGEKVERPPCWIMRQAGRYLPEYHEVKNN
FT                   RDFFQTCRDAEIASEITIQPVRRYRGLIDAAIIFSDILVIPQAMGMRVEMLEGKGPHFP
FT                   EPLRNPEDLQTVLDYKVDVLKELDWAFKAITMTRIKLDGEVPLFGFCGGPWTLMVYMTE
FT                   GGGSRLFRFAKQWINMYPELSHKLLQKITDVAVEFLSQQVVAGAQILQVFESWGGELSS
FT                   VDFDEFSLPYLRQIAERVPKRLQELGIMEQIPMIVFAKGSWYALDKLCCSGFDVVSLDW
FT                   SWDPREAVKINKNRVTLQGNLDPGVMYGSKEVITKKVKQMIEAFGGGKSRYIVNFGHGT
FT                   HPFMDPDVIKFFLEECHRIGSK"
FT   gene            553254..555152
FT                   /gene="VMS1"
FT                   /locus_tag="YDR049W"
FT   mRNA            553254..555152
FT                   /gene="VMS1"
FT                   /locus_tag="YDR049W"
FT                   /product="Vms1p"
FT   CDS_pept        553254..555152
FT                   /codon_start=1
FT                   /gene="VMS1"
FT                   /locus_tag="YDR049W"
FT                   /product="Vms1p"
FT                   /note="Component of a Cdc48p-complex involved in protein
FT                   quality control; exhibits cytosolic and ER-membrane
FT                   localization, with Cdc48p, during normal growth, and
FT                   contributes to ER-associated degradation (ERAD) of specific
FT                   substrates at a step after their ubiquitination; forms a
FT                   mitochondrially-associated complex with Cdc48p and Npl4p
FT                   under oxidative stress that is required for
FT                   ubiquitin-mediated mitochondria-associated protein
FT                   degradation (MAD); conserved in C. elegans and humans"
FT                   /db_xref="GOA:Q04311"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR041175"
FT                   /db_xref="PDB:5WHG"
FT                   /db_xref="PDB:6R87"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04311"
FT                   /experiment="EXISTENCE:direct assay:GO:0004045
FT                   aminoacyl-tRNA hydrolase activity [PMID:29632312]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004843
FT                   thiol-dependent ubiquitin-specific protease activity
FT                   [PMID:24351022]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:21070972|PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005789 endoplasmic
FT                   reticulum membrane [PMID:21148305]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:21070972]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005840 ribosome
FT                   [PMID:29632312]"
FT                   /experiment="EXISTENCE:direct assay:GO:0036266
FT                   Cdc48p-Npl4p-Vms1p AAA ATPase complex [PMID:21070972]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030433
FT                   ubiquitin-dependent ERAD pathway [PMID:21148305]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0071630 nuclear
FT                   protein quality control by the ubiquitin-proteasome system
FT                   [PMID:22718752]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0072671
FT                   mitochondria-associated ubiquitin-dependent protein
FT                   catabolic process [PMID:21070972]"
FT                   /protein_id="DAA11896.1"
FT                   /translation="MNSQKASKMTGSLKKNDLYIFDLSEQLLNSLKLMSFDSTLREVEV
FT                   EKTSDNDRNKESGDLQIARKKVTSNVMRCSVCQMSFDSRNEQKAHYQTDYHLMNVKRNL
FT                   RGLDILSVEEFDALISKEHGIKSEDENSGGEQTSSDHEESEEASDRDPDLQTNNYMETI
FT                   IENDLQKLGFQKDESDAISHINTQSPYIYFKSKYLQKNEVLAIYKSLFNKRSLSNPNEA
FT                   LTFWNSQENPMAISALFMVGGGHFAGAIVSHQRLNVKGNAHKKDETLIEQAVNFLEHKT
FT                   FHRYTTRRKQGGSQSAMDNAKGKANSAGSALRRYNESALKTDIQGVLKDWEPYLSKCDN
FT                   IFIRARNVSDKKIFTDNTVLNKGDERIKSFPFTTNRPTVLELKKAWCELSYLKILPKPE
FT                   PLAVKETVQKLEVSNKKDEFKEKQEPLLEEIQTEEIISLLKKGRAPLLISFLKKNKLDG
FT                   NFRLKPESKYSLTPTMLHYASQQGMKQMALILLSNIKCDPTIKNRLGRTAWDLNRNDDV
FT                   RHAFQIARYNLGESFTNWDETHIGQPLSREQVDEINEKKKAIENEKAEKLIKLELEAAK
FT                   EKQRFAKDAERGPGKKLTNIPSIQQQNLNSLTDEQRRRLMREQRARAAEERMKKKY"
FT   rep_origin      555240..555404
FT                   /note="ARS418; Autonomously Replicating Sequence"
FT   gene            complement(555726..556472)
FT                   /gene="TPI1"
FT                   /locus_tag="YDR050C"
FT   mRNA            complement(555726..556472)
FT                   /gene="TPI1"
FT                   /locus_tag="YDR050C"
FT                   /product="triose-phosphate isomerase TPI1"
FT   CDS_pept        complement(555726..556472)
FT                   /codon_start=1
FT                   /gene="TPI1"
FT                   /locus_tag="YDR050C"
FT                   /product="triose-phosphate isomerase TPI1"
FT                   /EC_number="5.3.1.1"
FT                   /note="Triose phosphate isomerase, abundant glycolytic
FT                   enzyme; mRNA half-life is regulated by iron availability;
FT                   transcription is controlled by activators Reb1p, Gcr1p, and
FT                   Rap1p through binding sites in the 5' non-coding region;
FT                   inhibition of Tpi1p activity by PEP (phosphoenolpyruvate)
FT                   stimulates redox metabolism in respiring cells; E104D
FT                   mutation in human homolog TPI1 causes a rare autosomal
FT                   disease; human TPI1 can complement yeast null mutant"
FT                   /db_xref="GOA:P00942"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="PDB:1I45"
FT                   /db_xref="PDB:1NEY"
FT                   /db_xref="PDB:1NF0"
FT                   /db_xref="PDB:1YPI"
FT                   /db_xref="PDB:2YPI"
FT                   /db_xref="PDB:3YPI"
FT                   /db_xref="PDB:4FF7"
FT                   /db_xref="PDB:7TIM"
FT                   /db_xref="UniProtKB/Swiss-Prot:P00942"
FT                   /experiment="EXISTENCE:direct assay:GO:0004807
FT                   triose-phosphate isomerase activity [PMID:236471]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:27385335|PMID:11914276]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:16962558|PMID:24769239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:16622836]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006096
FT                   glycolytic process [PMID:11329176]"
FT                   /protein_id="DAA11897.1"
FT                   /translation="MARTFFVGGNFKLNGSKQSIKEIVERLNTASIPENVEVVICPPAT
FT                   YLDYSVSLVKKPQVTVGAQNAYLKASGAFTGENSVDQIKDVGAKWVILGHSERRSYFHE
FT                   DDKFIADKTKFALGQGVGVILCIGETLEEKKAGKTLDVVERQLNAVLEEVKDWTNVVVA
FT                   YEPVWAIGTGLAATPEDAQDIHASIRKFLASKLGDKAASELRILYGGSANGSNAVTFKD
FT                   KADVDGFLVGGASLKPEFVDIINSRN"
FT   gene            complement(557056..558060)
FT                   /gene="DET1"
FT                   /locus_tag="YDR051C"
FT   mRNA            complement(557056..558060)
FT                   /gene="DET1"
FT                   /locus_tag="YDR051C"
FT                   /product="acid phosphatase DET1"
FT   CDS_pept        complement(557056..558060)
FT                   /codon_start=1
FT                   /gene="DET1"
FT                   /locus_tag="YDR051C"
FT                   /product="acid phosphatase DET1"
FT                   /note="Acid phosphatase; involved in the non-vesicular
FT                   transport of sterols in both directions between the
FT                   endoplasmic reticulum and plasma membrane; deletion confers
FT                   sensitivity to nickel"
FT                   /db_xref="GOA:Q99288"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99288"
FT                   /experiment="EXISTENCE:direct assay:GO:0003993 acid
FT                   phosphatase activity [PMID:19753119]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016311
FT                   dephosphorylation [PMID:19753119]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0032366
FT                   intracellular sterol transport [PMID:19060182]"
FT                   /protein_id="DAA11898.1"
FT                   /translation="MCEENVHVSEDVAGSHGSFTNARPRLIVLIRHGESESNKNKEVNG
FT                   YIPNHLISLTKTGQIQARQAGIDLLRVLNVDDHNLVEDLAKKYIKDESSRRTLPLKDYT
FT                   RLSREKDTNIVFYTSPYRRARETLKGILDVIDEYNELNSGVRICEDMRYDPHGKQKHAF
FT                   WPRGLNNTGGVYENNEDNICEGKPGKCYLQYRVKDEPRIREQDFGNFQKINSMQDVMKK
FT                   RSTYGHFFFRFPHGESAADVYDRVASFQETLFRHFHDRQERRPRDVVVLVTHGIYSRVF
FT                   LMKWFRWTYEEFESFTNVPNGSVMVMELDESINRYVLRTVLPKWTDCEGDLTT"
FT   gene            complement(558511..560625)
FT                   /gene="DBF4"
FT                   /gene_synonym="DNA52"
FT                   /gene_synonym="LSD7"
