(data stored in ACNUC7421 zone)

EMBL: BN001301

ID   BN001301; SV 1; linear; genomic DNA; STD; FUN; 3704807 BP.
XX
AC   BN001301;
XX
PR   Project:PRJEA40559;
XX
DT   24-SEP-2009 (Rel. 102, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   TPA: Aspergillus nidulans FGSC A4 chromosome I
XX
KW   Third Party Data; TPA; TPA:reassembly.
XX
OS   Aspergillus nidulans FGSC A4
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RG   the Eurofungbase Aspergillus nidulans re-annotation project
RA   Mabey Gilsenan J.;
RT   ;
RL   Submitted (09-SEP-2009) to the INSDC.
RL   Mabey Gilsenan J.E., School of Medicine, University of Manchester, ERC,
RL   University Hospital of South Manchester, Manchester, M23 9LT, UK
XX
RN   [2]
RP   1-3704807
RA   Russo Wortman J., Mabey Gilsenan J., Joardar V., Deegan J., Clutterbuck J.,
RA   Andersen M.R., Archer D., Bencina M., Braus G., Coutinho P., von Dohren H.,
RA   Doonan J., Driessen A.J.M., Durek P., Espeso E., Fekete E., Flipphi M.,
RA   Garcia Estrada C., Geysens S., Goldman G., de Groot P.W.J., Hansen K.,
RA   Harris S.D., Heinekamp T., Helmstaedt K., Henrissat B., Hofmann G.,
RA   Homan T., Horio T., Horiuchi H., James S., Jones M., Karaffa L.,
RA   Karanyi Z., Kato M., Keller N., Kelly D.E., Kiel J.A.K.W., Kim J-M.,
RA   van der Klei I.J., Klis F.M., Kovalchuk A., Krasevec N., Kubicek C.P.,
RA   Liu B., MacCabe A., Meyer V., Mirabito P., Miskei M., Mos M., Mullins J.,
RA   Nelson D.R., Nielsen J., Oakley B.R., Osmani S.A., Pakula T., Paszewski A.,
RA   Paulsen I., Pilsyk S., Posci I., Punt P.J., Ram A.F.J., Ren Q.,
RA   Robellet X., Robson G., Seiboth B., van Solingen P., Specht T., Sun J.,
RA   Taheri-Talesh N., Takeshita N., Ussery D., vanKuyk P.A., Visser H.,
RA   van der Vondervoot P.J.I., de Vries R.P., Walton J., Xiang X., Xiong Y.,
RA   Ping Zeng A., Brandt B.W., Cornell M.J., van den Hondel C.A.M.J.J.,
RA   Visser J., Oliver S.G., Turner G.;
RT   "The 2008 update of the Aspergillus nidulans genome annotation: A community
RT   effort";
RL   Fungal Genet. Biol. 46(1):S2-S13(2009).
XX
DR   MD5; 2c7c4bd43a4e29edff78884b4c959564.
DR   BioSample; SAMEA2272224.
DR   EnsemblGenomes-Gn; CADANIAG00006674.
DR   EnsemblGenomes-Gn; CADANIAG00007251.
DR   EnsemblGenomes-Gn; CADANIAG00007355.
DR   EnsemblGenomes-Gn; CADANIAG00007542.
DR   EnsemblGenomes-Gn; CADANIAG00010572.
DR   EnsemblGenomes-Gn; CADANIAG00010573.
DR   EnsemblGenomes-Gn; CADANIAG00010574.
DR   EnsemblGenomes-Gn; CADANIAG00010575.
DR   EnsemblGenomes-Gn; CADANIAG00010576.
DR   EnsemblGenomes-Gn; CADANIAG00010577.
DR   EnsemblGenomes-Gn; CADANIAG00010604.
DR   EnsemblGenomes-Gn; CADANIAG00010606.
DR   EnsemblGenomes-Gn; CADANIAG00010622.
DR   EnsemblGenomes-Gn; CADANIAG00010631.
DR   EnsemblGenomes-Gn; CADANIAG00010632.
DR   EnsemblGenomes-Gn; CADANIAG00010643.
DR   EnsemblGenomes-Gn; CADANIAG00010650.
DR   EnsemblGenomes-Gn; CADANIAG00010676.
DR   EnsemblGenomes-Gn; CADANIAG00010701.
DR   EnsemblGenomes-Gn; CADANIAG00010714.
DR   EnsemblGenomes-Gn; CADANIAG00010723.
DR   EnsemblGenomes-Gn; CADANIAG00010740.
DR   EnsemblGenomes-Gn; CADANIAG00010741.
DR   EnsemblGenomes-Gn; CADANIAG00010747.
DR   EnsemblGenomes-Gn; CADANIAG00010755.
DR   EnsemblGenomes-Gn; CADANIAG00010764.
DR   EnsemblGenomes-Gn; CADANIAG00010769.
DR   EnsemblGenomes-Gn; CADANIAG00010774.
DR   EnsemblGenomes-Gn; CADANIAG00010786.
DR   EnsemblGenomes-Gn; CADANIAG00010798.
DR   EnsemblGenomes-Gn; CADANIAG00010817.
DR   EnsemblGenomes-Gn; CADANIAG00010818.
DR   EnsemblGenomes-Gn; CADANIAG00010819.
DR   EnsemblGenomes-Gn; ENSRNA049496462.
DR   EnsemblGenomes-Gn; ENSRNA049496463.
DR   EnsemblGenomes-Gn; ENSRNA049496468.
DR   EnsemblGenomes-Gn; ENSRNA049496469.
DR   EnsemblGenomes-Gn; ENSRNA049496470.
DR   EnsemblGenomes-Gn; ENSRNA049496475.
DR   EnsemblGenomes-Gn; ENSRNA049496479.
DR   EnsemblGenomes-Gn; ENSRNA049496480.
DR   EnsemblGenomes-Gn; ENSRNA049523168.
DR   EnsemblGenomes-Gn; ENSRNA049523214.
DR   EnsemblGenomes-Gn; ENSRNA049523254.
DR   EnsemblGenomes-Gn; ENSRNA049523263.
DR   EnsemblGenomes-Gn; ENSRNA049523292.
DR   EnsemblGenomes-Gn; ENSRNA049523355.
DR   EnsemblGenomes-Gn; ENSRNA049523374.
DR   EnsemblGenomes-Gn; ENSRNA049523418.
DR   EnsemblGenomes-Gn; ENSRNA049523448.
DR   EnsemblGenomes-Gn; ENSRNA049523469.
DR   EnsemblGenomes-Gn; ENSRNA049523500.
DR   EnsemblGenomes-Gn; ENSRNA049523508.
DR   EnsemblGenomes-Gn; ENSRNA049523527.
DR   EnsemblGenomes-Gn; ENSRNA049523543.
DR   EnsemblGenomes-Gn; ENSRNA049523567.
DR   EnsemblGenomes-Gn; ENSRNA049523592.
DR   EnsemblGenomes-Gn; ENSRNA049523626.
DR   EnsemblGenomes-Tr; CADANIAT00006674.
DR   EnsemblGenomes-Tr; CADANIAT00007251.
DR   EnsemblGenomes-Tr; CADANIAT00007355.
DR   EnsemblGenomes-Tr; CADANIAT00007542.
DR   EnsemblGenomes-Tr; CADANIAT00010572.
DR   EnsemblGenomes-Tr; CADANIAT00010573.
DR   EnsemblGenomes-Tr; CADANIAT00010574.
DR   EnsemblGenomes-Tr; CADANIAT00010575.
DR   EnsemblGenomes-Tr; CADANIAT00010576.
DR   EnsemblGenomes-Tr; CADANIAT00010577.
DR   EnsemblGenomes-Tr; CADANIAT00010604.
DR   EnsemblGenomes-Tr; CADANIAT00010606.
DR   EnsemblGenomes-Tr; CADANIAT00010622.
DR   EnsemblGenomes-Tr; CADANIAT00010631.
DR   EnsemblGenomes-Tr; CADANIAT00010632.
DR   EnsemblGenomes-Tr; CADANIAT00010643.
DR   EnsemblGenomes-Tr; CADANIAT00010650.
DR   EnsemblGenomes-Tr; CADANIAT00010676.
DR   EnsemblGenomes-Tr; CADANIAT00010701.
DR   EnsemblGenomes-Tr; CADANIAT00010714.
DR   EnsemblGenomes-Tr; CADANIAT00010723.
DR   EnsemblGenomes-Tr; CADANIAT00010740.
DR   EnsemblGenomes-Tr; CADANIAT00010741.
DR   EnsemblGenomes-Tr; CADANIAT00010747.
DR   EnsemblGenomes-Tr; CADANIAT00010755.
DR   EnsemblGenomes-Tr; CADANIAT00010764.
DR   EnsemblGenomes-Tr; CADANIAT00010769.
DR   EnsemblGenomes-Tr; CADANIAT00010774.
DR   EnsemblGenomes-Tr; CADANIAT00010786.
DR   EnsemblGenomes-Tr; CADANIAT00010798.
DR   EnsemblGenomes-Tr; CADANIAT00010817.
DR   EnsemblGenomes-Tr; CADANIAT00010818.
DR   EnsemblGenomes-Tr; CADANIAT00010819.
DR   EuropePMC; PMC3245145; 22080563.
DR   EuropePMC; PMC3892141; 24375164.
DR   GOA; P0C1D2.
DR   InterPro; IPR010625; CHCH.
DR   InterPro; IPR039289; CHCHD4.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00004; U2.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00016; SNORD14.
DR   RFAM; RF01505; Afu_264.
DR   RFAM; RF01515; Afu_514.
DR   StrainInfo; 598196; 0.
DR   UniProtKB/Swiss-Prot; P0C1D2; MIA40_EMENI.
XX
CC   Aspergillus nidulans FGSC A4 CADRE,
CC   updated by Eurofungbase with contributions from
CC   CADRE (http://www.cadre-genomes.org.uk),
CC   AspGD (http://www.aspergillusgenome.org) and
CC     Ensembl Genomes (http://www.ensemblgenomes.org).
