(data stored in ACNUC11016 zone)

EMBL: BN000763

ID   BN000763; SV 1; linear; mRNA; STD; MAM; 1467 BP.
XX
AC   BN000763;
XX
DT   08-NOV-2005 (Rel. 85, Created)
DT   06-DEC-2005 (Rel. 86, Last updated, Version 2)
XX
DE   TPA: Canis familiaris partial mRNA for glucosamine (N-acetyl)-6-sulfatase
DE   (gns gene)
XX
KW   glucosamine (N-acetyl)-6-sulfatase; gns gene; Third Party Data; TPA;
KW   TPA:inferential.
XX
OS   Canis lupus familiaris (dog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae; Canis.
XX
RN   [1]
RP   1-1467
RA   Sardiello M.;
RT   ;
RL   Submitted (24-APR-2005) to the INSDC.
RL   Sardiello M., TIGEM, Telethon Foundation, Via Pietro Castellino 111 Naples,
RL   80131, ITALY.
XX
RN   [2]
RX   DOI; 10.1093/hmg/ddi351.
RX   PUBMED; 16174644.
RA   Sardiello M., Annunziata I., Roma G., Ballabio A.;
RT   "Sulfatases and sulfatase modifying factors: an exclusive and promiscuous
RT   relationship";
RL   Hum. Mol. Genet. 14(21):3203-3217(2005).
XX
DR   MD5; a62fac447dc0dbbffbdd7b4617228e42.
XX
AH   LOCAL_SPAN      PRIMARY_IDENTIFIER   PRIMARY_SPAN   COMP
AS   1-60            AAEX01029684.1       4829-4888
AS   61-267          AAEX01029684.1       6682-6888
AS   268-333         AAEX01029684.1       9031-9096
AS   334-432         AAEX01029684.1       9760-9858
AS   433-600         AAEX01029684.1       11399-11566
AS   601-683         AAEX01029684.1       13264-13346
AS   684-802         AAEX01029684.1       15173-15291
AS   803-906         AAEX01029684.1       16733-16836
AS   907-1008        AAEX01029684.1       24014-24115
AS   1009-1116       AAEX01029684.1       43791-43898
AS   1117-1227       AAEX01029684.1       44796-44906
AS   1228-1388       AAEX01029684.1       46308-46468
AS   1389-1467       AAEX01029684.1       49082-49160
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1467
FT                   /organism="Canis lupus familiaris"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9615"
FT   CDS_pept        <1..1467
FT                   /codon_start=1
FT                   /gene="gns"
FT                   /product="glucosamine (N-acetyl)-6-sulfatase"
FT                   /EC_number="3.1.6.14"
FT                   /db_xref="GOA:Q32KH4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012251"
FT                   /db_xref="InterPro:IPR015981"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q32KH4"
FT                   /protein_id="CAI85009.1"
FT                   /translation="TPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHV
FT                   VNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLG
FT                   WSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANISLGFLDYKSNSEPFFM
FT                   MISTPAPHSPWTAAPQYQKTFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLD
FT                   NAFRKRWQTLLSVDDLVEKLVKRLEFNGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYE
FT                   FDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYNLNKTQMDGMSLLPILKGAR
FT                   NLTWRSDVLVEYQGEGRDVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSARWN
FT                   LQYCEFDDQEVFVEVYNLTADPDQITNIAKSIDPELLGKMNYRLMMLQSCSGPTCRTPG
FT                   VFDPGYRFDPRLMFSNQGSVRTRRFSKHPL"
XX
SQ   Sequence 1467 BP; 431 A; 321 C; 327 G; 388 T; 0 other;
     acaccactaa agaaaaccaa ggctctcatt ggagaaatgg ggatgacttt ctccagtgct        60
     tatgtgccaa gtgctctttg ctgtccgagc agagccagta tcttgacagg gaagtaccca       120
     cataatcatc acgttgttaa caacacttta gagggaaact gcagtagtaa gtcttggcag       180
     aagatccaag aaccaaatac ttttccagca attctcagat cgatgtgtgg ttatcagacc       240
     ttttttgcag ggaagtactt aaatgagtat ggagccccag atgcaggtgg actagaacat       300
     gttcctctag gctggagtta ttggtatgcc ttggaaaaga attctaaata ctataattat       360
     acgctctcta tcaatgggaa ggcacggaaa catggtgaaa actacagtgt ggactacctg       420
     acagatgttc tggctaatat ctctttgggc ttcctggact acaagtccaa ctctgagccg       480
     ttcttcatga tgatctccac accagcacct cattctcctt ggacagccgc acctcagtac       540
     cagaagacct ttcagaacgt ctttgcacca agaaataaga acttcaacat ccatggaacg       600
     aacaagcact ggttaattag gcaagccaag accccaatga ctaattcttc aatacagttt       660
     ttagataatg catttaggaa aaggtggcaa actttactgt cagttgatga ccttgtggag       720
     aaactggtga agagattgga attcaatggg gaacttaaca acacatatat cttttatacg       780
     tcagacaatg gctatcacac aggacagttt tctttgccaa tagacaaaag acagctgtat       840
     gagtttgata tcaaagttcc actgctggtt cgaggacctg ggatcaaacc aaatcagaca       900
     agcaagatgc tcgttgccaa cattgacttg ggtcctacta ttttggatat tgctggatat       960
     aacctgaata agacacagat ggatgggatg tctttattgc ccattttgaa aggtgccaga      1020
     aatctgactt ggcgatcaga tgtcttggtg gaatatcaag gagaaggccg tgatgtcacc      1080
     gacccaacct gtccttccct gagtcctgga gtatctcaat gtttcccaga ctgtgtctgt      1140
     gaagatgctt acaataacac ctacgcctgc gtgaggacca tgtcagcacg gtggaattta      1200
     cagtattgtg agtttgatga ccaggaggtg tttgtagaag tctataacct gactgcagac      1260
     ccagaccaaa tcacaaacat tgctaaaagt atcgacccag agcttttagg aaaaatgaac      1320
     taccggctga tgatgttaca gtcctgttct ggaccaacct gccgcactcc aggggtgttt      1380
     gaccctggat acaggtttga ccctcgtctc atgttcagca atcagggcag tgtcaggact      1440
     cgaaggtttt caaaacaccc tctgtag                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page