FT                   /locus_tag="YDR052C"
FT   mRNA            complement(558511..560625)
FT                   /gene="DBF4"
FT                   /gene_synonym="DNA52"
FT                   /gene_synonym="LSD7"
FT                   /locus_tag="YDR052C"
FT                   /product="protein serine/threonine kinase activating
FT                   protein DBF4"
FT   CDS_pept        complement(558511..560625)
FT                   /codon_start=1
FT                   /gene="DBF4"
FT                   /gene_synonym="DNA52"
FT                   /gene_synonym="LSD7"
FT                   /locus_tag="YDR052C"
FT                   /product="protein serine/threonine kinase activating
FT                   protein DBF4"
FT                   /note="Regulatory subunit of Cdc7p-Dbf4p kinase complex;
FT                   required for Cdc7p kinase activity and initiation of DNA
FT                   replication; phosphorylates the Mcm2-7 family of proteins;
FT                   cell cycle regulated; relative distribution to the nucleus
FT                   increases upon DNA replication stress; co-expression of
FT                   human CDC7 and DBF4 complements single cdc7 or dbf4 null
FT                   mutations or the cdc7 dbf4 double null mutation"
FT                   /db_xref="GOA:P32325"
FT                   /db_xref="InterPro:IPR006572"
FT                   /db_xref="InterPro:IPR013939"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR038545"
FT                   /db_xref="PDB:3OQ0"
FT                   /db_xref="PDB:3OQ4"
FT                   /db_xref="PDB:3QBZ"
FT                   /db_xref="PDB:5T2F"
FT                   /db_xref="PDB:5T2S"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32325"
FT                   /experiment="EXISTENCE:direct assay:GO:0000775 chromosome,
FT                   centromeric region [PMID:23746350]"
FT                   /experiment="EXISTENCE:direct assay:GO:0000785 chromatin
FT                   [PMID:10508166]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003688 DNA
FT                   replication origin binding [PMID:8066465]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031431
FT                   Dbf4-dependent protein kinase complex [PMID:19692334]"
FT                   /experiment="EXISTENCE:direct assay:GO:0045860 positive
FT                   regulation of protein kinase activity [PMID:19692334]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0001100
FT                   negative regulation of exit from mitosis [PMID:19478884]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0031431
FT                   Dbf4-dependent protein kinase complex [PMID:8474449]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0033314
FT                   mitotic DNA replication checkpoint [PMID:18372119]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0043539
FT                   protein serine/threonine kinase activator activity
FT                   [PMID:8474449]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0071902
FT                   positive regulation of protein serine/threonine kinase
FT                   activity [PMID:8474449]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:1903468
FT                   positive regulation of DNA replication initiation
FT                   [PMID:9407029]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0001100 negative
FT                   regulation of exit from mitosis [PMID:19478884]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006279
FT                   premeiotic DNA replication [PMID:16319063]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043539 protein
FT                   serine/threonine kinase activator activity [PMID:8474449]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0060903 positive
FT                   regulation of meiosis I [PMID:16319063]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0071902 positive
FT                   regulation of protein serine/threonine kinase activity
FT                   [PMID:8474449]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0006270 DNA
FT                   replication initiation [PMID:8474449]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0031431
FT                   Dbf4-dependent protein kinase complex [PMID:8474449]"
FT                   /protein_id="DAA11899.1"
FT                   /translation="MVSPTKMIIRSPLKETDTNLKHNNGIAASTTAAGHLNVFSNDNNC
FT                   NNNNTTESFPKKRSLERLELQQQQHLHEKKRARIERARSIEGAVQVSKGTGLKNVEPRV
FT                   TPKELLEWQTNWKKIMKRDSRIYFDITDDVEMNTYNKSKMDKRRDLLKRGFLTLGAQIT
FT                   QFFDTTVTIVITRRSVENIYLLKDTDILSRAKKNYMKVWSYEKAARFLKNLDVDLDHLS
FT                   KTKSASLAAPTLSNLLHNEKLYGPTDRDPRTKRDDIHYFKYPHVYLYDLWQTWAPIITL
FT                   EWKPQELTNLDELPYPILKIGSFGRCPFIGDRNYDESSYKRVVKRYSRDKANKKYALQL
FT                   RALFQYHADTLLNTSSVNDQTKNLIFIPHTCNDSTKSFKKWMQEKAKNFEKTELKKTDD
FT                   SAVQDVRNEHADQTDEKNSILLNETETKEPPLKEEKENKQSIAEESNKYPQRKELAATP
FT                   KLNHPVLATFARQETEEVPDDLCTLKTKSRQAFEIKASGAHQSNDVATSFGNGLGPTRA
FT                   SVMSKNMKSLSRLMVDRKLGVKQTNGNNKNYTATIATTAETSKENRHRLDFNALKKDEA
FT                   PSKETGKDSAVHLETNRKPQNFPKVATKSVSADSKVHNDIKITTTESPTASKKSTSTNV
FT                   TLHFNAQTAQTAQPVKKETVKNSGYCENCRVKYESLEQHIVSEKHLSFAENDLNFEAID
FT                   SLIENLRFQI"
FT   gene            complement(561440..562327)
FT                   /gene="CDC34"
FT                   /gene_synonym="DNA6"
FT                   /gene_synonym="UBC3"
FT                   /locus_tag="YDR054C"
FT   mRNA            complement(561440..562327)
FT                   /gene="CDC34"
FT                   /gene_synonym="DNA6"
FT                   /gene_synonym="UBC3"
FT                   /locus_tag="YDR054C"
FT                   /product="SCF E2 ubiquitin-protein ligase catalytic subunit
FT                   CDC34"
FT   CDS_pept        complement(561440..562327)
FT                   /codon_start=1
FT                   /gene="CDC34"
FT                   /gene_synonym="DNA6"
FT                   /gene_synonym="UBC3"
FT                   /locus_tag="YDR054C"
FT                   /product="SCF E2 ubiquitin-protein ligase catalytic subunit
FT                   CDC34"
FT                   /EC_number="2.3.2.23"
FT                   /note="Ubiquitin-conjugating enzyme (E2); catalytic subunit
FT                   of SCF ubiquitin-protein ligase complex (together with
FT                   Skp1p, Rbx1p, Cdc53p, and an F-box protein) that regulates
FT                   cell cycle progression by targeting key substrates for
FT                   degradation; protein abundance increases in response to DNA
FT                   replication stress; human CDC34 functionally complements
FT                   the thermosensitivity of the cdc34-2 mutant"
FT                   /db_xref="GOA:P14682"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14682"
FT                   /experiment="EXISTENCE:direct assay:GO:0000209 protein
FT                   polyubiquitination [PMID:1848239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004842
FT                   ubiquitin-protein transferase activity
FT                   [PMID:9346239|PMID:2842867]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:11080155|PMID:8164658]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:11080155]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006511
FT                   ubiquitin-dependent protein catabolic process
FT                   [PMID:9346238|PMID:9346239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0019005 SCF
FT                   ubiquitin ligase complex [PMID:9346238]"
FT                   /experiment="EXISTENCE:direct assay:GO:0031146
FT                   SCF-dependent proteasomal ubiquitin-dependent protein
FT                   catabolic process [PMID:9346238|PMID:9346239]"
FT                   /experiment="EXISTENCE:direct assay:GO:0051865 protein
FT                   autoubiquitination [PMID:8383676]"
FT                   /experiment="EXISTENCE:direct assay:GO:0061630 ubiquitin
FT                   protein ligase activity [PMID:9346238]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000086 G2/M
FT                   transition of mitotic cell cycle
FT                   [PMID:7954792|PMID:9736614]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004842
FT                   ubiquitin-protein transferase activity [PMID:2842867]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0019005 SCF
FT                   ubiquitin ligase complex [PMID:9736614]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0051865 protein
FT                   autoubiquitination [PMID:8383676]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0019005 SCF