XX
AH   LOCAL_SPAN       PRIMARY_IDENTIFIER   PRIMARY_SPAN   COMP
AS   1-352052         AACD01000108.1       735-352786     c
AS   352053-358890    AACD01000208.1       1-6838
AS   358991-803510    AACD01000107.1       303-444822     c
AS   803511-870685    AACD01000106.1       681-67855      c
AS   870686-877350    AACD01000204.1       330-6994       c
AS   877351-1153779   AACD01000105.1       755-277183     c
AS   1153780-1159431  AACD01000207.1       1229-6880      c
AS   1159432-1455595  AACD01000104.1       1606-297769    c
AS   1455596-1522986  AACD01000103.1       1882-69272     c
AS   1522987-1654985  AACD01000102.1       645-132643     c
AS   1654986-1662472  AACD01000194.1       740-8226       c
AS   1662473-1872040  AACD01000101.1       1-209568       c
AS   1872141-2209391  AACD01000100.1       1-337251       c
AS   2209492-2211496  AACD01000099.1       1-2005         c
AS   2211597-2445546  AACD01000109.1       1-233950
AS   2445547-2449799  AACD01000234.1       1-4253         c
AS   2449800-2746834  AACD01000110.1       1211-298245
AS   2746835-2807881  AACD01000111.1       1372-62418
AS   2807982-3161705  AACD01000112.1       1-353724
AS   3161806-3477871  AACD01000113.1       1-316066
AS   3477872-3481868  AACD01000237.1       1-3997         c
AS   3481869-3507262  AACD01000114.1       543-25936
AS   3507263-3515692  AACD01000187.1       1-8430         c
AS   3515693-3640436  AACD01000115.1       2577-127320
AS   3640437-3650266  AACD01000181.1       831-10660
AS   3650267-3704807  AACD01000116.1       2262-56802
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3704807
FT                   /organism="Aspergillus nidulans FGSC A4"
FT                   /chromosome="I"
FT                   /strain="FGSC A4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:227321"
FT   misc_feature    1..352052
FT                   /note="contig 1.108 735..352786(-1)"
FT   gene            1883..4080
FT                   /locus_tag="ANIA_10814"
FT                   /old_locus_tag="AN10814.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1883..1924,1976..1986,2041..2133,2186..2347,
FT                   2409..2756,2833..2873,2931..2995,3065..3087,3140..3268,
FT                   3312..4080)
FT                   /locus_tag="ANIA_10814"
FT                   /old_locus_tag="AN10814.4"
FT                   /note="transcript_id=CADANIAT00006475"
FT   CDS_pept        join(1883..1924,1976..1986,2041..2133,2186..2347,
FT                   2409..2756,2833..2873,2931..2995,3065..3087,3140..3268,
FT                   3312..4080)
FT                   /locus_tag="ANIA_10814"
FT                   /old_locus_tag="AN10814.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006475"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006475"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006475"
FT                   /db_xref="GOA:C8V036"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038220"
FT                   /db_xref="UniProtKB/TrEMBL:C8V036"
FT                   /protein_id="CBF69357.1"
FT                   /translation="MRSESSTDVLIVGAGPAGLTTALWLAHTGVQFRIIDKRPNIPRRG
FT                   QADGLSPRTMEILETFEVAHEVTRLWERATDEMLWCRDAQGNLTRMERFRNQPPQGVRW
FT                   GHGTLQQGVVEEIMKKKITEVCGVEVEYETTLFELSLDTTKANDPEAFPWSATVRYGTD
FT                   EPAGQMLSKTMLAKYVVGADGGRSFVRQTMGIEMQGTKGEAVWGVMDIIGTSDFPDDID
FT                   GAVDFVRREKDRDAITPESIIVKCEYIIRPYKLYIKEHVWWSAFTVAQRISNSMAVHNR
FT                   GFLVGDAVHTHSPLCGAGMNTAVQLHRDAYNLGWKLAGVLKHQLNPEILQTYGAERRPV
FT                   AEALLDADKTILALFHAPLGPEAEALLAKADHIQAYLSGRGIQYRASLLTHGSAEGLRS
FT                   LAVLPGHCIPDITVQNYMTGRASNLHSWIMADGGWSVIFWASDLSCASRVENIHNCCKQ
FT                   VESIRAKTSSKVGYMLDAFLIHCNEWPSVDLAALPGLFLPPSKYGCLDYGKIFVREETA
FT                   SCKSERMNNLGGIAVVRPDKYVGWVGGLDDMVGLGLYFSKIFL"
FT   gene            4351..5615
FT                   /locus_tag="ANIA_10821"
FT                   /old_locus_tag="AN10821.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(4351..4490,4542..4667,4720..4842,4895..5615)
FT                   /locus_tag="ANIA_10821"
FT                   /old_locus_tag="AN10821.4"
FT                   /note="transcript_id=CADANIAT00006476"
FT   CDS_pept        join(4351..4490,4542..4667,4720..4842,4895..5615)
FT                   /locus_tag="ANIA_10821"
FT                   /old_locus_tag="AN10821.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006476"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006476"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006476"
FT                   /db_xref="GOA:C8V037"
FT                   /db_xref="InterPro:IPR002227"
FT                   /db_xref="InterPro:IPR008922"
FT                   /db_xref="UniProtKB/TrEMBL:C8V037"
FT                   /protein_id="CBF69359.1"
FT                   /translation="MKFSWLLWFFGLWDQEGTHQVSLKVQDENRKGHHRCTPDVRSVRR
FT                   EWGMLSESERFDYIDALHCMQSKPPILPRDQYPGVRHRMDDFSATHINYTLNIHLSGIF
FT                   FGWHRHFVYLWEKALQEECGYRGDQPYWDWALSADNISASPIFDGSPTSLSGDGDPIPQ
FT                   DPFFKLVPTNITIPNGSGGGCVTNGPFANMTLNLPDLTFAGDAEFPASAFNYSPHCFTR
FT                   NLNSHMAQLFTSQRDVDRLLNSHSITELQINIDFSDWPELRKAGIMGPHAVAHMQLGRT
FT                   MDDFWTAPQDPSFFLHHAQVDRVWTLWQSKDPKRRRWALNGTSSIHNAPTTPEVNLDTE
FT                   LPFGWLDQSRTLREVMSTEDYHLCYKYGS"
FT   gene            6073..8131
FT                   /locus_tag="ANIA_06485"
FT                   /old_locus_tag="AN6485.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            join(6073..6271,6327..6390,6447..6708,6785..6899,
FT                   6967..7061,7112..7441,7514..7624,7683..7843,7906..8131)
FT                   /locus_tag="ANIA_06485"
FT                   /old_locus_tag="AN6485.4"
FT                   /note="transcript_id=CADANIAT00006477"
FT   CDS_pept        join(6073..6271,6327..6390,6447..6708,6785..6899,
FT                   6967..7061,7112..7441,7514..7624,7683..7843,7906..8131)
FT                   /locus_tag="ANIA_06485"
FT                   /old_locus_tag="AN6485.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006477"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006477"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006477"
FT                   /db_xref="GOA:Q5AYZ5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AYZ5"
FT                   /protein_id="CBF69360.1"
FT                   /translation="MNYVAYIPLLAIALLAWVIIRRLLFNPLLGIPGPWTARIFGFYEF
FT                   YHNIWRDGEWCKTFPELHKRYSSPVVRIGPNHVHINNIEAYEHIFRLGTDFYKDESFYT
FT                   CADNHGSVFSLSDRDDHRERRKVLAPRFSKQAAELAAPKIQARLQDLVQFMVKQSRKGE
FT                   GCNITDLFRAVAINWVADVFLGDCGDWVNYEARKLDMLEDIDGLSALIPTLRFFPYLAT
FT                   LNSLLPSSVVNYLTPSAVAGFKKICKDHTRPLLNTPTKEMARRTEASVAELLIFHRLEN
FT                   TGKPPTLDYLAEEAFAFIDAGVDTTGGTLVTALYHVLKSPEILRKLRKELDEAMRRQAK
FT                   STDIDPRKLGELPYLNAIIKESHRIWPAIPGPLPRVVPPAGINIGSYFIPGGTTVSATH
FT                   HSLHYNETIFPEPHKFNPERWLKEEKSEGGRYLNPYSRGTRACIGINLAQIQLRLTLTH
FT                   LFGQYELELCDPVPSRHEWKDHFVAHPKEPIFVKFRERKGQVESVVQSGDEEGRGCKTN
FT                   FVM"
FT   gene            complement(8579..10058)
FT                   /locus_tag="ANIA_06484"
FT                   /old_locus_tag="AN6484.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(8579..8642,8724..8729,8842..8962,
FT                   9138..9418,9493..9566,9626..9825,9887..10058))
FT                   /locus_tag="ANIA_06484"
FT                   /old_locus_tag="AN6484.4"
FT                   /note="transcript_id=CADANIAT00006478"
FT   CDS_pept        complement(join(8579..8642,8724..8729,8842..8962,
FT                   9138..9418,9493..9566,9626..9825,9887..10058))
FT                   /locus_tag="ANIA_06484"
FT                   /old_locus_tag="AN6484.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006478"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006478"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006478"
FT                   /db_xref="GOA:Q5AYZ6"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AYZ6"
FT                   /protein_id="CBF69362.1"
FT                   /translation="MADYNPTPSYPQPQRLTGALSQFKYIESTPALGREYMDLQLSSIL
FT                   ENDEMVRDLAITASERGVLLFNDQNITPFELKRLLVKLGKLTGNPPEAGLHRSAFPSQI
FT                   HSHLDIPEVEDPDIFIISSVTQKKSLADALPTGGRKFASWGWHTDESYEKYPPAYTGFK
FT                   IAKSPPTGGDTLFVSSYGLYEHLSEPWQKFADGLTATHSAKEFLRFMEKGMTLDGELQR
FT                   GHPENVGLEFRASQYASPLALYTNCSFNPADMRTVLRMITDSSDLQTRKRWNDNGVAIW
FT                   DKLRYWREALLRPEFCLQGRVSSQ"
FT   gene            10377..11942
FT                   /locus_tag="ANIA_10813"
FT                   /old_locus_tag="AN10813.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(10377..11796,11887..11942)
FT                   /locus_tag="ANIA_10813"
FT                   /old_locus_tag="AN10813.4"
FT                   /note="transcript_id=CADANIAT00006479"
FT   CDS_pept        join(10377..11796,11887..11942)
FT                   /locus_tag="ANIA_10813"
FT                   /old_locus_tag="AN10813.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006479"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006479"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006479"
FT                   /db_xref="GOA:C8V040"
FT                   /db_xref="InterPro:IPR003480"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:C8V040"
FT                   /protein_id="CBF69364.1"
FT                   /translation="MSAVPPFQPFELTAADYSLPMLYAGNAIFFRLHDPEQGVPVLQEA
FT                   IKQVVEHIPFLAGVVMPTDGKCGTMGIRPASNYDLAQRTPLCTVKQLTHLRLPSCLMPA
FT                   SGQANTGTEVYYDRNASLVLAPIHVAAQRAHRPVIRFQINVLADGIILNLFSNHMVIDG
FT                   SGVSLLVEAIAVCCRTGAACQPPPDLAAAMDREIITRAFLATISSAEPAAAARASRVDV
FT                   EEMDVELLHDATLHDCVFSLSTAKVNHLRQAALQQLQERYHSVFPPVSADDIVTAILSL
FT                   CFARFRSRSVSTGNVVPFTVQRMVDVRRRLQPPIPSRYIGNCFVMLDQKLDLYIPEANK
FT                   TPESFTYLIAEIACALRSNLNKVDDRFVRDHMARHPVFTAAMSISEEPDISVTSLRRLP
FT                   IYEQNFGPVLGSVLHFQLIPYMNPERVCTLNPCRVSDETWEVGVTLKKEEMELLRDDSV
FT                   FRWVVEREEYLRFFDTPLGGGKFLRGISSSPIE"
FT   gene            12076..13418
FT                   /locus_tag="ANIA_10820"
FT                   /old_locus_tag="AN10820.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(12076..12115,12184..13418)
FT                   /locus_tag="ANIA_10820"
FT                   /old_locus_tag="AN10820.4"
FT                   /note="transcript_id=CADANIAT00006480"
FT   CDS_pept        join(12076..12115,12184..13418)
FT                   /locus_tag="ANIA_10820"
FT                   /old_locus_tag="AN10820.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006480"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006480"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006480"