FT                   ubiquitin ligase complex [PMID:9346238]"
FT                   /protein_id="DAA11900.1"
FT                   /translation="MSSRKSTASSLLLRQYRELTDPKKAIPSFHIELEDDSNIFTWNIG
FT                   VMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSGD
FT                   PMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKME
FT                   VERSKQDIPKGFIMPTSESAYISQSKLDEPESNKDMADNFWYDSDLDDDENGSVILQDD
FT                   DYDDGNNHIPFEDDDVYNYNDNDDDDERIEFEDDDDDDDDSIDNDSVMDRKQPHKAEDE
FT                   SEDVEDVERVSKKI"
FT   gene            563527..564861
FT                   /gene="PST1"
FT                   /gene_synonym="HPF2"
FT                   /locus_tag="YDR055W"
FT   mRNA            563527..564861
FT                   /gene="PST1"
FT                   /gene_synonym="HPF2"
FT                   /locus_tag="YDR055W"
FT                   /product="Pst1p"
FT   CDS_pept        563527..564861
FT                   /codon_start=1
FT                   /gene="PST1"
FT                   /gene_synonym="HPF2"
FT                   /locus_tag="YDR055W"
FT                   /product="Pst1p"
FT                   /note="Cell wall protein that contains a putative
FT                   GPI-attachment site; secreted by regenerating protoplasts;
FT                   up-regulated by activation of the cell integrity pathway,
FT                   as mediated by Rlm1p; upregulated by cell wall damage via
FT                   disruption of FKS1; PST1 has a paralog, ECM33, that arose
FT                   from the whole genome duplication"
FT                   /db_xref="GOA:Q12355"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12355"
FT                   /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
FT                   vacuole [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005886 plasma
FT                   membrane [PMID:15583168]"
FT                   /experiment="EXISTENCE:direct assay:GO:0009277 fungal-type
FT                   cell wall [PMID:10383953|PMID:15583168]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071944 cell
FT                   periphery [PMID:26928762]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0031505
FT                   fungal-type cell wall organization [PMID:15583168]"
FT                   /protein_id="DAA11901.1"
FT                   /translation="MQLHSLIASTALLITSALAATSSSSSIPSSCTISSHATATAQSDL
FT                   DKYSRCDTLVGNLTIGGGLKTGALANVKEINGSLTIFNATNLTSFAADSLESITDSLNL
FT                   QSLTILTSASFGSLQSVDSIKLITLPAISSFTSNIKSANNIYISDTSLQSVDGFSALKK
FT                   VNVFNVNNNKKLTSIKSPVETVSDSLQFSFNGNQTKITFDDLVWANNISLTDVHSVSFA
FT                   NLQKINSSLGFINNSISSLNFTKLNTIGQTFSIVSNDYLKNLSFSNLSTIGGALVVANN
FT                   TGLQKIGGLDNLTTIGGTLEVVGNFTSLNLDSLKSVKGGADVESKSSNFSCNALKALQK
FT                   KGGIKGESFVCKNGASSTSVKLSSTSKSQSSQTTAKVSKSSSKAEEKKFTSGDIKAAAS
FT                   ASSVSSSGASSSSSKSSKGNAAIMAPIGQTTPLVGLLTAIIMSIM"
FT   gene            complement(565023..565640)
FT                   /gene="EMC10"
FT                   /locus_tag="YDR056C"
FT   mRNA            complement(565023..565640)
FT                   /gene="EMC10"
FT                   /locus_tag="YDR056C"
FT                   /product="Emc10p"
FT   CDS_pept        complement(565023..565640)
FT                   /codon_start=1
FT                   /gene="EMC10"
FT                   /locus_tag="YDR056C"
FT                   /product="Emc10p"
FT                   /note="hypothetical protein; subunit of evolutionarily
FT                   conserved EMC (Endoplasmic Reticulum Membrane Complex)
FT                   implicated in ERAD (ER-associated degradation) and proper
FT                   assembly of multi-pass transmembrane (TM) proteins; EMC
FT                   acts in yeast as an ER-mitochondria tether that interacts
FT                   with outer membrane protein Tom5p of TOM (Translocase of
FT                   the Mitochondrial Outer Membrane) complex; YDR056C is not
FT                   an essential protein"
FT                   /db_xref="GOA:Q12025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12025"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:14562095|PMID:26928762]"
FT                   /protein_id="DAA11902.1"
FT                   /translation="MLVRLLRVILLASMVFCADILQLSYSDDAKDAIPLGTFEIDSTSD
FT                   GNVTVTTVNIQDVEVSGEYCLNAQIEGKLDMPCFSYMKLRTPLKYDLIVDVDEDNEVKQ
FT                   VSLSYDETNDAITATVRYPEAGPTAPVTKLKKKTKTYADKKASKNKDGSTAQFEEDEEV
FT                   KEVSWFQKNWKMLLLGLLIYNFVAGSAKKQQQGGAGADQKTE"
FT   gene            565927..567555
FT                   /gene="YOS9"
FT                   /locus_tag="YDR057W"
FT   mRNA            565927..567555
FT                   /gene="YOS9"
FT                   /locus_tag="YDR057W"
FT                   /product="Yos9p"
FT   CDS_pept        565927..567555
FT                   /codon_start=1
FT                   /gene="YOS9"
FT                   /locus_tag="YDR057W"
FT                   /product="Yos9p"
FT                   /note="ER quality-control lectin; integral subunit of the
FT                   HRD ligase; participates in efficient ER retention of
FT                   misfolded proteins by recognizing them and delivering them
FT                   to Hrd1p; binds to glycans with terminal alpha-1,6 linked
FT                   mannose on misfolded N-glycosylated proteins and
FT                   participates in targeting proteins to ERAD; member of the
FT                   OS-9 protein family"
FT                   /db_xref="GOA:Q99220"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="InterPro:IPR012913"
FT                   /db_xref="InterPro:IPR041039"
FT                   /db_xref="PDB:2YMA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99220"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005788 endoplasmic
FT                   reticulum lumen [PMID:16168371]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034099 luminal
FT                   surveillance complex [PMID:16873065]"
FT                   /experiment="EXISTENCE:direct assay:GO:0070492
FT                   oligosaccharide binding [PMID:19111666]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030433
FT                   ubiquitin-dependent ERAD pathway
FT                   [PMID:16168370|PMID:16168371|PMID:16168372|PMID:22298424]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030968
FT                   endoplasmic reticulum unfolded protein response
FT                   [PMID:22298424]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030970
FT                   retrograde protein transport, ER to cytosol
FT                   [PMID:24292014]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0097466
FT                   ubiquitin-dependent glycoprotein ERAD pathway
FT                   [PMID:19124653]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0000839
FT                   Hrd1p ubiquitin ligase ERAD-L complex [PMID:16873066]"
FT                   /protein_id="DAA11903.1"
FT                   /translation="MQAKIIYALSAISALIPLGSSLLAPIEDPIVSNKYLISYIDEDDW
FT                   SDRILQNQSVMNSGYIVNMGDDLECFIQNASTQLNDVLEDSNEHSNSEKTALLTKTLNQ
FT                   GVKTIFDKLNERCIFYQAGFWIYEYCPGIEFVQFHGRVNTKTGEIVNRDESLVYRLGKP
FT                   KANVEEREFELLYDDVGYYISEIIGSGDICDVTGAERMVEIQYVCGGSNSGPSTIQWVR
FT                   ETKICVYEAQVTIPELCNLELLAKNEDQKNASPILCRMPAKSKIGSNSIDLITKYEPIF
FT                   LGSGIYFLRPFNTDERDKLMVTDNAMSNWDEITETYYQKFGNAINKMLSLRLVSLPNGH
FT                   ILQPGDSCVWLAEVVDMKDRFQTTLSLNILNSQRAEIFFNKTFTFNEDNGNFLSYKIGD
FT                   HGESTELGQITHSNKADINTAEIRSDEYLINTDNELFLRISKEIAEVKELLNEIVSPHE
FT                   MEVIFENMRNQPNNDFELALMNKLKSSLNDDNKVEQINNARMDDDESTSHTTRDIGEAG
FT                   SQTTGNTESEVTNVAAGVFIEHDEL"
FT   rep_origin      567610..567685
FT                   /note="ARS419; Autonomously Replicating Sequence"
FT   gene            complement(567723..568703)
FT                   /gene="TGL2"
FT                   /locus_tag="YDR058C"
FT   mRNA            complement(567723..568703)
FT                   /gene="TGL2"
FT                   /locus_tag="YDR058C"
FT                   /product="triglyceride lipase"
FT   CDS_pept        complement(567723..568703)
FT                   /codon_start=1
FT                   /gene="TGL2"
FT                   /locus_tag="YDR058C"
FT                   /product="triglyceride lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="Triacylglycerol lipase that is localized to the
FT                   mitochondria; has lipolytic activity towards
FT                   triacylglycerols and diacylglycerols when expressed in E.
FT                   coli"
FT                   /db_xref="GOA:P54857"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54857"
FT                   /experiment="EXISTENCE:direct assay:GO:0004806 triglyceride
FT                   lipase activity [PMID:9544243]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:19959834]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004806
FT                   triglyceride lipase activity [PMID:9544243]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0019433
FT                   triglyceride catabolic process [PMID:19959834]"
FT                   /protein_id="DAA11904.1"
FT                   /translation="MKNDNKANDIIIDSVKVPDSYKPPKNPIVFCHGLSGFDKLILIPS
FT                   VFHLTNLISNSIVHNMAENFMQDDEDKSDNKYTNLLEIEYWIGVKKFLQSKGCTVITTK
FT                   VPGFGSIEERAMALDAQLQKEVKKIESKDKRHSLNLIAHSMGGLDCRYLICNIKNRNYD
FT                   ILSLTTISTPHRGSEMADYVVDLFENLNALRVSQKILPICFYQLTTAYMKYFNLVTPNS
FT                   PKVSYFSYGCSFVPKWYNVFCTPWKIVYERSKGCPNDGLVTINSSKWGEYRGTLKDMDH
FT                   LDVINWKNKLQDDWSKFFRTTTVGEKVDILNFYLKITDDLARKGF"
FT   gene            568882..568953
FT                   /locus_tag="tR(UCU)D"
FT   tRNA            568882..568953
FT                   /locus_tag="tR(UCU)D"
FT                   /product="tRNA-Arg"
FT                   /note="tR(UCU)D; Arginine tRNA (tRNA-Arg), predicted by
FT                   tRNAscan-SE analysis; one of 11 nuclear tRNA genes
FT                   containing the tDNA-anticodon UCU (converted to mcm5-UCU in
FT                   the mature tRNA), decodes AGA codons into arginine, one of
FT                   19 nuclear tRNAs for arginine"
FT                   /experiment="EXISTENCE:curator inference:GO:0005829 cytosol
FT                   [PMID:9023104]"
FT                   /experiment="EXISTENCE:curator inference:GO:0006414
FT                   translational elongation [PMID:9023104]"
FT   gene            568964..569035
FT                   /locus_tag="tD(GUC)D"
FT   tRNA            568964..569035
FT                   /locus_tag="tD(GUC)D"
FT                   /product="tRNA-Asp"
FT                   /note="tD(GUC)D; Aspartate tRNA (tRNA-Asp), predicted by
FT                   tRNAscan-SE analysis"
FT                   /experiment="EXISTENCE:curator inference:GO:0005829 cytosol
FT                   [PMID:9023104]"
FT                   /experiment="EXISTENCE:curator inference:GO:0006414
FT                   translational elongation [PMID:9023104]"
FT   gene            complement(569234..569770)
FT                   /gene="UBC5"
FT                   /locus_tag="YDR059C"
FT   mRNA            complement(join(569234..569633,569724..569770))
FT                   /gene="UBC5"
FT                   /locus_tag="YDR059C"
FT                   /product="E2 ubiquitin-conjugating protein UBC5"
FT   CDS_pept        complement(join(569234..569633,569724..569770))
FT                   /codon_start=1
FT                   /gene="UBC5"
FT                   /locus_tag="YDR059C"
FT                   /product="E2 ubiquitin-conjugating protein UBC5"
FT                   /EC_number="2.3.2.23"
FT                   /note="Ubiquitin-conjugating enzyme; mediates selective
FT                   degradation of short-lived, abnormal, or excess proteins,
FT                   including histone H3; central component of the cellular
FT                   stress response; expression is heat inducible; protein
FT                   abundance increases in response to DNA replication stress;
FT                   UBC5 has a paralog, UBC4, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:P15732"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15732"
FT                   /experiment="EXISTENCE:direct assay:GO:0000209 protein
FT                   polyubiquitination [PMID:2154373]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004842
FT                   ubiquitin-protein transferase activity [PMID:2154373]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034605 cellular
FT                   response to heat [PMID:2154373]"
FT                   /experiment="EXISTENCE:direct assay:GO:0070628 proteasome
FT                   binding [PMID:10848595]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0005515
FT                   protein binding [PMID:29519818]"
FT                   /protein_id="DAA11905.1"
FT                   /translation="MSSSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSP
FT                   YAGGVFFLSIHFPTDYPFKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVL
FT                   LSICSLLTDANPDDPLVPEIAQIYKTDKAKYEATAKEWTKKYAV"
FT   gene            570649..573726
FT                   /gene="MAK21"
FT                   /gene_synonym="NOC1"
FT                   /locus_tag="YDR060W"
FT   mRNA            570649..573726
FT                   /gene="MAK21"
FT                   /gene_synonym="NOC1"
FT                   /locus_tag="YDR060W"
FT                   /product="RNA-binding ribosome biosynthesis protein MAK21"
FT   CDS_pept        570649..573726
FT                   /codon_start=1
FT                   /gene="MAK21"
FT                   /gene_synonym="NOC1"
FT                   /locus_tag="YDR060W"
FT                   /product="RNA-binding ribosome biosynthesis protein MAK21"
FT                   /note="Constituent of 66S pre-ribosomal particles; required
FT                   for large (60S) ribosomal subunit biogenesis; acts as part
FT                   of a Mak21p-Noc2p-Rrp5p module that associates with nascent
FT                   pre-rRNA during transcription and has a role in bigenesis
FT                   of the large ribosomal subunit; involved in nuclear export
FT                   of pre-ribosomes; required for maintenance of dsRNA virus;
FT                   homolog of human CAATT-binding protein"
FT                   /db_xref="GOA:Q12176"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040155"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12176"
FT                   /experiment="EXISTENCE:direct assay:GO:0003729 mRNA binding
FT                   [PMID:23222640]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005730 nucleolus
FT                   [PMID:11371346]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030687 preribosome,
FT                   large subunit precursor [PMID:23209026]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030690 Noc1p-Noc2p
FT                   complex [PMID:11371346]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000027
FT                   ribosomal large subunit assembly [PMID:9786894]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0042273
FT                   ribosomal large subunit biogenesis
FT                   [PMID:23209026|PMID:11371346]"
FT                   /protein_id="DAA11906.1"
FT                   /translation="MSENNGNPLDLSSLRNKISSKLRDNNSKKAKKTHKGKDVKASSNS
FT                   KKVNEDIRREALALGASEEDLKLIQGLSDDDDAKSEQEFDAVADEDADDKGFKNDLQNF
FT                   MKNVGFDQHKLEDVDDDDIEEESTSSKESKIPAQEKEHAQSNIASSTIEKTSQESIDNG
FT                   SEQEENTVEEANLSSDQEPESESAEKEKKEEKDGGLITQTTIISSDKLIIPYDKPWYEI
FT                   PLDPQVGQNDDVEELSKEQIEKLFERGKQTLEADNQTYYEEFTKDSSQAKFMSQILSDG
FT                   TLNDKISAVTLLIQDSPLHNTKSLETLVSYCGKKSRNSALQSLNALKDLFLNGLLPNRK
FT                   LRYFKNQPGLSMMLNKKTLAIFYFEDYLKKLFFRVLEVLEVLSHDPIIHVRLQILNHVF
FT                   DLLTNQPEQEFNLLRLGVNKIGDIDSKVSSKASYLLLKLEQAHPNMKSIVIDAIVDIAL
FT                   RPNADYHTTYYSVITLNQTILKRSEDSVANKLVKTYFTLFEKFLINTDKDNTNGVVKSN
FT                   SKSYEEKRKKNFKKGKHGGKSVKIEKTENEVLDEKNSKLFSALLTGINRAFPFAQIPAS
FT                   VYEVHMETLFKITHSSNFNTSIQALVLINQVTVKAKLNSDRYYRTLYESLFDPRLVNSS
FT                   KQGIYLNLLYKSLKQDALNVERVEAFVKRILQVCSHWLNVGTITGFFFLLIQLAKTVPQ
FT                   IKNLLTNTPVDYEYESDAEEEQGDKDIKRKEYDGRKRDPKFANAEKSSLWEINNFINHF
FT                   HPTVKTYANAYVTGETEQIAKPDLGLFTLSHFLDRFVYRSAKQTNTARGTSIMQPLFSG
FT                   SRVNDSVLVKASDIMHDQGPVNTEDWLTKKVEDIKPEDKFFYQYFTTKKTADGKGKKSN
FT                   KASNFDSDDEMDENEIWSALVKSRPDVEDDSDDSELDFAEDDFSDSTSDDEPKLDAIDD
FT                   EDAKSEGSQESDQEEGLDEDIFYSFDGEQDNSDKKRSFAESSEEDESSEEEKEEEENKE
FT                   VSAKRAKKKQRKNMLKSLPVFASADDYAQYLDQDSD"
FT   gene            574164..575783
FT                   /locus_tag="YDR061W"
FT   mRNA            574164..575783
FT                   /locus_tag="YDR061W"
FT                   /product="hypothetical protein"
FT   CDS_pept        574164..575783
FT                   /codon_start=1
FT                   /locus_tag="YDR061W"
FT                   /product="hypothetical protein"
FT                   /note="Protein with similarity to ABC transporter family
FT                   members; lacks predicted membrane-spanning regions;
FT                   transcriptionally activated by Yrm1p along with genes
FT                   involved in multidrug resistance"
FT                   /db_xref="GOA:Q12298"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12298"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14562095|PMID:16823961|PMID:24769239]"
FT                   /protein_id="DAA11907.1"
FT                   /translation="MSTNKFVVRITNALFKSSLASNSPPVYPKRIRHFEILPNEKWVIW
FT                   GPGKGKFLDVLNNKYICEPPLSLRFGFLKESSNILPRIEQVAFKGVMPTAHLSARYEYF
FT                   KDDYDQTCKQFIFDKASGSNAVSYKVETNNRQINMELYNALVENLNLSSLQDRWVMGLS
FT                   NGQMRRARLARSILKEPDLLLIDDPFLGLDPAAIATISQFLAKYDSIEVSGGCPIVIGL
FT                   RYQDTIPAWCTHICCVDEKNGILFEGPIEKLQSKMDETRSRALKELEQLKKASNSKEDI
FT                   SINDLICIHPMYGKKEHEIIKMPHLIELDGLSVSYKGEAVLENLHWKVQPGSKWHIRGD