FT                   /db_xref="GOA:C8V041"
FT                   /db_xref="InterPro:IPR005018"
FT                   /db_xref="InterPro:IPR006593"
FT                   /db_xref="InterPro:IPR015920"
FT                   /db_xref="InterPro:IPR038697"
FT                   /db_xref="UniProtKB/TrEMBL:C8V041"
FT                   /protein_id="CBF69366.1"
FT                   /translation="MKPHKLLPWVSALVPSTTARTASFHPPHRADITFSISVPSSSNPS
FT                   SLLFRIQAQKSIEWIALAQGTHMANANMFLVYASQSDPSNITVSPRAAPGHVPPRYNHN
FT                   ARVALLSHSGIDIVTGDITAEIECFTCLKGYGGFMDPDGAETRWVWAFKEINEEDEETR
FT                   LRSDDVTARIAFHDEFGRVIVDLSRARTDSSSKDLFSDPDFDAVHPVDQTGDDSNSKYD
FT                   MAIAHGVLMSLAFFFLFPSFALSVPLGYPLMKIHAPLQGVTLGIALLGAVLGFKIWNSA
FT                   GRNMHPHPILGLILISIILLIQPMLGYFQHVHFLRVGGKSYFAYMHRWLGRVGILLGVV
FT                   NGIWGFAWVGAADRGAGWWHTAMVWYLVVAGVGLVAYVSVRGWLVLVLERKRKGVLADI
FT                   QRRVDGGYRDLDEDEDEDVGEIVVR"
FT   gene            15221..16233
FT                   /locus_tag="ANIA_06482"
FT                   /old_locus_tag="AN6482.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(15221..15424,15529..16233)
FT                   /locus_tag="ANIA_06482"
FT                   /old_locus_tag="AN6482.4"
FT                   /note="transcript_id=CADANIAT00006481"
FT   CDS_pept        join(15221..15424,15529..16233)
FT                   /locus_tag="ANIA_06482"
FT                   /old_locus_tag="AN6482.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006481"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006481"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006481"
FT                   /db_xref="GOA:Q5AYZ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AYZ8"
FT                   /protein_id="CBF69368.1"
FT                   /translation="MPLEILEGEAPPPPPLGSLPLEKYILSQWDSVRPAPAGAYPAPIS
FT                   ETPSERRTRLIRQFLELGSQGREPYNTQSQSEKESRPTLAQIDTILRPLRPEQLRPYAD
FT                   YTGSLDEGLYLRLCYDDSKEEAHKAVWAGNLDVAFVGPDGIILDDREIFGQCSSFSDAL
FT                   GVFPERVTNGGGVGHVQARERALREALSQEQGEEDEGQGDEGEGGNLVRYAAYHAACVV
FT                   THLFVEDEEALNGTGLLHIFLDDCGNVVRQWRTDNEGGDYDFDGTWKEGVWREDFYAGR
FT                   GELGPAYRAGGIRGPPYSVLG"
FT   gene            complement(16398..18782)
FT                   /locus_tag="ANIA_06481"
FT                   /old_locus_tag="AN6481.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(16398..16529,16598..16741,16806..16978,
FT                   17164..17384,17442..17499,17637..17698,17765..18356,
FT                   18456..18782))
FT                   /locus_tag="ANIA_06481"
FT                   /old_locus_tag="AN6481.4"
FT                   /note="transcript_id=CADANIAT00006482"
FT   CDS_pept        complement(join(16735..16741,16806..16978,17164..17384,
FT                   17442..17499,17637..17698,17765..18356,18456..18782))
FT                   /locus_tag="ANIA_06481"
FT                   /old_locus_tag="AN6481.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006482"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006482"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006482"
FT                   /db_xref="GOA:C8V043"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C8V043"
FT                   /protein_id="CBF69369.1"
FT                   /translation="MRNVGRLGIPSDHYSDSESETEEITITPHLLPYDPSPGIDSLFAR
FT                   LDQARDECCAMFRSNEDEDSSAAVSGLGLIVTRMMESVLKGHSTCKEMPDLNIGEVYAT
FT                   YTNALQLEARNHPSKNLLLDINLLREELETIIANIVEQLKLITGLRDDSSGQAADEGLL
FT                   FIDTENINFELLFTSSSPSPSPSTLNGTASNNEDIAQIDLPSRAILQAIHAELHEQEEV
FT                   FTELIKRANILERQIVQRVDIIQEDHGKAILVFTIVSVIFLPLSFVSSYLGMNTADIRD
FT                   MKLNQALFWQVALPVTVVVVALVLVEWKSLIQDAKKRSTSTSQSVRTANGQLHASVVAD
FT                   SRGICNGILSTLYTNVAYFDQDSGSMTEDWKLWSKRILKSQPSDERWTPGRREGDPNAS
FT                   VFGRLARYPHAVPHSEGIDETGSMALNNFELGTTTGTTALHVFCAVNLFNQPDIYHFGT
FT                   YNWVLLRHEQGAEQDVAEYWF"
FT   gene            complement(18985..20040)
FT                   /locus_tag="ANIA_06480"
FT                   /old_locus_tag="AN6480.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(18985..20040)
FT                   /locus_tag="ANIA_06480"
FT                   /old_locus_tag="AN6480.4"
FT                   /note="transcript_id=CADANIAT00006483"
FT   CDS_pept        complement(18985..20040)
FT                   /locus_tag="ANIA_06480"
FT                   /old_locus_tag="AN6480.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006483"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006483"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006483"
FT                   /db_xref="GOA:Q5AZ00"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ00"
FT                   /protein_id="CBF69371.1"
FT                   /translation="MATDSKIDHIAPLEYQMKILEEYHINVLAIPLDMVLRHVRSIREG
FT                   LAGVDSRAIPRSMVDAFIQIVVLFVEAASERERIVAGIERLLEGSGGRTVDSASLEMND
FT                   LETLKEGPEGRDWHPDSLEENPGSSDAKNPESLGKSARVLEKSLEDPEWEYDSVDQSTR
FT                   DPTNRLDRTEEGSESLEGNLDRPGKIIESPDAKNPDSLEKRPNSLEGRLRGLEKKSGTL
FT                   LESSRSPETNPENMKGPSPAASSPSPNTRSSSTDRSTDWLREWLLHRSRNSLQDNQEDN
FT                   LVNRTNGSSQNSPGNRSEYTITESMMEIINQIEIQRKVQSKVQVNVQIKIPLRGFLMVH
FT                   TKKQSERQVKV"
FT   gene            complement(20196..22128)
FT                   /locus_tag="ANIA_06479"
FT                   /old_locus_tag="AN6479.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(20196..21173,21238..22128))
FT                   /locus_tag="ANIA_06479"
FT                   /old_locus_tag="AN6479.4"
FT                   /note="transcript_id=CADANIAT00006484"
FT   CDS_pept        complement(join(20196..21173,21238..22128))
FT                   /locus_tag="ANIA_06479"
FT                   /old_locus_tag="AN6479.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006484"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006484"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006484"
FT                   /db_xref="GOA:Q5AZ01"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ01"
FT                   /protein_id="CBF69373.1"
FT                   /translation="MSPQCPVPRYLNQNQDSKIELVVPGDYPGNSPKESLISVEATARL
FT                   PLPENDPSGSVDELPGLLLGVKSIDTTTKIEPPEQLRLLHVSNNDYGMEFSAFLGRALE
FT                   AYGLTEPHTQKTIFKFFDRFLELSEQSAFRGGRFSPVPASTKVRLPARNGSKEEEVRVT
FT                   FIAIPYFLLHDAQRPPQRAIMSRNKVHWVQPLVQSGYHLDSSMMREDQQAIRRLYRHIK
FT                   QVIHVPQLWVLSIGHNFVATCAPTPLFDGQRSPSASPCIALRAIGEQTAFPPTVRITTP
FT                   WGFVFCLELRKCGVWSGFLYQVQVMLSSVAPENTSIDTRNWVYSLEVDGSTIDARRWRS
FT                   LWEAHGDNNPLLAIIASPPPEHIPRRKEPTEPTTSPSSLSAETPEPRYPSGISDTLKKL
FT                   DERMREHRERRSRTIATTQSKYAGDDDADGLRNPFSRRFPSSVKHRVRRYRSAGFRNYD
FT                   NDHPYQYIDPYYFPPQFVLDAIRNQFKAEKEDGESHGLAQGASGAVGVAQADGPGPGAQ
FT                   SATKRDKKQEQEKPLPVFKWSIGKKASEEASSNSDEAESTRRMESLLAYIHRHMLFHTN
FT                   NKKSSSYFPQTTKASTKVLNRTYNAIPLKTRSIVDSQLLHLRDTYT"
FT   gene            22401..23183
FT                   /locus_tag="ANIA_06478"
FT                   /old_locus_tag="AN6478.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(22401..22570,22655..22694,22845..23183)
FT                   /locus_tag="ANIA_06478"
FT                   /old_locus_tag="AN6478.4"
FT                   /note="transcript_id=CADANIAT00006485"
FT   CDS_pept        join(22401..22570,22655..22694,22845..23183)
FT                   /locus_tag="ANIA_06478"
FT                   /old_locus_tag="AN6478.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006485"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006485"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006485"
FT                   /db_xref="GOA:Q5AZ02"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ02"
FT                   /protein_id="CBF69375.1"
FT                   /translation="MSTTSSSSSSSSSSEQDPLRDAVVKEFTEAGYTNEEIQTVLTQQD
FT                   ALRRIKDDDADSILDAYHLPWQLDEADEEYILIKKEVSTELLDEIFEHTRRAQEDSYNI
FT                   RSSNPSGGRYGWPSSRRTPHASYSPRAGHVQRASYTKLSNMRRTELAVYDNAYGYGGHA
FT                   VPIDRPSRSAARMDRIYTA"
FT   gene            complement(23835..24147)
FT                   /locus_tag="ANIA_11518"
FT                   /old_locus_tag="AN11518.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(23835..23965,24102..24147))
FT                   /locus_tag="ANIA_11518"
FT                   /old_locus_tag="AN11518.4"
FT                   /note="transcript_id=CADANIAT00006486"
FT   CDS_pept        complement(join(23835..23965,24102..24147))
FT                   /locus_tag="ANIA_11518"
FT                   /old_locus_tag="AN11518.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006486"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006486"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006486"
FT                   /db_xref="GOA:C8V047"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8V047"
FT                   /protein_id="CBF69377.1"
FT                   /translation="MPAILHMSTGVLDYGTVRSRCGVDNTCIGVMGTSAGGGLAASAAL
FT                   MARDRWQKTPLAE"
FT   gene            complement(24753..26659)
FT                   /locus_tag="ANIA_06477"
FT                   /old_locus_tag="AN6477.4"
FT                   /product="MFS multidrug transporter, putative
FT                   (AFU_orthologue; AFUA_1G01930)"
FT   mRNA            complement(join(24753..25367,25432..26007,26084..26659))
FT                   /locus_tag="ANIA_06477"
FT                   /old_locus_tag="AN6477.4"
FT                   /note="transcript_id=CADANIAT00006487"
FT   CDS_pept        complement(join(24753..25367,25432..26007,26084..26524))
FT                   /locus_tag="ANIA_06477"
FT                   /old_locus_tag="AN6477.4"
FT                   /product="MFS multidrug transporter, putative
FT                   (AFU_orthologue; AFUA_1G01930)"
FT                   /note="transcript_id=CADANIAT00006487"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006487"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006487"
FT                   /db_xref="GOA:Q5AZ03"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ03"
FT                   /protein_id="CBF69379.1"
FT                   /translation="MRPAKHSAQVSSSRTTGSDRSSITIIPQGPDELNKQASNANNSQQ
FT                   EQHDLEKQDSREMSMPTQVTFPESDLSQGIVGWDSQDDPSNPQNFPARKKWGLLALISA
FT                   FTLISPLASSMFSPAISYMAADFGETNETILSFTVSVYLMGYTFGPCILAPLSEIYGRR
FT                   VTLSGANWFFVVWQVGCALAQNIETEIVCRFFAGIGGSGCITLGAGVIADLFPVEQRGK
FT                   ATAVWGLGPLIGPVAGPIAGGFIGENVGWRWTFWTLLIAGGTVALGIEFLNKETFAPVL
FT                   IKWKTTKLAQETGRADLRSAYDLERESLSVGQALKLGLKRPVLLLVKSPIVFLLSVYMA
FT                   FIYGLLYLFFTTISSVFTSNYGFSTGLSGLAYLGIGIGFIVGICFMAVTNDRMLVKLTA
FT                   RAGGKFEPEMRLPLMIIFSSILPISFFWYGWSADKHVHWIVPIIGMFPFGVGMIGVYMP
FT                   IQTYIIDCYPKYAASANATMTATRSLVGALLPLAGPTMFRSLGLGWGNSLLGFLALAFV
FT                   PVPILFTRYGKVLRDKWPVTLEGKKT"
FT   gene            28917..29166
FT                   /locus_tag="ANIA_11517"
FT                   /old_locus_tag="AN11517.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(28917..28975,29018..29033,29068..29166)
FT                   /locus_tag="ANIA_11517"
FT                   /old_locus_tag="AN11517.4"
FT                   /note="transcript_id=CADANIAT00006488"
FT   CDS_pept        join(28917..28975,29018..29033,29068..29166)
FT                   /locus_tag="ANIA_11517"
FT                   /old_locus_tag="AN11517.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006488"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006488"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006488"
FT                   /db_xref="UniProtKB/TrEMBL:C8V049"
FT                   /protein_id="CBF69381.1"
FT                   /translation="MLIFLPSSYIAYEYCDTYALVNMNLLFKKLGRGYEEVMLADDSQA
FT                   GILGQFRALLSA"
FT   gene            30914..31619
FT                   /locus_tag="ANIA_06476"
FT                   /old_locus_tag="AN6476.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(30914..31248,31316..31395,31446..31619)
FT                   /locus_tag="ANIA_06476"
FT                   /old_locus_tag="AN6476.4"
FT                   /note="transcript_id=CADANIAT00006489"
FT   CDS_pept        join(30944..31248,31316..31395,31446..31465)
FT                   /locus_tag="ANIA_06476"
FT                   /old_locus_tag="AN6476.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006489"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006489"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006489"
FT                   /db_xref="GOA:Q5AZ04"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ04"
FT                   /protein_id="CBF69383.1"
FT                   /translation="MKFQLLSLAALFSVALAAPTAETSAELNVADFATPVEARDISPEA
FT                   LGLVKRAVRCYIVNSSSGTVNCRSGPGFDYGVVGSVTVGYSYPFNCYKSGDCYEGNCTW
FT                   DQVPLSGGGVCYVNGYYTDSKCTVAALGKC"
FT   gene            32384..32648
FT                   /locus_tag="ANIA_11516"
FT                   /old_locus_tag="AN11516.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(32384..32585,32620..32648)
FT                   /locus_tag="ANIA_11516"
FT                   /old_locus_tag="AN11516.4"
FT                   /note="transcript_id=CADANIAT00006490"
FT   CDS_pept        join(32384..32585,32620..32648)
FT                   /locus_tag="ANIA_11516"
FT                   /old_locus_tag="AN11516.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006490"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006490"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006490"
FT                   /db_xref="UniProtKB/TrEMBL:C8V051"
FT                   /protein_id="CBF69385.1"
FT                   /translation="MIIVVLIHKGPVEKIQNLSYPETLDISVFTTTSERKEFATKASQF
FT                   AVINIGPHKRVLAAPGKNETHSNERDPSYFK"
FT   gene            33757..36522
FT                   /locus_tag="ANIA_06475"
FT                   /old_locus_tag="AN6475.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(33757..33830,34868..34970,35073..35090,35141..35281,
FT                   35365..35381,35428..35469,35526..35570,35621..35632,
FT                   35774..35861,35967..35979,36146..36184,36235..36315,
FT                   36368..36381,36481..36522)
FT                   /locus_tag="ANIA_06475"
FT                   /old_locus_tag="AN6475.4"
FT                   /note="transcript_id=CADANIAT00006491"
FT   CDS_pept        join(33757..33830,34868..34970,35073..35090,35141..35281,
FT                   35365..35381,35428..35469,35526..35570,35621..35632,
FT                   35774..35861,35967..35979,36146..36184,36235..36315,
FT                   36368..36381,36481..36522)
FT                   /locus_tag="ANIA_06475"
FT                   /old_locus_tag="AN6475.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006491"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006491"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006491"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ05"
FT                   /protein_id="CBF69387.1"
FT                   /translation="MGHWRVTFGGFWLRVLSVDEARRFSMPSIRDNNLRKSPEYCHYLE
FT                   AVKDRELMLPDFKIGCLKYTVPSANRNILVKYLKDKNSYGMEFTLHNGPPTIKELMEAK
FT                   GKSYLDYLKHKQAATKSKDHNTKGVKNFNEGEAGNDQDNGKGLSSGPSAMRVARQLNQL
FT                   VRKELYPTRPVATQRAKAKGANMDNAKETSNKESILNKENKYKNKEEKAAEPEEVQGDD
FT                   RYISEYLLQLTWISETLALI"
FT   gene            complement(36896..38707)
FT                   /locus_tag="ANIA_06474"
FT                   /old_locus_tag="AN6474.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(36896..36924,37343..37422,37877..37946,
FT                   38127..38204,38247..38346,38395..38412,38555..38571,
FT                   38632..38707))
FT                   /locus_tag="ANIA_06474"
FT                   /old_locus_tag="AN6474.4"
FT                   /note="transcript_id=CADANIAT00006492"
FT   CDS_pept        complement(join(36896..36924,37343..37422,37877..37946,
FT                   38127..38204,38247..38346,38395..38412,38555..38571,
FT                   38632..38707))
FT                   /locus_tag="ANIA_06474"
FT                   /old_locus_tag="AN6474.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006492"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006492"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006492"
FT                   /db_xref="GOA:Q5AZ06"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ06"
FT                   /protein_id="CBF69388.1"
FT                   /translation="MSFKRVHEGRFNKVIFAVFLEDHGKVITLLHIKDRGTLGLGKCLQ
FT                   ELDPEHHEPDWQLERILIFCQVYFIFLFKAMISLLYAPTRAQYMDILEQLLGKQTHQKL
FT                   YAFSRKHLPILKAVTRSPSLAQIASQNYRNQQASHEQHILDLLQSFSTVSC"
FT   gene            complement(39584..40597)
FT                   /locus_tag="ANIA_11515"
FT                   /old_locus_tag="AN11515.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(39584..39609,39884..39885,39967..39977,
FT                   40357..40395,40550..40597))
FT                   /locus_tag="ANIA_11515"
FT                   /old_locus_tag="AN11515.4"
FT                   /note="transcript_id=CADANIAT00006493"
FT   CDS_pept        complement(join(39584..39609,39884..39885,39967..39977,
FT                   40357..40395,40550..40597))
FT                   /locus_tag="ANIA_11515"
FT                   /old_locus_tag="AN11515.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006493"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006493"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006493"
FT                   /db_xref="UniProtKB/TrEMBL:C8V054"
FT                   /protein_id="CBF69390.1"
FT                   /translation="MSTTLQIPGAIDVPEQNSYTYIVLLDPNQTFLCSSLGLVLD"
FT   gene            41137..43698
FT                   /locus_tag="ANIA_06473"
FT                   /old_locus_tag="AN6473.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(41137..41196,41257..42182,42500..42678,42745..42917,
FT                   42985..43627,43673..43698)
FT                   /locus_tag="ANIA_06473"
FT                   /old_locus_tag="AN6473.4"
FT                   /note="transcript_id=CADANIAT00006494"
FT   CDS_pept        join(41137..41196,41257..42182,42500..42678,42745..42917,
FT                   42985..43627,43673..43698)
FT                   /locus_tag="ANIA_06473"
FT                   /old_locus_tag="AN6473.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006494"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006494"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006494"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ07"
FT                   /protein_id="CBF69392.1"
FT                   /translation="MKVSVLVKLGALARLTTASLLTRQSQCSGEPATLTLSDPPYQNFF
FT                   YSDCNTAAQLVVTSPLPDSDLEIIGPRLIVAWPAGNSGVCAFFAPQNGVNGSLSISLVN
FT                   STAGPPLTAIHTEPPENSATDLPIVGVQGIVRFNASAVLTVPILGSIRTIRDFVEGPSL
FT                   LYPEVQDAIMFGTTPDGGVTLERLWLDNVTTTSLNFVPMNSSYSQVSIAGRTVTFTPGD
FT                   YMFSASYNYPQLTQLKPSAVLANKSADLITEYPTQTTALSFLSYSEKLLAGAWRFLTYF
FT                   GRDSMISALLLDPILSSGEDSAMEAVIGSVLERINRTDGSACHEETIGIPAGSVDALNQ
FT                   NITYGELAFRNAQRVLRLAAPFVKNPVKENLIHLKPNEVVGQWRDSTYGLGGGRIPYDV
FT                   NTALVPAALRAISALAREGVFTTDKRWATLADRYAKVWEDETLSFFEVTIPKETAKSLV
FT                   QSYTNRTRFEGPSHANSIDDDIHFHAVALDGNNNLSHVEVMNTDDCFRHFLLNTTNQAQ
FT                   LTAFVNQTANNIRRTFPAGLMTGVGLVVANPAYGSDPVYARNFTNGAYHGTVVWSWQLA
FT                   MMARGLEQQLGRCIDSKEAAVPQFCKDDTVYTNVQLAYNLLWDNLEANSAQLSSEVWSW
FT                   VFRDGRFIPTPLGVLPAPPGVGGQTGGSNDTIF"
FT   gene            47156..48424
FT                   /locus_tag="ANIA_06472"
FT                   /old_locus_tag="AN6472.4"
FT                   /product="putative endo mannanase, GH76 family (Eurofung)"
FT   mRNA            join(47156..47656,47768..48424)
FT                   /locus_tag="ANIA_06472"
FT                   /old_locus_tag="AN6472.4"
FT                   /note="transcript_id=CADANIAT00006495"
FT   CDS_pept        join(47156..47656,47768..48424)
FT                   /locus_tag="ANIA_06472"
FT                   /old_locus_tag="AN6472.4"
FT                   /product="putative endo mannanase, GH76 family (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006495"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006495"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006495"
FT                   /db_xref="GOA:Q5AZ08"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ08"
FT                   /protein_id="CBF69394.1"
FT                   /translation="MLLSIISFTTLALPRAAAASPETAASRAITATEALQTWYNRTTGI
FT                   WDTCGWWNGANCMTTLADLATLKLNDSVDGLAKDVFQNTFSVAPNSNPYPERGIDADYT
FT                   TANGTSYSQTLDKKVPTGAANASLWLDGSYDDDAWWGLAWVAAYDATGQTDYLDLAEGI
FT                   FYHLCGNGGIDSDYTHVYVGAVANELYLALAAQLANRASDSEYYLGWAKRQWSWFRDSG
FT                   LINENYTINDGLTNDCANNGATAWTYNQGIILGGLVELNRAVDNETSSNSTYLQEAHKI
FT                   AMSAIAALTDDYHVLHEPCEPDNCGGDQTQFKGIFMRNLRLLHEVTPNDTYAQVVNASA
FT                   QSLWANDRTDENQFGIDWSGPVDSGKVDASTQSSALDALVAAIWE"
FT   gene            complement(49804..50534)
FT                   /locus_tag="ANIA_06471"
FT                   /old_locus_tag="AN6471.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(49804..50158,50217..50353,50418..50534))