FT                   NGSGKSTLLSLLTAEHPQSWNSRVIDNGVPRRTGKTNYFDLNSKIGMSSPELHAIFLKN
FT                   AGGRLNIRESVATGYHEASSNNYLPIWKRLDKNSQEIVNMYLKYFGLDKDADSVLFEQL
FT                   SVSDQKLVLFVRSLIKMPQILILDEAFSGMEVEPMMRCHEFLEEWPGTVLVVAHVAEET
FT                   PKCAHYLRLISPGEYEIGDMEN"
FT   gene            576474..578159
FT                   /gene="LCB2"
FT                   /gene_synonym="SCS1"
FT                   /gene_synonym="TSC1"
FT                   /locus_tag="YDR062W"
FT   mRNA            576474..578159
FT                   /gene="LCB2"
FT                   /gene_synonym="SCS1"
FT                   /gene_synonym="TSC1"
FT                   /locus_tag="YDR062W"
FT                   /product="serine C-palmitoyltransferase LCB2"
FT   CDS_pept        576474..578159
FT                   /codon_start=1
FT                   /gene="LCB2"
FT                   /gene_synonym="SCS1"
FT                   /gene_synonym="TSC1"
FT                   /locus_tag="YDR062W"
FT                   /product="serine C-palmitoyltransferase LCB2"
FT                   /EC_number="2.3.1.50"
FT                   /note="Component of serine palmitoyltransferase;
FT                   responsible along with Lcb1p for the first committed step
FT                   in sphingolipid synthesis, which is the condensation of
FT                   serine with palmitoyl-CoA to form 3-ketosphinganine"
FT                   /db_xref="GOA:P40970"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40970"
FT                   /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
FT                   reticulum [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0035339 SPOTS
FT                   complex [PMID:20182505]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0004758
FT                   serine C-palmitoyltransferase activity [PMID:8058731]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004758 serine
FT                   C-palmitoyltransferase activity [PMID:1556076]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0017059 serine
FT                   C-palmitoyltransferase complex [PMID:1556076]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030148
FT                   sphingolipid biosynthetic process [PMID:1556076]"
FT                   /protein_id="DAA11908.1"
FT                   /translation="MSTPANYTRVPLCEPEELPDDIQKENEYGTLDSPGHLYQVKSRHG
FT                   KPLPEPVVDTPPYYISLLTYLNYLILIILGHVHDFLGMTFQKNKHLDLLEHDGLAPWFS
FT                   NFESFYVRRIKMRIDDCFSRPTTGVPGRFIRCIDRISHNINEYFTYSGAVYPCMNLSSY
FT                   NYLGFAQSKGQCTDAALESVDKYSIQSGGPRAQIGTTDLHIKAEKLVARFIGKEDALVF
FT                   SMGYGTNANLFNAFLDKKCLVISDELNHTSIRTGVRLSGAAVRTFKHGDMVGLEKLIRE
FT                   QIVLGQPKTNRPWKKILICAEGLFSMEGTLCNLPKLVELKKKYKCYLFIDEAHSIGAMG
FT                   PTGRGVCEIFGVDPKDVDILMGTFTKSFGAAGGYIAADQWIIDRLRLDLTTVSYSESMP
FT                   APVLAQTISSLQTISGEICPGQGTERLQRIAFNSRYLRLALQRLGFIVYGVADSPVIPL
FT                   LLYCPSKMPAFSRMMLQRRIAVVVVAYPATPLIESRVRFCMSASLTKEDIDYLLRHVSE
FT                   VGDKLNLKSNSGKSSYDGKRQRWDIEEVIRRTPEDCKDDKYFVN"
FT   gene            578663..579112
FT                   /gene="AIM7"
FT                   /gene_synonym="GMF1"
FT                   /locus_tag="YDR063W"
FT   mRNA            578663..579112
FT                   /gene="AIM7"
FT                   /gene_synonym="GMF1"
FT                   /locus_tag="YDR063W"
FT                   /product="Aim7p"
FT   CDS_pept        578663..579112
FT                   /codon_start=1
FT                   /gene="AIM7"
FT                   /gene_synonym="GMF1"
FT                   /locus_tag="YDR063W"
FT                   /product="Aim7p"
FT                   /note="Protein that interacts with Arp2/3 complex;
FT                   interacts with Arp2/3 complex to stimulate actin filament
FT                   debranching and inhibit actin nucleation; has similarity to
FT                   Cof1p and also to human glia maturation factor (GMF); null
FT                   mutant displays elevated mitochondrial genome loss"
FT                   /db_xref="GOA:Q12156"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR011171"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12156"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:20362448|PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030479 actin
FT                   cortical patch [PMID:20362448]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034316 negative
FT                   regulation of Arp2/3 complex-mediated actin nucleation
FT                   [PMID:20362448]"
FT                   /experiment="EXISTENCE:direct assay:GO:0071846 actin
FT                   filament debranching [PMID:20362448]"
FT                   /protein_id="DAA11909.1"
FT                   /translation="MSNLYKIGTETRNKIKKFRTSTARTDSIKALSIKIEPKPSYEIIV
FT                   DEDEQEELDEIEDLSELAEILPDNSPRFVLTAYPTTTKDGFKQTPLVLVYWKPMTVVSQ
FT                   EWKMLYAGALEMIREECGTFKLIEVSSGLEDDSDVEELREQLENC"
FT   gene            579458..580452
FT                   /gene="RPS13"
FT                   /gene_synonym="RPS13B"
FT                   /gene_synonym="RPS13C"
FT                   /locus_tag="YDR064W"
FT   mRNA            join(579458..579478,580018..580452)
FT                   /gene="RPS13"
FT                   /gene_synonym="RPS13B"
FT                   /gene_synonym="RPS13C"
FT                   /locus_tag="YDR064W"
FT                   /product="ribosomal 40S subunit protein S13"
FT   CDS_pept        join(579458..579478,580018..580452)
FT                   /codon_start=1
FT                   /gene="RPS13"
FT                   /gene_synonym="RPS13B"
FT                   /gene_synonym="RPS13C"
FT                   /locus_tag="YDR064W"
FT                   /product="ribosomal 40S subunit protein S13"
FT                   /note="Protein component of the small (40S) ribosomal
FT                   subunit; homologous to mammalian ribosomal protein S13 and
FT                   bacterial S15"
FT                   /db_xref="GOA:P05756"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012606"
FT                   /db_xref="InterPro:IPR023029"
FT                   /db_xref="PDB:1K5X"
FT                   /db_xref="PDB:3J6X"
FT                   /db_xref="PDB:3J6Y"
FT                   /db_xref="PDB:3J77"
FT                   /db_xref="PDB:3J78"
FT                   /db_xref="PDB:4U3M"
FT                   /db_xref="PDB:4U3N"
FT                   /db_xref="PDB:4U3U"
FT                   /db_xref="PDB:4U4N"
FT                   /db_xref="PDB:4U4O"
FT                   /db_xref="PDB:4U4Q"
FT                   /db_xref="PDB:4U4R"
FT                   /db_xref="PDB:4U4U"
FT                   /db_xref="PDB:4U4Y"
FT                   /db_xref="PDB:4U4Z"
FT                   /db_xref="PDB:4U50"
FT                   /db_xref="PDB:4U51"
FT                   /db_xref="PDB:4U52"
FT                   /db_xref="PDB:4U53"
FT                   /db_xref="PDB:4U55"
FT                   /db_xref="PDB:4U56"
FT                   /db_xref="PDB:4U6F"
FT                   /db_xref="PDB:4V4B"
FT                   /db_xref="PDB:4V6I"
FT                   /db_xref="PDB:4V7R"
FT                   /db_xref="PDB:4V88"
FT                   /db_xref="PDB:4V8Y"
FT                   /db_xref="PDB:4V8Z"
FT                   /db_xref="PDB:4V92"
FT                   /db_xref="PDB:5DAT"
FT                   /db_xref="PDB:5DC3"
FT                   /db_xref="PDB:5DGE"
FT                   /db_xref="PDB:5DGF"
FT                   /db_xref="PDB:5DGV"
FT                   /db_xref="PDB:5FCI"
FT                   /db_xref="PDB:5FCJ"
FT                   /db_xref="PDB:5I4L"
FT                   /db_xref="PDB:5JPQ"
FT                   /db_xref="PDB:5JUO"
FT                   /db_xref="PDB:5JUP"
FT                   /db_xref="PDB:5JUS"
FT                   /db_xref="PDB:5JUT"
FT                   /db_xref="PDB:5JUU"
FT                   /db_xref="PDB:5LL6"
FT                   /db_xref="PDB:5LYB"
FT                   /db_xref="PDB:5M1J"
FT                   /db_xref="PDB:5MC6"
FT                   /db_xref="PDB:5MEI"
FT                   /db_xref="PDB:5NDG"
FT                   /db_xref="PDB:5NDV"
FT                   /db_xref="PDB:5NDW"
FT                   /db_xref="PDB:5OBM"
FT                   /db_xref="PDB:5ON6"
FT                   /db_xref="PDB:5TBW"
FT                   /db_xref="PDB:5TGA"
FT                   /db_xref="PDB:5TGM"
FT                   /db_xref="PDB:5WLC"
FT                   /db_xref="PDB:5WYJ"
FT                   /db_xref="PDB:5WYK"
FT                   /db_xref="PDB:6EML"
FT                   /db_xref="PDB:6FAI"
FT                   /db_xref="PDB:6GQ1"
FT                   /db_xref="PDB:6GQB"
FT                   /db_xref="PDB:6GQV"
FT                   /db_xref="PDB:6HHQ"
FT                   /db_xref="PDB:6I7O"
FT                   /db_xref="PDB:6Q8Y"
FT                   /db_xref="PDB:6RBD"
FT                   /db_xref="PDB:6RBE"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05756"
FT                   /experiment="EXISTENCE:curator inference:GO:0002181
FT                   cytoplasmic translation
FT                   [PMID:2517480|PMID:3533916|PMID:6814480]"
FT                   /experiment="EXISTENCE:direct assay:GO:0003735 structural
FT                   constituent of ribosome
FT                   [PMID:2517480|PMID:3533916|PMID:6814480]"
FT                   /experiment="EXISTENCE:direct assay:GO:0022627 cytosolic
FT                   small ribosomal subunit
FT                   [PMID:2517480|PMID:3533916|PMID:6814480]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030686 90S