FT                   /locus_tag="ANIA_06471"
FT                   /old_locus_tag="AN6471.4"
FT                   /note="transcript_id=CADANIAT00006496"
FT   CDS_pept        complement(join(49804..50158,50217..50353,50418..50534))
FT                   /locus_tag="ANIA_06471"
FT                   /old_locus_tag="AN6471.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006496"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006496"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006496"
FT                   /db_xref="GOA:Q5AZ09"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ09"
FT                   /protein_id="CBF69396.1"
FT                   /translation="MKSFLLPALASLACAGSTITSMFLPGFSKESIVASVAGNDDTATT
FT                   YSMTCAASYDNEEECGMGNGLTVVKAGKAMTYMMDEGDAYSFSGECTVDGTTAACTGSA
FT                   TGSGDGLPASQTYKTYAQYVPVTITAGSITDATAALTATSMAEGTGTAAQASPTASEAA
FT                   EETADGSGAEATPTGAAAQITGAGSILFGGAVVLMAAAL"
FT   gene            complement(51786..52575)
FT                   /locus_tag="ANIA_06470"
FT                   /old_locus_tag="AN6470.4"
FT                   /product="N,O-diacetylmuramidasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5AZ10]"
FT   mRNA            complement(join(51786..52344,52406..52575))
FT                   /locus_tag="ANIA_06470"
FT                   /old_locus_tag="AN6470.4"
FT                   /note="transcript_id=CADANIAT00006497"
FT   CDS_pept        complement(join(51829..52344,52406..52540))
FT                   /locus_tag="ANIA_06470"
FT                   /old_locus_tag="AN6470.4"
FT                   /product="N,O-diacetylmuramidasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5AZ10]"
FT                   /note="transcript_id=CADANIAT00006497"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006497"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006497"
FT                   /db_xref="GOA:Q5AZ10"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR008270"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ10"
FT                   /protein_id="CBF69397.1"
FT                   /translation="MKGISLLALPGLAYAAVQGFDISNWQPTVDYKGAYASGARFVMIK
FT                   ATEGTSFIDPLFNTHYPGATSAGLIRGGYHFAHPDSSSGSAQAKYFLAHGGGWSGDGIT
FT                   LPGMLDLEAGCYGLSATAMVSWISDFGETYKSATGRYPMIYTTTSWWQECTGNNDGFGE
FT                   YPLVLARWASTPGTLPASWDYYSFWQNSDSYAYGGDSQLWNGSEERLRIFASG"
FT   gene            complement(53159..53451)
FT                   /locus_tag="ANIA_11514"
FT                   /old_locus_tag="AN11514.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(53159..53257,53338..53451))
FT                   /locus_tag="ANIA_11514"
FT                   /old_locus_tag="AN11514.4"
FT                   /note="transcript_id=CADANIAT00006498"
FT   CDS_pept        complement(join(53159..53257,53338..53451))
FT                   /locus_tag="ANIA_11514"
FT                   /old_locus_tag="AN11514.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006498"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006498"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006498"
FT                   /db_xref="UniProtKB/TrEMBL:C8V059"
FT                   /protein_id="CBF69399.1"
FT                   /translation="MNKLHDTNFLAYHTPRSWTEGASEKAQIPDILHVLTRERSITGTR
FT                   GELTIFFEGYSTRFTVGYTVLQIRT"
FT   gene            55588..56252
FT                   /locus_tag="ANIA_11513"
FT                   /old_locus_tag="AN11513.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(55588..55729,55846..55880,56181..56252)
FT                   /locus_tag="ANIA_11513"
FT                   /old_locus_tag="AN11513.4"
FT                   /note="transcript_id=CADANIAT00006499"
FT   CDS_pept        join(55588..55729,55846..55880,56181..56252)
FT                   /locus_tag="ANIA_11513"
FT                   /old_locus_tag="AN11513.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006499"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006499"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006499"
FT                   /db_xref="GOA:C8V060"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C8V060"
FT                   /protein_id="CBF69401.1"
FT                   /translation="MNDFPYITICGLANLFDSHKYDDWQPHAAATAVKFANEFLSHRES
FT                   AQDSEPQNCLLTAATLWISQCIGVWNQVVAYSRKKYA"
FT   gene            complement(57879..59853)
FT                   /locus_tag="ANIA_06469"
FT                   /old_locus_tag="AN6469.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(57879..58255,58414..58756,58939..59232,
FT                   59320..59853))
FT                   /locus_tag="ANIA_06469"
FT                   /old_locus_tag="AN6469.4"
FT                   /note="transcript_id=CADANIAT00006500"
FT   CDS_pept        complement(join(57879..58255,58414..58756,58939..59232,
FT                   59320..59697))
FT                   /locus_tag="ANIA_06469"
FT                   /old_locus_tag="AN6469.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006500"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006500"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006500"
FT                   /db_xref="GOA:C8V061"
FT                   /db_xref="UniProtKB/TrEMBL:C8V061"
FT                   /protein_id="CBF69403.1"
FT                   /translation="MDISSIEPRSAPPTKPDLWQRAFDDLRPEDQELIKSVSMPSCNKK
FT                   IECNGENNSSAIVSRLRILSELVESVKIQYQTDQENSRIKEPAQRIVKAVPNFQSFIQK
FT                   AVAIDPTGHATSVWAIVSLGFTKEAWLESCASLTNVITRYSLVEDEYRKNPTTDEHVET
FT                   ALVQVYAAVLTFAARAQSLYDRGRAVWIWKSVTSYARSLDLSIARIKTSRSTMNQLPIE
FT                   SLLVTKSIPGDSLTELRKSIAEAEFHLQKWFQIVDCYEQRERVNRLLEVADNMLSSANE
FT                   PHDKIDLAELKVAEEAHYNAYTGEEDQERLPETRTELLEDIKSWATDPDRRPVFWLQEI
FT                   TTSSAANQEAIRTSRDNGSRNPQEQFNELLFEPLKSLNLGLRTPLILAAVIDALDECQV
FT                   PGDVTAFLSILPTLNDLEEVHLRVLITRRPEPPVTRGFRSIYKDEIILHQIKRSTIQHD
FT                   ISVFL"
FT   gene            complement(61078..63565)
FT                   /locus_tag="ANIA_06468"
FT                   /old_locus_tag="AN6468.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(61078..61266,61332..61505,61563..61871,
FT                   61935..62230,62294..62481,62538..62816,63238..63371,
FT                   63455..63565))
FT                   /locus_tag="ANIA_06468"
FT                   /old_locus_tag="AN6468.4"
FT                   /note="transcript_id=CADANIAT00006501"
FT   CDS_pept        complement(join(61078..61266,61332..61505,61563..61871,
FT                   61935..62230,62294..62481,62538..62816,63238..63371,
FT                   63455..63565))
FT                   /locus_tag="ANIA_06468"
FT                   /old_locus_tag="AN6468.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006501"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006501"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006501"
FT                   /db_xref="GOA:Q5AZ12"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ12"
FT                   /protein_id="CBF69405.1"
FT                   /translation="MSHTVQNIISEDETSYIRQEKLEDRLYVLFGYPIKVQHINGRYVF
FT                   EAPRKVDMVSYRPHGILLWYRLADPWCPAPGIQDEIAVYSYRTRPYNHSYCSRPYQEIK
FT                   IISRPSMSDLESGYYRSLRPYLRYDTFASHPEKSNIYVFETTPQHAAYSFTNSDIFESH
FT                   IANAAKPETRIVSISCQNSLRPLGITEQAMCKLMTHYDIDASFFDLVVSFGDKPRTSDA
FT                   GHGAMSFKQRDDGAYDIQYLFTYAENDSTRGAASWRIRQVCVFHRYNPSGAGNLWILLH
FT                   VCPQSKLQRQIEHILSTNPSALLAERSSMHLLVFSTYLSGWRWCIRNLGDEIERTVDIA
FT                   LTLDFSKPKARDHKDGLVQLLKQEYLGDRLVPLSARLRAALCTLRHLEQISSLSHSKGV
FT                   SRDQQGGYMSGEVARHITELEGHIESVQVLERKVRGISDLLAVAVTVENQAVTIDINNK
FT                   MLDLNNKLVKLTNKSLDENATVRIVTLVTLIYLPASFVSTLLGMNLFDYGSEGNLEVSH
FT                   DFWIFFILAVPLTAFTVGSWYWLVRRRRRLRDMKQAVDMEAQ"
FT   gene            64526..67115
FT                   /locus_tag="ANIA_10812"
FT                   /old_locus_tag="AN10812.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(64526..64538,64614..64893,64950..65060,65169..65263,
FT                   65317..65378,65435..65535,65600..66017,66070..66223,
FT                   66273..66542,66608..66761,66798..66907,66973..67115)
FT                   /locus_tag="ANIA_10812"
FT                   /old_locus_tag="AN10812.4"
FT                   /note="transcript_id=CADANIAT00006502"
FT   CDS_pept        join(64526..64538,64614..64893,64950..65060,65169..65263,
FT                   65317..65378,65435..65535,65600..66017,66070..66223,
FT                   66273..66542,66608..66761,66798..66907,66973..67115)
FT                   /locus_tag="ANIA_10812"
FT                   /old_locus_tag="AN10812.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006502"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006502"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006502"
FT                   /db_xref="GOA:C8V063"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8V063"
FT                   /protein_id="CBF69407.1"
FT                   /translation="MLNDETRSNPNPLTERTASELEQDVRDFHRRKELSSVVDVELLVK
FT                   AALIARDRIYMQICSLTEPEKRVFESEEKLGFFQQTKELKVSILTTACAAIIQGWQQST
FT                   INASSRGWQCQFLLPNSTEEQPMVNVVRHVIGTWLSDPLQESKFGRRSALFVSALFCAA
FT                   CVLGTARCDTWQQLLACRLILGIGIGAKASIAPVFAAEVAADHLRGRLLMMWQIFDTFG
FT                   IFIGFLCYWIVGRSWRGLLGSAAVPALILLVLVFLCPESPRFLIRRDRYPEAFLSLRQL
FT                   RGSDIQAAKDLYYIHAQLQIETELINGKRPEEWWAKEVYQEKVKAQSFFQRVGALFSVR
FT                   RNLRACIAAFLVMAAQQLCGINVLSFYSSTLFRSASSTSSTNNTTLSDFSNPADIVNCE
FT                   IPMDDTVAWLNFGFGLANFLFTIPAYMFIDRRGRRILLLVSLGGMFFTLVATSGFFLII
FT                   TPDDARKGLVSTFTIVVFTLFYGIGAGPVPFTFSAEVFPLAFREVGMSFSVMVNFIGLS
FT                   ILILFVPPLTTAFSPDDPNRDKARLVGQSNLLFFFTVMTVASSGLNALAFILVYFLVPS
FT                   GTAGISLEEMNSIFNTRTAVHAYEHLPAAVRRRWQPLVVQKEGQEHQRDQHHLQTIYSN
FT                   V"
FT   gene            68004..70333
FT                   /locus_tag="ANIA_10819"
FT                   /old_locus_tag="AN10819.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(68004..68579,68651..70333)
FT                   /locus_tag="ANIA_10819"
FT                   /old_locus_tag="AN10819.4"
FT                   /note="transcript_id=CADANIAT00006503"
FT   CDS_pept        join(68004..68579,68651..70333)
FT                   /locus_tag="ANIA_10819"
FT                   /old_locus_tag="AN10819.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006503"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006503"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006503"
FT                   /db_xref="GOA:C8V064"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C8V064"
FT                   /protein_id="CBF69408.1"
FT                   /translation="MRFPRRRPLDFRKELAERLLSAIGKGAGRFAPRDELLQIWNVEVL
FT                   AEFASRERIRLPSASSLEDIRKDFLQTISLLVYVGWDEWSRFDTLFLSHKGPDQELDRT
FT                   DRHIQEYDVQTLSNADFLGPMRGNLFFDNRHLFCPVEIVENENLRLDGNWKLPLLEGRS
FT                   EHCGRGGFGQVTREVIAARHYHSVHGPSMSEKVVARKVFKSIIDFERERWVLKELRKCE
FT                   VQNARIVLPLATVVVGGQSNILFPPARMDLDKFLAGGLVSPDECGMMELLTELMGLAGA
FT                   LSHLHTSLGFNVYGCHADLKCANILIYPSRENSGSSRIGSWMITDFGLSIITASAKRRD
FT                   SGFMLPEQQATDTVTLLRQMPGAYQAPEVRYGDGVSRSSDIWSFGCIMVRVLAFKLDGV
FT                   RGLQELDRLRAKDDDGVTIYSNDHFNRGEPPILNPHIANWINNLPVRYPGYNGEFLQDC
FT                   AAVLRRTLAIDKHDRPKASEVQYLLGELRSLFHTSMHTPSESASSVPSLGTPRSSVTDL
FT                   APPSSVGGALRVEDLFNAIRGSNLRKVEACLAEGVDIEKHDDHGDTPLGVAARLGHGPI
FT                   VQCLLEARAQVNARSAGGKTALMLASYAGFEGVVQLLLHHNADCQEYSNEGLTCLHYAT
FT                   FRHASAGLIRLLTQHFKPVDIPTRSPTEETPLVSLLKNYVPSTAWEDKVRALISAGADV
FT                   NATDKFGNKPIDYTGGVRSEAALEMLQAPVGPPRSIRSSIDSGQSHRSFSLRWRRSKG"
FT   gene            complement(71210..72181)
FT                   /locus_tag="ANIA_10815"
FT                   /old_locus_tag="AN10815.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(71210..72181)
FT                   /locus_tag="ANIA_10815"
FT                   /old_locus_tag="AN10815.4"
FT                   /note="transcript_id=CADANIAT00006504"
FT   CDS_pept        complement(71210..72181)
FT                   /locus_tag="ANIA_10815"
FT                   /old_locus_tag="AN10815.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006504"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006504"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006504"
FT                   /db_xref="GOA:C8V065"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8V065"
FT                   /protein_id="CBF69410.1"
FT                   /translation="MGAQFSQFFPPHPTFTSENLSEQQGKVFLITGGTSGIGLELAKIL
FT                   YCHGGKVYITARSEEKAEKAIQEIQASAPNHHGELDFIILELDDLRSIKASVEAFKAQE
FT                   SKLDILWNNAGVSQPPLGSVSKQGHELQLAVNCFGPFLFTQMLLPLLDAAVASSVSPGS
FT                   VRVIWTSSQVAELSSPDEGIIMSELTSPPKDNVRNYVNSKTGNWFLSAEFARRYGSRGI
FT                   VSVALNPGAANTNLLKDARLMKILSYPLLHRAGLAAHTELYAGFSPAISLQNNGCYVIP
FT                   FGRIHDQVADALLSAMKVAEDGGSGRAKEFWEFCEARTKDYL"
FT   gene            complement(75438..77092)
FT                   /locus_tag="ANIA_10811"
FT                   /old_locus_tag="AN10811.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            complement(join(75438..75782,75869..76981,77033..77092))
FT                   /locus_tag="ANIA_10811"
FT                   /old_locus_tag="AN10811.4"
FT                   /note="transcript_id=CADANIAT00006505"
FT   CDS_pept        complement(join(75438..75782,75869..76981,77033..77092))
FT                   /locus_tag="ANIA_10811"
FT                   /old_locus_tag="AN10811.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006505"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006505"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006505"
FT                   /db_xref="GOA:C8V066"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8V066"
FT                   /protein_id="CBF69412.1"
FT                   /translation="MGVYLFSSSLWATLLLAILIYRLVRITYNLYFHPLSGIPGPSAWA
FT                   ASRLPFVYALIRGTIIQDFQKLHEQYGPIIRIAPNEVTFAHPEAYTDIFQPRPEKSQGQ
FT                   FLKDPLWWARQPGHPDSLLSVINPERHAQMRRVLSPGFTARALRKQEPFVQKYVNLLVA
FT                   QLQDLVSKSPSAHINMTPWFNYTTFDIFGDLGFGESFDCLQHSRYHPWIALLFDSVKAA
FT                   GFVIATRYYPLIEAVLLKCVPPSMRKIQRDHYQQIVDKVQRRLGWELQRPDFMSYVIDE
FT                   RGGLRLDAGELYATFMILTTAGSETTATALTGTLNYLVNHSPESLQRLENEIRGAFSGL
FT                   DAITLDAVRNLPFLNAVIQEGLRLCPPIPWVLPRLVPQGGSMICGTWLPGGTPVSIQAY
FT                   TLNRDPTLFNRATSFLPERWLASSTSDSSSCFFNDQRQVVQPFSTGPRACLGQHLAWAE
FT                   MRLILAKLVWVFDFGAIDGQGVNWEDLRTYLLVERKPINVRISSRTV"
FT   gene            78100..80382
FT                   /locus_tag="ANIA_06465"
FT                   /old_locus_tag="AN6465.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(78100..78284,78343..78438,78535..78674,78860..78865,
FT                   78934..78967,79066..79160,79520..79526,79615..79756,
FT                   80061..80087,80185..80206,80300..80382)
FT                   /locus_tag="ANIA_06465"
FT                   /old_locus_tag="AN6465.4"
FT                   /note="transcript_id=CADANIAT00006506"
FT   CDS_pept        join(78100..78284,78343..78438,78535..78674,78860..78865,
FT                   78934..78967,79066..79160,79520..79526,79615..79756,
FT                   80061..80087,80185..80206,80300..80382)
FT                   /locus_tag="ANIA_06465"
FT                   /old_locus_tag="AN6465.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006506"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006506"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006506"
FT                   /db_xref="GOA:Q5AZ15"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ15"
FT                   /protein_id="CBF69414.1"
FT                   /translation="MPGIPPHLAAAGCLESCPIPLAPFSSATGLYVLLLRVRTLWALNI
FT                   TAWKRIRLAAVFGLGILAFAASIVRLGMTHVLTSSPGATWNISSISKWAVICACLPVLP
FT                   ALLDRYREKNFGSSLNRLWSGGSRRSYSSAATESEVRFYCAYPDIISKSKGPISSTSDN
FT                   QPPAISLERLSPQTEVNLHLTKKNSSPEAEPCRGDGDSGDYRAGRSATSTSSTSQVITP
FT                   QRKTMMQARFTRGTGKSKSGCENLPTARSESHRNRNEFRSVQYSLSLAWGMDLDSA"
FT   gene            complement(80852..83958)
FT                   /locus_tag="ANIA_06464"
FT                   /old_locus_tag="AN6464.4"
FT                   /product="esterase, putative (AFU_orthologue;
FT                   AFUA_1G03170)"
FT   mRNA            complement(join(80852..81732,81788..82163,82217..82314,
FT                   82373..82600,82672..83515,83620..83958))
FT                   /locus_tag="ANIA_06464"
FT                   /old_locus_tag="AN6464.4"
FT                   /note="transcript_id=CADANIAT00006507"
FT   CDS_pept        complement(join(80852..81732,81788..82163,82217..82314,
FT                   82373..82600,82672..83515,83620..83958))
FT                   /locus_tag="ANIA_06464"
FT                   /old_locus_tag="AN6464.4"
FT                   /product="esterase, putative (AFU_orthologue;
FT                   AFUA_1G03170)"
FT                   /note="transcript_id=CADANIAT00006507"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006507"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006507"
FT                   /db_xref="GOA:Q5AZ16"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ16"
FT                   /protein_id="CBF69416.1"
FT                   /translation="MALLERLCGILVPILLLNVLNVRGHVIYGRGAPSLPVNAASISDQ
FT                   VPSALVRRQSVGDVELRILPLGASITWGLKSETHNGYRKYLRDQLRFDGWEVNMVGSKH
FT                   DPDSTMKDNDVEAHSGDTIDMVTAAVHGSLAYKPNVVLINAGTNDCRLGIEIPEAGARM
FT                   RSLIETLVQAEDMSRTLIVLSTLLPTENAQAKANVPSVNAQYRTLVKTMREEGVSIVLA
FT                   EMNRADGWIAFPNDFADDTHPNEAGYKKMASIWHSAIKDAANKNLIVAPAAFGSPGGSD
FT                   GQCEREYGTGVYAGGLTQRGSGEEDGIYYHDSEAMGEVFTVLGGEDDFDTFFFARIFSR
FT                   DRDDMLRWTKADGSVKYLLNRNIDGQSTKFVDEHISMTVEDNCNPAGVNFIDVNADGLD
FT                   DFVCIAKDGTAYASINTGEDPPRFVYKGLWKSREGYGQANVRLGDVDGDGRADYCVVAG
FT                   NGDITCWRNGWVDDMPKYWQPLGKRFTGKGIGDLRGVRLEDINGDGRDDWLWVDDVGAT
FT                   TTYTNARSCQTVEEGDGLNIVWRPGYHKGYSSGPTHFGMSDFGNSGLRRRVHFARIYGV
FT                   PQDFGLLGSQDYVFVDRDDNPVNGGGDGDKVGGYTYRIRVWKNKGSGGTKIKADGNRYC
FT                   NMLGHDDGRMDYVWILSKGDMRIYPNKGLSFVSNDGESYWGPNYVIFDPASMSINRDLD
FT                   RRDLHLVDWDGDGACDIIWTDPNNLNRPRLFRNRIKETGDFNWEYTANPAPTVTCPEQR
FT                   GLGFFDRPVQLADITGNGKADYLCIEKDGRTWGWVHNDNGWELIDQVKFSEAKDRANLH
FT                   WADVNGDGRADLIHTNKFNGDGTVWYNRGRREIGGSRFWWEPAGLTYEGAVAGSCTYFA
FT                   DLDGDGRADMHAITHSMLNTAETWYNKCELTDSTGDDGPITDPGLPSIPE"
FT   gene            complement(84477..84825)
FT                   /locus_tag="ANIA_11512"
FT                   /old_locus_tag="AN11512.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(84477..84560,84766..84825))
FT                   /locus_tag="ANIA_11512"
FT                   /old_locus_tag="AN11512.4"
FT                   /note="transcript_id=CADANIAT00006508"
FT   CDS_pept        complement(join(84477..84560,84766..84825))
FT                   /locus_tag="ANIA_11512"
FT                   /old_locus_tag="AN11512.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006508"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006508"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006508"
FT                   /db_xref="UniProtKB/TrEMBL:C8V069"
FT                   /protein_id="CBF69418.1"
FT                   /translation="MATTGVVVTVQVSREYGWDYFGSDQESHRLRTNITVREPHDVDYH
FT                   KP"
FT   gene            89766..90028
FT                   /locus_tag="ANIA_11511"
FT                   /old_locus_tag="AN11511.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(89766..89785,89842..90028)
FT                   /locus_tag="ANIA_11511"
FT                   /old_locus_tag="AN11511.4"
FT                   /note="transcript_id=CADANIAT00006509"
FT   CDS_pept        join(89766..89785,89842..90028)
FT                   /locus_tag="ANIA_11511"
FT                   /old_locus_tag="AN11511.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006509"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006509"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006509"
FT                   /db_xref="GOA:C8V070"
FT                   /db_xref="UniProtKB/TrEMBL:C8V070"
FT                   /protein_id="CBF69419.1"
FT                   /translation="MPGKEDTYHWALIVGPKIETPGKIGMRYHAKELPKAGGGSEWYFG
FT                   GSKCQLTPTSMLLVRVMIGKVED"
FT   gene            complement(90324..91415)
FT                   /locus_tag="ANIA_06463"
FT                   /old_locus_tag="AN6463.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(90324..91015,91313..91415))
FT                   /locus_tag="ANIA_06463"
FT                   /old_locus_tag="AN6463.4"
FT                   /note="transcript_id=CADANIAT00006510"
FT   CDS_pept        complement(join(90324..91015,91313..91415))
FT                   /locus_tag="ANIA_06463"
FT                   /old_locus_tag="AN6463.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006510"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006510"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006510"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ17"
FT                   /protein_id="CBF69421.1"