FT                   preribosome [PMID:12150911]"
FT                   /experiment="EXISTENCE:direct assay:GO:0070181 small
FT                   ribosomal subunit rRNA binding [PMID:2517480]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000462
FT                   maturation of SSU-rRNA from tricistronic rRNA transcript
FT                   (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:16246728]"
FT                   /protein_id="DAA11910.1"
FT                   /translation="MGRMHSAGKGISSSAIPYSRNAPAWFKLSSESVIEQIVKYARKGL
FT                   TPSQIGVLLRDAHGVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKHLER
FT                   NRKDKDAKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVN"
FT   gene            580687..581784
FT                   /gene="RRG1"
FT                   /gene_synonym="MTA2"
FT                   /locus_tag="YDR065W"
FT   mRNA            580687..581784
FT                   /gene="RRG1"
FT                   /gene_synonym="MTA2"
FT                   /locus_tag="YDR065W"
FT                   /product="Rrg1p"
FT   CDS_pept        580687..581784
FT                   /codon_start=1
FT                   /gene="RRG1"
FT                   /gene_synonym="MTA2"
FT                   /locus_tag="YDR065W"
FT                   /product="Rrg1p"
FT                   /note="hypothetical protein; required for efficient 5'
FT                   processing of mitochondrial tRNAs, for respiratory growth
FT                   and mitochondrial genome maintenance; required for vacuolar
FT                   acidification; localizes to the matrix side of the inner
FT                   mitochondrial membrane"
FT                   /db_xref="GOA:Q12167"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12167"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14562095|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0099617 matrix side
FT                   of mitochondrial inner membrane [PMID:30759361]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0000002
FT                   mitochondrial genome maintenance [PMID:19751518]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0007035 vacuolar
FT                   acidification [PMID:16168084]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0097745
FT                   mitochondrial tRNA 5'-end processing [PMID:30759361]"
FT                   /protein_id="DAA11911.1"
FT                   /translation="MAQNFGKIPSHKSYVLSLYRTVLRNIPKCCHSYAFQYEIKKTLSI
FT                   QLFKHKHDKSSWSVYTLLNEFSLLNNCLLEGKLQEIKNLMKPLKKMKKQLKTTKILNSL
FT                   TSLGDVKTNDPEEVRRFHVLSAYIKRKQDLGLLPAYIPKTYQHKLLLPLALNEHACLKL
FT                   FHIQQKLKNGPPSAGLSYTKEGRNQIWFVRSPINKGRQQSKKLGILIRKERKDSQKNID
FT                   NLNFCEINAAWALHEAIWEEYLESKKIIKVNLPKYLEYAANIPKSTKCNPSSQYQKVKE
FT                   WVDPVREIMFELHSKSFQRVEYFNKYKEKLLKNGGQLAYFDKKSKEMYAKRLTLFRKMS
FT                   KETLPYVTLFIEGRDLPSVLAKYGF"
FT   gene            complement(581908..582498)
FT                   /gene="RTR2"
FT                   /locus_tag="YDR066C"
FT   mRNA            complement(581908..582498)
FT                   /gene="RTR2"
FT                   /locus_tag="YDR066C"
FT                   /product="putative protein-serine/threonine phosphatase"
FT   CDS_pept        complement(581908..582498)
FT                   /codon_start=1
FT                   /gene="RTR2"
FT                   /locus_tag="YDR066C"
FT                   /product="putative protein-serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="hypothetical protein; exhibits genetic interactions
FT                   with Rtr1p; green fluorescent protein (GFP)-fusion protein
FT                   localizes to the cytoplasm; YDR066C is not an essential
FT                   gene; relocalizes from nucleus to cytoplasmic foci upon DNA
FT                   replication stress; RTR2 has a paralog, RTR1, that arose
FT                   from the whole genome duplication"
FT                   /db_xref="GOA:Q12378"
FT                   /db_xref="InterPro:IPR007308"
FT                   /db_xref="InterPro:IPR038534"
FT                   /db_xref="InterPro:IPR039693"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12378"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:22842922]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095|PMID:22842922]"
FT                   /protein_id="DAA11912.1"
FT                   /translation="MQIITTTFIQKVILGSHQLHEQLSIVEARMIESAIVSMLTESFCE
FT                   NEQTLKYLARLLSPMSYMDVINARRGKKICGYPLCYKSAAENSSDGFFIHSMYCNNYHS
FT                   KCSLYLMRQLSQTPLHERRGVHLTSYINLEFDDMYSVSLLEELVGSEVPIDTVKSLITS
FT                   FKDLEFDDTYKNEPLPLDVYFGQLTTDEETCIE"
FT   gene            complement(582791..583465)
FT                   /gene="OCA6"
FT                   /locus_tag="YDR067C"
FT   mRNA            complement(582791..583465)
FT                   /gene="OCA6"
FT                   /locus_tag="YDR067C"
FT                   /product="protein-tyrosine-phosphatase"
FT   CDS_pept        complement(582791..583465)
FT                   /codon_start=1
FT                   /gene="OCA6"
FT                   /locus_tag="YDR067C"
FT                   /product="protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="Cytoplasmic protein required for replication of
FT                   Brome mosaic virus; S. cerevisiae is a model system for
FT                   studying positive-strand RNA virus replication; null
FT                   mutation confers sensitivity to tunicamycin and DTT"
FT                   /db_xref="GOA:Q12454"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12454"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /protein_id="DAA11913.1"
FT                   /translation="MTLVTPLQFSTVQPNLYRGSYPREINLPFLRTLRLKYILSLTPEP
FT                   LSTDPLMVKFCEENNIKTIHIKCQSERKADKTKPKIKRKKKTVPIEYDVVVRCVKFLID
FT                   KGHYPCYMHCTNGELIISLVVACMRKFSYWSTVSILNEFLVYNSSINIHERNFIENFNS
FT                   EIEVDDLDIKDKVPWITVRYIARTATESKDELRVDDANASEKVARVSSVSNSLPKLKFH
FT                   SM"
FT   gene            583713..584645
FT                   /gene="DOS2"
FT                   /locus_tag="YDR068W"
FT   mRNA            583713..584645
FT                   /gene="DOS2"
FT                   /locus_tag="YDR068W"
FT                   /product="Dos2p"
FT   CDS_pept        583713..584645
FT                   /codon_start=1
FT                   /gene="DOS2"
FT                   /locus_tag="YDR068W"
FT                   /product="Dos2p"
FT                   /note="hypothetical protein; green fluorescent protein
FT                   (GFP)-fusion protein localizes to the cytoplasm"
FT                   /db_xref="GOA:P54858"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="InterPro:IPR035925"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54858"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /protein_id="DAA11914.1"
FT                   /translation="MEFFYEEQVACIEDDKISNSHTKETGSTENTENNELQSRDDKTNE
FT                   AFQKLEEEVNKRYEKTTSAFKKLVIEKDDGIEINLPISNETTETAQKYLKKLDENIHSV
FT                   ESLAQSYWSKMKTKNFWSGFSSFDNAAENDSNDKDENSKENEIAVGGNRTEAELRTLSK
FT                   DKSVYLDNKMDLQLDPFDVDEKTEEICSILQGDKDISKLMNDIVPHKISYKDFWHIYFL
FT                   QRNKILDKESKRKEILSKKEKETEEKEVEWDDEEEEEDDDKVEAVADNKSKGETKVAVS
FT                   QEGLKDVSDHVGLANKDESKDDDDDDDWE"
FT   gene            complement(584939..587719)
FT                   /gene="DOA4"
FT                   /gene_synonym="DOS1"
FT                   /gene_synonym="MUT4"
FT                   /gene_synonym="NPI2"
FT                   /gene_synonym="SSV7"
FT                   /gene_synonym="UBP4"
FT                   /locus_tag="YDR069C"
FT   mRNA            complement(584939..587719)
FT                   /gene="DOA4"
FT                   /gene_synonym="DOS1"
FT                   /gene_synonym="MUT4"
FT                   /gene_synonym="NPI2"
FT                   /gene_synonym="SSV7"
FT                   /gene_synonym="UBP4"
FT                   /locus_tag="YDR069C"
FT                   /product="ubiquitin-specific protease DOA4"
FT   CDS_pept        complement(584939..587719)
FT                   /codon_start=1
FT                   /gene="DOA4"
FT                   /gene_synonym="DOS1"
FT                   /gene_synonym="MUT4"
FT                   /gene_synonym="NPI2"
FT                   /gene_synonym="SSV7"
FT                   /gene_synonym="UBP4"
FT                   /locus_tag="YDR069C"
FT                   /product="ubiquitin-specific protease DOA4"
FT                   /EC_number="3.4.19.12"
FT                   /note="Ubiquitin hydrolase; deubiquitinates intralumenal
FT                   vesicle (ILVs) cargo proteins; required for recycling
FT                   ubiquitin from proteasome-bound ubiquitinated
FT                   intermediates, acts at the late endosome/prevacuolar
FT                   compartment to recover ubiquitin from ubiquitinated
FT                   membrane proteins destined for the vacuole; DOA4 has a
FT                   paralog, UBP5, that arose from the whole genome
FT                   duplication"
FT                   /db_xref="GOA:P32571"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32571"
FT                   /experiment="EXISTENCE:direct assay:GO:0000502 proteasome
FT                   complex [PMID:10069815]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004843
FT                   thiol-dependent ubiquitin-specific protease activity
FT                   [PMID:19410548|PMID:8247125]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005768 endosome