FT                   /translation="MAIVSFSQSIQPRWQDRQNDLTGFSIQNTKMKRRNRLCVKYGEYI
FT                   DLSEASTMRFISKNTSIPVPKIHCAFTHKGYSYIVMERIKGDMIGMGWVHRNEESKAKL
FT                   LTQLKAMVQEMRAIPPPGGTGVSSVDGGALYDCRLPSPTLRFGPFPSVQAFHRHLRRGM
FT                   EFDPGLDFEVKELIRQHERDWPIVFTHGDLSSLNILVRGDDVVGIIDWEIAGWYPSYWE
FT                   YTTACQVNPQNPFWLNEIDKFIAPMPDELKMEKSRQKYFGAF"
FT   gene            complement(92758..93073)
FT                   /locus_tag="ANIA_11510"
FT                   /old_locus_tag="AN11510.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(92758..92779,92831..92877,92930..93073))
FT                   /locus_tag="ANIA_11510"
FT                   /old_locus_tag="AN11510.4"
FT                   /note="transcript_id=CADANIAT00006511"
FT   CDS_pept        complement(join(92758..92779,92831..92877,92930..93073))
FT                   /locus_tag="ANIA_11510"
FT                   /old_locus_tag="AN11510.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006511"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006511"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006511"
FT                   /db_xref="GOA:C8V072"
FT                   /db_xref="InterPro:IPR001542"
FT                   /db_xref="InterPro:IPR036574"
FT                   /db_xref="UniProtKB/TrEMBL:C8V072"
FT                   /protein_id="CBF69423.1"
FT                   /translation="MQFSSIILSAVALFGSMAFAAPSEDLVARASCQIGDIWGAGDAAC
FT                   SASCLKDGTYHGGYCNEESVCVCTY"
FT   gene            complement(98011..99486)
FT                   /locus_tag="ANIA_06462"
FT                   /old_locus_tag="AN6462.4"
FT                   /product="amidohydrolase, putative (AFU_orthologue;
FT                   AFUA_6G11660)"
FT   mRNA            complement(join(98011..98419,98489..98878,98947..99329,
FT                   99391..99486))
FT                   /locus_tag="ANIA_06462"
FT                   /old_locus_tag="AN6462.4"
FT                   /note="transcript_id=CADANIAT00006512"
FT   CDS_pept        complement(join(98011..98419,98489..98878,98947..99329,
FT                   99391..99486))
FT                   /locus_tag="ANIA_06462"
FT                   /old_locus_tag="AN6462.4"
FT                   /product="amidohydrolase, putative (AFU_orthologue;
FT                   AFUA_6G11660)"
FT                   /note="transcript_id=CADANIAT00006512"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006512"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006512"
FT                   /db_xref="GOA:Q5AZ18"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ18"
FT                   /protein_id="CBF69425.1"
FT                   /translation="MAILNPTIEQVRASIDEALQSANASLRTFNQKIWSNPETAYEERR
FT                   AHDTICDFLEEKGFAVTRHAFGLNTSFEAKSGSGGRLINFNAEYDALPEIGHACGHNLI
FT                   TTSSVAAFLALSTVLKQYNMPGRTQLLGTPAEENGGGKAKLIDAGAYKGVDISLMAHAG
FT                   PRELFPGVVLDGCAGVLMNARKELHCEFTGVSAHAGGNPWDGVNALDALVSAYNNIAML
FT                   RQQMMPDERMHCAFLETPKVANVIPAHTKAYWQVRSPTLKGLNSLMSRARRCVEAGAAA
FT                   SGCDVKITEKELYADIKLNDTLCALYQTHMATYGRNVLKRHEKILTGSSDIGMRDLYLL
FT                   EQTAANKLSGNVSYIMPTLHAIFAIPATNGSFLHHPSFASAAGTDEAHEEALVVGKTLG
FT                   LVGWEMLTNDELFEQSKSQWQKCVNE"
FT   gene            100208..102090
FT                   /locus_tag="ANIA_06461"
FT                   /old_locus_tag="AN6461.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(100208..100386,100458..100551,100609..100892,
FT                   100976..101819,101890..102090)
FT                   /locus_tag="ANIA_06461"
FT                   /old_locus_tag="AN6461.4"
FT                   /note="transcript_id=CADANIAT00006513"
FT   CDS_pept        join(100208..100386,100458..100551,100609..100892,
FT                   100976..101819,101890..102090)
FT                   /locus_tag="ANIA_06461"
FT                   /old_locus_tag="AN6461.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006513"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006513"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006513"
FT                   /db_xref="GOA:Q5AZ19"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ19"
FT                   /protein_id="CBF69427.1"
FT                   /translation="MHEHSQSQSIPKDFPVRDDLDETKRYLERLETQDDGLGQIMEVAA
FT                   TPEEERRVVRKLDMILIPVMGLCYMMQYMDKLALSQATLFNLREDLNLQGTDYSWTSAV
FT                   FYFGYLGWSWPSSYLMVRLPIGKYITASVLAWGGALMCHAATKNFGGLMTARFFLGVGE
FT                   ASIAPGFALITGMLYKREEQPARQAAWFLGNCVATIIGGVIAYAIGTVEGVAVNSWQLL
FT                   FLALGTITTGMVLWLVFLLPDSPKKVIFLTKKEQAIVVQRTMANKTGMMDNESFMLGQA
FT                   WQALRDPQTWFLVLYTFCVNLWNGGVTSVMSSLTSAFFIVTVCADTFRLQFSSIIINSF
FT                   GFSQLRSLLMQMPMGGAQVVFLVLSAAVATWFPRTRILMMIFNVTVSMVGMLLVWQLDP
FT                   DHQIGRMVGLALGAVFAVNIPLSLSVISTNVAGFTKRSVTSALLFVAYCMGNIIGPQLF
FT                   LTSEEPAYPTGMKAAISGLALGAFFLTCLLCYYIFENRRRDAKYGPPTQLTEEEERTHA
FT                   LSNKTDLEIESFRYLI"
FT   gene            complement(103140..104328)
FT                   /locus_tag="ANIA_06460"
FT                   /old_locus_tag="AN6460.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(103140..104043,104110..104328))
FT                   /locus_tag="ANIA_06460"
FT                   /old_locus_tag="AN6460.4"
FT                   /note="transcript_id=CADANIAT00006514"
FT   CDS_pept        complement(join(103189..104043,104110..104328))
FT                   /locus_tag="ANIA_06460"
FT                   /old_locus_tag="AN6460.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006514"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006514"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006514"
FT                   /db_xref="GOA:C8V0C3"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0C3"
FT                   /protein_id="CBF69429.1"
FT                   /translation="MSRSAAAWAFAVRWRWYLGLAPTITLLWMVYLLSSYQRPRVIAQS
FT                   HTLSADNSTAENSFTRPPLTGAGNSTLGFETILALSPFPSWRTTGLQAAAQLTGLDIQI
FT                   PPQPPVPPEIIDAFAGLGPEDARHPNHGSAVAWVAHLDLIKYVVQSDFETALILEDDVD
FT                   WDLSIREQMVAVAEAVRRLTKTTDSTGAPYGLSWDVLWVGLCAETWDQEFETQFIVDET
FT                   VIPADRYVGLGKAPIDRLPPGQRAVFYSGAPICTFAYALTRTGARNVLLDVGAGKDEAF
FT                   DISLMNGCRERNLTCISVLPELFRHYIPSDKVGASSLVNTKDGEETSTEIEEEMGHTEN
FT                   ILESARCHALWGQPCPA"
FT   gene            complement(108057..110040)
FT                   /locus_tag="ANIA_06459"
FT                   /old_locus_tag="AN6459.4"
FT                   /product="isoamyl alcohol oxidase (AFU_orthologue;
FT                   AFUA_3G07410)"
FT   mRNA            complement(join(108057..108242,108302..109228,
FT                   109282..109486,109534..109913,109966..110040))
FT                   /locus_tag="ANIA_06459"
FT                   /old_locus_tag="AN6459.4"
FT                   /note="transcript_id=CADANIAT00006515"
FT   CDS_pept        complement(join(108057..108242,108302..109228,
FT                   109282..109486,109534..109913,109966..110040))
FT                   /locus_tag="ANIA_06459"
FT                   /old_locus_tag="AN6459.4"
FT                   /product="isoamyl alcohol oxidase (AFU_orthologue;
FT                   AFUA_3G07410)"
FT                   /note="transcript_id=CADANIAT00006515"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006515"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006515"
FT                   /db_xref="GOA:Q5AZ21"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ21"
FT                   /protein_id="CBF69431.1"
FT                   /translation="MRLPLLLLTISSLYPTSALWQRCRCTPAHSCWQQIDWSSLNATVS
FT                   GKLIRNSPPAVSCYPGPKYNKEECAHVGSQWSNTTFQSEQPIGYCYPIDNSCPVTNFTW
FT                   QGKCSLGPSPVYTINATELEELVAGISFARVNNVRLVIRNTGHDLLGKSTGYGSLQIWV
FT                   RYLRKGILFQPTFNLSIPCAACNWTGAAFTVSGGYIWDEVYEEAFVRDLIVVGGGDPTI
FT                   SVIGGYIQGGGHSPATHDFGLASDQVLEAQVILANGSIVVANPCINPDLFTALRGGGGG
FT                   TYGVVISVTIKAHPSRPVVAHTLAIVPTSTSNLNPFLDAITDLYTFYPTLSESGFSGYG
FT                   SWSINDPITTYGNSPAGYKHAFAALDKPLVSAKSALEPILDTLSVHDAIDIFVSWFEFP
FT                   SYAAYYRAMSGVHQKTGVPETSLASRMFDKKALTSDRERLRGMVGAVAGNALESTINQV
FT                   LLVGGGKVLEEPEYSGVNPAWRKTFLIHIVARGWPAKLGPVVAKKVKTDITYSKYYAMR
FT                   QLTPGMGGYLNEADRNNPWWEEDLYGTTKYNQLLQIKTKYDPEGVFYCPQCVGSSSWYE
FT                   QTLPGKKYGPLCAR"
FT   gene            110529..111748
FT                   /locus_tag="ANIA_06458"
FT                   /old_locus_tag="AN6458.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(110529..111039,111074..111412,111442..111668,
FT                   111737..111748)
FT                   /locus_tag="ANIA_06458"
FT                   /old_locus_tag="AN6458.4"
FT                   /note="transcript_id=CADANIAT00006516"
FT   CDS_pept        join(110529..111039,111074..111412,111442..111668,
FT                   111737..111748)
FT                   /locus_tag="ANIA_06458"
FT                   /old_locus_tag="AN6458.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006516"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006516"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006516"
FT                   /db_xref="GOA:Q5AZ22"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ22"
FT                   /protein_id="CBF69432.1"
FT                   /translation="MNATLIDIPSPSGVATRLSEGNLIVITWVGAGLGALFTLLRVAIR
FT                   LTRMRRLLPDDYFILLAFSFLIANAVLQTIQIPHLYYIILNPTGSDIAPHALKYVHYMF
FT                   AIIGLFWSVLWSVKAAFLALFWAMTNNLPHYRRWWFGIVIFTFASYAGCWFASAFTCHP
FT                   PSTYFKFESDSPAQCVKPIDQKGAEIAIIYSTVVDILTDLMSTPSARFEPLFLIMTVMG
FT                   FALSIIWSTNISLHQKVGLGTVFSLGLVIIAFAVVRAINITGRSYSDQAGLAVWGIAES
FT                   SIFLTDEKAVIVGCLPPFKTFLSRSSSSRASRYPPIYYRYRQKRSVTQTTISSDIALRP
FT                   LSESVDRVPKGEIRITQGFVED"
FT   gene            complement(113732..114706)
FT                   /locus_tag="ANIA_06457"
FT                   /old_locus_tag="AN6457.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(113732..113889,113944..114215,
FT                   114284..114524,114583..114706))
FT                   /locus_tag="ANIA_06457"
FT                   /old_locus_tag="AN6457.4"
FT                   /note="transcript_id=CADANIAT00006517"
FT   CDS_pept        complement(join(113732..113889,113944..114215,
FT                   114284..114524,114583..114706))
FT                   /locus_tag="ANIA_06457"
FT                   /old_locus_tag="AN6457.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006517"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006517"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006517"
FT                   /db_xref="GOA:Q5AZ23"