FT                   [PMID:17145966]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:26928762]"
FT                   /experiment="EXISTENCE:direct assay:GO:0010995 free
FT                   ubiquitin chain depolymerization [PMID:19410548]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0070676
FT                   intralumenal vesicle formation [PMID:23444383]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004843
FT                   thiol-dependent ubiquitin-specific protease activity
FT                   [PMID:8247125]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006275
FT                   regulation of DNA replication [PMID:8657109]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006511
FT                   ubiquitin-dependent protein catabolic process
FT                   [PMID:17145966]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006897
FT                   endocytosis [PMID:9119204]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0010992
FT                   ubiquitin recycling [PMID:19410548]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0043162
FT                   ubiquitin-dependent protein catabolic process via the
FT                   multivesicular body sorting pathway [PMID:17376168]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1904669 ATP
FT                   export [PMID:26585826]"
FT                   /protein_id="DAA11915.1"
FT                   /translation="MEQNIISTIRDECIRHRSKYLTIAQLTAIAEAKINEFIITGKAKD
FT                   QDLSSLLDKCIDILSIYKKNSKDIKNIISCKNKGAMISSNSVMIIQLNYVYYKVIHIIV
FT                   TTNIPHLSEFAKIKLHKSTSDEGNGNNNNNEFQLMNIYNTLLETLLKDENIAKIKSFIK
FT                   SSIKQTKLNHEQEECNLMRTGSYITSNQLNSLISSSANSASSQMEILLIDIRSRLEFNK
FT                   SHIDTKNIICLEPISFKMSYSDHDLEKKSLITSPNSEIKMFQSRNLFKFIILYTDANEY
FT                   NVKQQSVLLDILVNHSFEKPISDDFTKIFILESGFPGWLKSNYGRQVSSSFPSNNNIKD
FT                   DSVYINGNTSGLSLQHLPKMSPSIRHSMDDSMKEMLVAPTPLNHLQQQQQQQSDNDHVL
FT                   KRSSSFKKLFSNYTSPNPKNSNSNLYSISSLSISSSPSPLPLHSPDPVKGNSLPINYPE
FT                   TPHLWKNSETDFMTNQREQLNHNSFAHIAPINTKAITSPSRTATPKLQRFPQTISMNLN
FT                   MNSNGHSSATSTIQPSCLSLSNNDSLDHTDVTPTSSHNYDLDFAVGLENLGNSCYMNCI
FT                   IQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMMYKEQVDGSKKISI
FT                   SPIKFKLACGSVNSLFKTASQQDCQEFCQFLLDGLHEDLNQCGSNPPLKELSQEAEARR
FT                   EKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLKCKVCSHTSTTYQPFTVLSIPIP
FT                   KKNSRNNITIEDCFREFTKCENLEVDEQWLCPHCEKRQPSTKQLTITRLPRNLIVHLKR
FT                   FDNLLNKNNDFVIYPFLLDLTPFWANDFDGVFPPGVNDDELPIRGQIPPFKYELYGVAC
FT                   HFGTLYGGHYTAYVKKGLKKGWLYFDDTKYKPVKNKADAINSNAYVLFYHRVYGV"
FT   gene            complement(588098..588379)
FT                   /gene="FMP16"
FT                   /locus_tag="YDR070C"
FT   mRNA            complement(588098..588379)
FT                   /gene="FMP16"
FT                   /locus_tag="YDR070C"
FT                   /product="Fmp16p"
FT   CDS_pept        complement(588098..588379)
FT                   /codon_start=1
FT                   /gene="FMP16"
FT                   /locus_tag="YDR070C"
FT                   /product="Fmp16p"
FT                   /note="hypothetical protein; may be involved in responding
FT                   to conditions of stress; the authentic, non-tagged protein
FT                   is detected in highly purified mitochondria in
FT                   high-throughput studies; protein abundance increases in
FT                   response to DNA replication stress"
FT                   /db_xref="GOA:Q12497"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12497"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion
FT                   [PMID:14562095|PMID:14576278|PMID:16823961|PMID:24769239]"
FT                   /protein_id="DAA11916.1"
FT                   /translation="MLRTTFLRTPRQLMRKSPRASFSIVTRAAFPHLKNNQDEAEKKEQ
FT                   GLFDSNKKRLDTLEHGKNPDYKQPGMEDLKKKGDDARIEQNRPDDGVY"
FT   gene            complement(588827..589402)
FT                   /gene="PAA1"
FT                   /locus_tag="YDR071C"
FT   mRNA            complement(588827..589402)
FT                   /gene="PAA1"
FT                   /locus_tag="YDR071C"
FT                   /product="polyamine acetyltransferase"
FT   CDS_pept        complement(588827..589402)
FT                   /codon_start=1
FT                   /gene="PAA1"
FT                   /locus_tag="YDR071C"
FT                   /product="polyamine acetyltransferase"
FT                   /note="Polyamine acetyltransferase; acetylates polyamines
FT                   (e.g. putrescine, spermidine, spermine) and also
FT                   aralkylamines (e.g. tryptamine, phenylethylamine); may be
FT                   involved in transcription and/or DNA replication"
FT                   /db_xref="GOA:Q12447"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12447"
FT                   /experiment="EXISTENCE:direct assay:GO:0004059 aralkylamine
FT                   N-acetyltransferase activity [PMID:11559708]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004145 diamine
FT                   N-acetyltransferase activity [PMID:15723835]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004145 diamine
FT                   N-acetyltransferase activity [PMID:15723835]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006325
FT                   chromatin organization [PMID:15723835]"
FT                   /protein_id="DAA11917.1"
FT                   /translation="MASSSSTLPLHMYIRPLIIEDLKQILNLESQGFPPNERASEEIIS
FT                   FRLINCPELCSGLFIREIEGKEVKKETLIGHIMGTKIPHEYITIESMGKLQVESSNHIG
FT                   IHSVVIKPEYQKKNLATLLLTDYIQKLSNQEIGNKIVLIAHEPLIPFYERVGFKIIAEN
FT                   TNVAKDKNFAEQKWIDMERELIKEEYDN"
FT   gene            complement(589761..591344)
FT                   /gene="IPT1"
FT                   /gene_synonym="KTI6"
FT                   /gene_synonym="MIC2"
FT                   /gene_synonym="SYR4"
FT                   /locus_tag="YDR072C"
FT   mRNA            complement(589761..591344)
FT                   /gene="IPT1"
FT                   /gene_synonym="KTI6"
FT                   /gene_synonym="MIC2"
FT                   /gene_synonym="SYR4"
FT                   /locus_tag="YDR072C"
FT                   /product="inositolphosphotransferase"
FT   CDS_pept        complement(589761..591344)
FT                   /codon_start=1
FT                   /gene="IPT1"
FT                   /gene_synonym="KTI6"
FT                   /gene_synonym="SYR4"
FT                   /gene_synonym="MIC2"
FT                   /locus_tag="YDR072C"
FT                   /product="inositolphosphotransferase"
FT                   /note="Inositolphosphotransferase; involved in synthesis of
FT                   mannose-(inositol-P)2-ceramide (M(IP)2C), the most abundant
FT                   sphingolipid; can mutate to resistance to the antifungals
FT                   syringomycin E and DmAMP1 and to K. lactis zymocin"
FT                   /db_xref="GOA:P38954"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38954"
FT                   /experiment="EXISTENCE:direct assay:GO:0006676 mannosyl
FT                   diphosphorylinositol ceramide metabolic process
FT                   [PMID:9368028]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016772 transferase
FT                   activity, transferring phosphorus-containing groups
FT                   [PMID:9368028]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0030148
FT                   sphingolipid biosynthetic process [PMID:15792805]"
FT                   /protein_id="DAA11918.1"
FT                   /translation="MNVIFSLASFVKNMYNASLNQRNLISLPFNFMLNFAPVFIWLSIF
FT                   KRAGLIPIRLRPDIHSKFAFFADQFLFGDYWHELTVQLPDNTSKLFFWSFISSSAFLLV
FT                   FLICIPFAIWYYIYYIKHVNYNLLEWFANIFHYPCKRKQRPIQKRFRTIFIPFALPLFT
FT                   FVILNIDHFFAYQSDANFTKTKDLLAWFSYVILHLTAPILTAVYLYVFQPPGTLKCFSF
FT                   ALGLQNIAGVLTHLLVPMASPWFTHLYGIDDTEHVNYTQEGFAAGLIRVDSHLGTHLNT
FT                   KGFHMSPIVFGAVPSLHSAIAFQCFLFLVSRSTSLKHRFSNAGGFTMHNNDSSTFKLSE
FT                   EDSEDEGDNSIPPTIGPNDLEMEPLGTVEPVDISNERSSSPSSSFTVSSNERSTGGGDG
FT                   SIINSNGNKKPLQFVHLYDEDTNFTNKWIFKIVNDGFIPKFWAILYIILQWWATMYLDH
FT                   HYRFDLFVGVLYAMTSFIIINWFVLQPKVLKKWIHIRLGDKVDTRNEARTFGMRVFCGT
FT                   KMEWFFDPLA"
FT   gene            592439..592948
FT                   /gene="SNF11"
FT                   /locus_tag="YDR073W"
FT   mRNA            592439..592948
FT                   /gene="SNF11"
FT                   /locus_tag="YDR073W"
FT                   /product="Snf11p"
FT   CDS_pept        592439..592948
FT                   /codon_start=1
FT                   /gene="SNF11"
FT                   /locus_tag="YDR073W"
FT                   /product="Snf11p"
FT                   /note="Subunit of the SWI/SNF chromatin remodeling complex;
FT                   involved in transcriptional regulation; interacts with a
FT                   highly conserved 40-residue sequence of Snf2p; relocates to
FT                   the cytosol under hypoxic conditions"
FT                   /db_xref="GOA:P38956"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38956"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:22932476]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
FT                   [PMID:22932476]"
FT                   /experiment="EXISTENCE:direct assay:GO:0015616 DNA
FT                   translocase activity [PMID:17188033]"
FT                   /experiment="EXISTENCE:direct assay:GO:0016514 SWI/SNF
FT                   complex [PMID:18644858|PMID:7623818]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0045944 positive
FT                   regulation of transcription by RNA polymerase II
FT                   [PMID:17573544]"
FT                   /protein_id="DAA11919.1"
FT                   /translation="MSSEIAYSNTNTNTENENRNTGAGVDVNTNANANANATANATANA
FT                   TANATAELNLPTVDEQRQYKVQLLLHINSILLARVIQMNNSLQNNLQNNINNSNNNNII
FT                   RIQQLISQFLKRVHANLQCISQINQGVPSAKPLILTPPQLANQQQPPQDILSKLYLLLA
FT                   RVFEIW"
FT   gene            593893..596583
FT                   /gene="TPS2"
FT                   /gene_synonym="HOG2"
FT                   /gene_synonym="PFK3"
FT                   /locus_tag="YDR074W"
FT   mRNA            593893..596583
FT                   /gene="TPS2"
FT                   /gene_synonym="HOG2"
FT                   /gene_synonym="PFK3"
FT                   /locus_tag="YDR074W"
FT                   /product="trehalose-phosphatase TPS2"
FT   CDS_pept        593893..596583
FT                   /codon_start=1
FT                   /gene="TPS2"
FT                   /gene_synonym="HOG2"
FT                   /gene_synonym="PFK3"
FT                   /locus_tag="YDR074W"
FT                   /product="trehalose-phosphatase TPS2"
FT                   /EC_number="3.1.3.12"
FT                   /note="Phosphatase subunit of the trehalose-6-P
FT                   synthase/phosphatase complex; involved in synthesis of the
FT                   storage carbohydrate trehalose; expression is induced by
FT                   stress conditions and repressed by the Ras-cAMP pathway;
FT                   protein abundance increases in response to DNA replication
FT                   stress"
FT                   /db_xref="GOA:P31688"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31688"
FT                   /experiment="EXISTENCE:direct assay:GO:0005739
FT                   mitochondrion [PMID:14576278|PMID:16823961]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034605 cellular
FT                   response to heat [PMID:8444170]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004805
FT                   trehalose-phosphatase activity [PMID:8444170|PMID:9837904]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0005992
FT                   trehalose biosynthetic process [PMID:8203161|PMID:8444170]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0034605 cellular
FT                   response to heat [PMID:8203161]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0070413
FT                   trehalose metabolism in response to stress [PMID:9837904]"
FT                   /experiment="EXISTENCE:physical interaction:GO:0005946
FT                   alpha,alpha-trehalose-phosphate synthase complex
FT                   (UDP-forming) [PMID:9837904]"
FT                   /protein_id="DAA11920.1"
FT                   /translation="MTTTAQDNSPKKRQRIINCVTQLPYKIQLGESNDDWKISATTGNS
FT                   ALFSSLEYLQFDSTEYEQHVVGWTGEITRTERNLFTREAKEKPQDLDDDPLYLTKEQIN
FT                   GLTTTLQDHMKSDKEAKTDTTQTAPVTNNVHPVWLLRKNQSRWRNYAEKVIWPTFHYIL
FT                   NPSNEGEQEKNWWYDYVKFNEAYAQKIGEVYRKGDIIWIHDYYLLLLPQLLRMKFNDES
FT                   IIIGYFHHAPWPSNEYFRCLPRRKQILDGLVGANRICFQNESFSRHFVSSCKRLLDATA
FT                   KKSKNSSNSDQYQVSVYGGDVLVDSLPIGVNTTQILKDAFTKDIDSKVLSIKQAYQNKK
FT                   IIIGRDRLDSVRGVVQKLRAFETFLAMYPEWRDQVVLIQVSSPTANRNSPQTIRLEQQV
FT                   NELVNSINSEYGNLNFSPVQHYYMRIPKDVYLSLLRVADLCLITSVRDGMNTTALEYVT
FT                   VKSHMSNFLCYGNPLILSEFSGSSNVLKDAIVVNPWDSVAVAKSINMALKLDKEEKSNL
FT                   ESKLWKEVPTIQDWTNKFLSSLKEQASSNDDMERKMTPALNRPVLLENYKQAKRRLFLF
FT                   DYDGTLTPIVKDPAAAIPSARLYTILQKLCADPHNQIWIISGRDQKFLNKWLGGKLPQL
FT                   GLSAEHGCFMKDVSCQDWVNLTEKVDMSWQVRVNEVMEEFTTRTPGSFIERKKVALTWH
FT                   YRRTVPELGEFHAKELKEKLLSFTDDFDLEVMDGKANIEVRPRFVNKGEIVKRLVWHQH
FT                   GKPQDMLKGISEKLPKDEMPDFVLCLGDDFTDEDMFRQLNTIETCWKEKYPDQKNQWGN
FT                   YGFYPVTVGSASKKTVAKAHLTDPQQVLETLGLLVGDVSLFQSAGTVDLDSRGHVKNSE
FT                   SSLKSKLASKAYVMKRSASYTGAKV"
FT   gene            597156..598082
FT                   /gene="PPH3"
FT                   /locus_tag="YDR075W"
FT   mRNA            597156..598082
FT                   /gene="PPH3"
FT                   /locus_tag="YDR075W"
FT                   /product="phosphoprotein phosphatase PP4 catalytic subunit
FT                   PPH3"
FT   CDS_pept        597156..598082
FT                   /codon_start=1
FT                   /gene="PPH3"
FT                   /locus_tag="YDR075W"
FT                   /product="phosphoprotein phosphatase PP4 catalytic subunit
FT                   PPH3"
FT                   /EC_number="3.1.3.16"
FT                   /note="Catalytic subunit of protein phosphatase PP4
FT                   complex; Pph3p and Psy2p form active complex, Psy4p may
FT                   provide substrate specificity; regulates recovery from the
FT                   DNA damage checkpoint, the gene conversion- and
FT                   single-strand annealing-mediated pathways of meiotic
FT                   double-strand break repair and efficient Non-Homologous
FT                   End-Joining (NHEJ) pathway; involved in activation of Gln3p
FT                   to alleviate nitrogen catabolite repression; Pph3p and
FT                   Psy2p localize to foci on meiotic chromosomes"
FT                   /db_xref="GOA:P32345"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32345"
FT                   /experiment="EXISTENCE:direct assay:GO:0000794 condensed
FT                   nuclear chromosome [PMID:20951350]"
FT                   /experiment="EXISTENCE:direct assay:GO:0004722 protein
FT                   serine/threonine phosphatase activity
FT                   [PMID:16299494|PMID:7941742]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
FT                   [PMID:14562095]"
FT                   /experiment="EXISTENCE:direct assay:GO:0006470 protein
FT                   dephosphorylation [PMID:16299494|PMID:7941742]"
FT                   /experiment="EXISTENCE:direct assay:GO:0030289 protein
FT                   phosphatase 4 complex [PMID:16299494|PMID:17517611]"
FT                   /experiment="EXISTENCE:direct assay:GO:0034399 nuclear
FT                   periphery [PMID:25817432]"
FT                   /experiment="EXISTENCE:genetic interaction:GO:0000724
FT                   double-strand break repair via homologous recombination
FT                   [PMID:21135129]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0004722 protein
FT                   serine/threonine phosphatase activity [PMID:16299494]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0006470 protein
FT                   dephosphorylation [PMID:16299494]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0030289 protein
FT                   phosphatase 4 complex [PMID:16299494]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0051173 positive
FT                   regulation of nitrogen compound metabolic process
FT                   [PMID:10940301]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:0072462 signal
FT                   transduction involved in meiotic recombination checkpoint
FT                   [PMID:20951350]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:1902660 negative
FT                   regulation of glucose mediated signaling pathway
FT                   [PMID:24277933]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:2000002 negative
FT                   regulation of DNA damage checkpoint
FT                   [PMID:16299494|PMID:17517611]"
FT                   /experiment="EXISTENCE:mutant phenotype:GO:2001034 positive
FT                   regulation of double-strand break repair via nonhomologous
FT                   end joining [PMID:24498054]"
FT                   /protein_id="DAA11921.1"
FT                   /translation="MMDLDKIIASLRDGKHIPEETVFRLCLNSQELLMNEGNVTQVDTP
FT                   VTICGDIHGQLHDLLTLFEKSGGVEKTRYIFLGDFVDRGFYSLESFLLLLCYKLRYPDR
FT                   ITLIRGNHETRQITKVYGFYDEVVRKYGNSNVWRYCCEVFDYLSLGAIINNSIFCVHGG
FT                   LSPDMTTVDEIRTIDRKQEVPHEGAMCDLLWSDPEDVDTWSLSPRGAGFLFGKREVDQF
FT                   LEKNNVELIARAHQLVMEGYKEMFDGGLVTVWSAPNYCYRCGNVAAVLKIDDDLNREYT
FT                   IFEAVQAQNEVGNAIIPTKKSQMDYFL"
FT   gene            598468..599688
FT                   /gene="RAD55"
FT                   /locus_tag="YDR076W"
FT   mRNA            598468..599688
FT                   /gene="RAD55"
FT                   /locus_tag="YDR076W"
FT                   /product="putative DNA-dependent ATPase RAD55"
FT   CDS_pept        598468..599688
FT                   /codon_start=1
FT                   /gene="RAD55"
FT                   /locus_tag="YDR076W"
FT                   /product="putative DNA-dependent ATPase RAD55"
FT                   /note="Protein that stimulates strand exchange; stimulates
FT                   strand exchange by stabilizing the binding of Rad51p to
FT                   single-stranded DNA; involved in the recombinational repair
FT                   of double-strand breaks in DNA during vegetative growth and
FT                   meiosis; forms heterodimer with Rad57p"
FT                   /db_xref="GOA:P38953"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38953"
FT                   /experiment="EXISTENCE:direct assay:GO:0030491 heteroduplex
FT