FT                   /db_xref="InterPro:IPR000028"
FT                   /db_xref="InterPro:IPR036851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ23"
FT                   /protein_id="CBF69434.1"
FT                   /translation="MKTSVLSAGLSLITSVVAFPHYLDIERRWEPREWIAPGPDDSRGP
FT                   CPGLNTLANHGYLPRNGKGITLDILKEGMLEGFNIEHGDAVLLFFQAIRTSPIPFSDRF
FT                   DLADLGRHGILEHDISLSRSDAYFADPKPFNETVWAETMSYFTTSMITVEQLAKARMGR
FT                   LATSKKTNPEFELSLLADGFSWGECASFFEIMADGTTGTVDKKYIDYWFRNERMPTELG
FT                   WQRRNVTMKGSERIKYSLLLMEAAGVKKRDMTSDAYGLPIVH"
FT   gene            complement(116346..117392)
FT                   /locus_tag="ANIA_06456"
FT                   /old_locus_tag="AN6456.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(116346..117171,117223..117392))
FT                   /locus_tag="ANIA_06456"
FT                   /old_locus_tag="AN6456.4"
FT                   /note="transcript_id=CADANIAT00006518"
FT   CDS_pept        complement(join(116346..117171,117223..117392))
FT                   /locus_tag="ANIA_06456"
FT                   /old_locus_tag="AN6456.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006518"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006518"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006518"
FT                   /db_xref="GOA:Q5AZ24"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ24"
FT                   /protein_id="CBF69436.1"
FT                   /translation="MAGVVDAIGVISGLLTIVSFSMDNFGQDQDPGSTIKVAVGLDGPG
FT                   GTENAGGDLPDVRIWNDFGEYKAMTADPGSVSNGNIGTITVDHDQQGVYSLFSANNDAI
FT                   CIAWVTTTWAETAGGNKYAVSGDYGEACGGTWYESNLWTNGENSYQPKCFWIDGNGDQP
FT                   NTGFQVRWPRYSSDQFDEGNTDPANICNDIDFGLRTEEDPSSINYWVKGKKRDLNSRRM
FT                   RARRDVRAPWTETELVVSESKFHSAVKLCESETSMGPDFVHVEENIFCDMGAKKAYPLC
FT                   TGSGVGTNTTATSQTCFDLESKNLFSGGAVKRASPYTSIRDWRSKNPATI"
FT   gene            118209..119247
FT                   /locus_tag="ANIA_06455"
FT                   /old_locus_tag="AN6455.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(118209..118928,118984..119247)
FT                   /locus_tag="ANIA_06455"
FT                   /old_locus_tag="AN6455.4"
FT                   /note="transcript_id=CADANIAT00006519"
FT   CDS_pept        join(118209..118928,118984..119247)
FT                   /locus_tag="ANIA_06455"
FT                   /old_locus_tag="AN6455.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006519"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006519"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006519"
FT                   /db_xref="GOA:Q5AZ25"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ25"
FT                   /protein_id="CBF69438.1"
FT                   /translation="MIHSKVLFLAPVISSLAQDLPTDIVGCKDLDCPNEGWDSCTVADE
FT                   TYAGVGLARVSNAPDSLAGISLVKGVHIEDPKSGGNAGGDGSEESRSFRSVYYLGTPSN
FT                   LEVADVSGCAVVFNDPPTGHFDVPKLNDSITVDTRASYGTCPDVIQQGCIEGLTRQAGK
FT                   LQYSGSNACSALASDLRNNPPDECSDMTGSGDGLGSFDVVSLSNLSTISQSANGSSNCW
FT                   PILPKTDNLAQLYDDTTKGNYTEQGNLAEMYKITPILTVFTSDNSTNSPVNNTAASLTC
FT                   LKVVGTQDVTNATDPTDTDVDAAPLSAVNMVGASVAAIATLIFVLL"
FT   gene            121125..124724
FT                   /locus_tag="ANIA_06454"
FT                   /old_locus_tag="AN6454.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(121125..122061,122340..122383,122560..122666,
FT                   122713..122874,123061..123337,123482..123749,
FT                   123810..124032,124092..124193,124237..124401,
FT                   124685..124724)
FT                   /locus_tag="ANIA_06454"
FT                   /old_locus_tag="AN6454.4"
FT                   /note="transcript_id=CADANIAT00006520"
FT   CDS_pept        join(121125..122061,122340..122383,122560..122666,
FT                   122713..122874,123061..123337,123482..123749,
FT                   123810..124032,124092..124193,124237..124401,
FT                   124685..124724)
FT                   /locus_tag="ANIA_06454"
FT                   /old_locus_tag="AN6454.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006520"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006520"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006520"
FT                   /db_xref="GOA:Q5AZ26"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ26"
FT                   /protein_id="CBF69440.1"
FT                   /translation="MSPRLDYNEGYDSEDEEIPRYVHHSRGKSHRSVRTSGRSRTLDYD
FT                   GDDEASDHAAPSGIDRDARACPTSRRYTDDCLETHKFRGARSSRSRGRTDDNKVLYYTK
FT                   YRSPAKDLPIERDPEGINLFKVRQHTRPSDAHVPSGYREPYEVKVDEYEDDHPRTCTSR
FT                   RDSRQPKVYKVRVDEYEDNLPARSHTDFRESPRSERCSSRYTEDSKPGELPPRSGPCRS
FT                   SRPSPVDEDVEYEIREPRGHRSSRHSTDVDFQPVEQHPRFGQRGLSRPSRVDEEVDYEI
FT                   REPRGNRVSHAAHGDSPCQDQSSRHIGIQLWTGVPVLSRQLTHAISTPVNMFRTVEDRP
FT                   TPKEVYNWRLYTEATIIATGTLLFGYDSAFVGTTIARQSFVDAFNIVESEAADISSNIT
FT                   STFQAGAFFGAIFCFLPEADAGRALTGIACGAITATVPSYIAELSIVSIRGFLTGFFEV
FT                   AYQIGSLVGFWINYGINENMDNSSAASWRVPMAVQIIPAGVLFIGGFSSMREDIEMNRT
FT                   RLLEEARIAEKYGQGWLAYIRGALFELSRHGMWNRVLLVLCAFALQNMSGAAAINYYSP
FT                   ILFASLGITDVALYTGIYGLVKAVASIIFYGILIDMWGRRRPTIVSSLACPLCLWFVGA
FT                   YVKVGHPADIIDAGGELSPSTEAGGRAATAMIMIYSVFWSFGLNGIPWIVSAEIFPGAL
FT                   RNLTGTWAALVQWLIQFVITKALPYIFNSLGYGTWFFFASWMLLAIIWSFFFLPETKGK
FT                   TLDEMHTIFLSKDGTHTITLR"
FT   gene            complement(124953..126190)
FT                   /locus_tag="ANIA_06453"
FT                   /old_locus_tag="AN6453.4"
FT                   /product="TfdA family oxidoreductase, putative
FT                   (AFU_orthologue; AFUA_4G13850)"
FT   mRNA            complement(join(124953..125682,125742..125877,
FT                   125923..126190))
FT                   /locus_tag="ANIA_06453"
FT                   /old_locus_tag="AN6453.4"
FT                   /note="transcript_id=CADANIAT00006521"
FT   CDS_pept        complement(join(124953..125682,125742..125877,
FT                   125923..126190))
FT                   /locus_tag="ANIA_06453"
FT                   /old_locus_tag="AN6453.4"
FT                   /product="TfdA family oxidoreductase, putative
FT                   (AFU_orthologue; AFUA_4G13850)"
FT                   /note="transcript_id=CADANIAT00006521"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006521"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006521"
FT                   /db_xref="GOA:Q5AZ27"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ27"
FT                   /protein_id="CBF69441.1"
FT                   /translation="MSVVIPPVPVGPDGQPDIQYLPDPVKYAARAERRQREENLPRTLP
FT                   EGFPQELKSDLAWDGKTVGEVYDWNYHLTEDDLKEVDQALLHFKTLNLPIGLVNQETFP
FT                   LYKLHNSLRLISREIHLGRGFKVIRGVPVDHPRPPGQQLAGKADVVLAHITDLSRKVDT
FT                   KTIKAPAYTTEKQVFHTDAGDVITLFALQEAAEGGQSYLSSSWHVYNELARTRPDLIHT
FT                   LAEPWVAEQGGDVVSRPLLYYQPQTSSSPERLIIQYARRGFTGYWGKPRAATLPPITEA
FT                   QAEALDALHYLAEKSAVALDFHKGDIQVINNLSIFHARAGFTDSDEKRRHLVRLWLRDP
FT                   ELAWETPERLKSRWEYVYDGVDAAKSIFPLKPFVRSQ"
FT   gene            126550..128898
FT                   /locus_tag="ANIA_06452"
FT                   /old_locus_tag="AN6452.4"
FT                   /product="OPT peptide transporter Mtd1, putative
FT                   (AFU_orthologue; AFUA_7G00910)"
FT   mRNA            join(126550..126691,126753..126920,126968..128898)
FT                   /locus_tag="ANIA_06452"
FT                   /old_locus_tag="AN6452.4"
FT                   /note="transcript_id=CADANIAT00006522"
FT   CDS_pept        join(126550..126691,126753..126920,126968..128898)
FT                   /locus_tag="ANIA_06452"
FT                   /old_locus_tag="AN6452.4"
FT                   /product="OPT peptide transporter Mtd1, putative
FT                   (AFU_orthologue; AFUA_7G00910)"
FT                   /note="transcript_id=CADANIAT00006522"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006522"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006522"
FT                   /db_xref="GOA:Q5AZ28"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ28"
FT                   /protein_id="CBF69443.1"
FT                   /translation="MQLSSYKETAVGEAVDKDNNAPAENLEGQIQVHDDVEYVKGHPVI
FT                   RTGADISRFIVSDRDDGDPALTFRSIVLGTVFTALSSVITILYVFKPYQVQVSAVFLQL
FT                   LVFIFGKAWAIFTPRPERVKWRWLQSVLRFMSFGQDFGIKEHVVAALIASSGNNGLSGV
FT                   EVRAVERLFYGLHISASTAVLSTFSIALCGFVLAGVLRPLIVYPAEMVYWSTLPQVVLY
FT                   QNLHFNPRNNKRRLIKFGWALGIAAVWELFPAYMMTWLGGFSVVCLASLRAPMHTRKII
FT                   TTIFGGASSNEGMGLLNFSLDWQYIQSTYLSLPLKQQVNSWIGYAIFYVVMAGTYYGNA
FT                   WDAKSFPFMSTSLFHSNGTTFSPDSVINSQGTIDYVKLEQVGLPSLTSSTVWGYLTQNL
FT                   AIGALISHVLIFYWKDMETAWKQARSRTQPDPHYQGMLKYKEVPMWWYYASFVLAFFAG
FT                   LIVTIKGETTLPAWGYIISLILGSFIAPFSCVLYGLYGTGVSTNQLSKMVAGALHPGRP
FT                   LAGLYFASWSHQVILLSVNLANWLKIGQYTKVPHRIMFATQVYGTLLGAALNYVVMITI
FT                   VTSQREILLDPIGNNVWSGSLVQSLNSQAITWSLAKEIYGTHGRYLIVPLGLIIGLVFP
FT                   AIHWGLSKIFPRIRNWPLNTTIILAHAGQVYYGTTAWVGSAIVVGIFSQFWLRRRLPRV
FT                   YNEYNYLIGAALDGGSQLVIFILSFAVLGASGTERPFPTWWGNPDGNPDHCL"
FT   gene            complement(128977..130849)
FT                   /locus_tag="ANIA_06451"
FT                   /old_locus_tag="AN6451.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(128977..129096,129150..129207,
FT                   129265..129795,129847..130011,130073..130382,
FT                   130444..130849))
FT                   /locus_tag="ANIA_06451"
FT                   /old_locus_tag="AN6451.4"
FT                   /note="transcript_id=CADANIAT00006523"
FT   CDS_pept        complement(join(128977..129096,129150..129207,
FT                   129265..129795,129847..130011,130073..130382,
FT                   130444..130849))
FT                   /locus_tag="ANIA_06451"
FT                   /old_locus_tag="AN6451.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006523"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006523"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006523"
FT                   /db_xref="GOA:Q5AZ29"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ29"
FT                   /protein_id="CBF69445.1"
FT                   /translation="MPEAEIALHRPALHSSSTMVLATPTTPTTETSKSSSDDNGTRGSN
FT                   SSGNTTNNIATTIEKEAPDPNLVVFSGPDDPLNPQNLPPWKKWVYANIIGWLSLVVTFA
FT                   TSVFSAATGVTAEEFGVGRQVTTLGTALFIAGFAAGPLLFGPLSELYGRKRPLIAGYAV
FT                   FVVFQIPVGVARNIETLILCRFIGGVAASGPLSIAGGYFADFFDPVQRGLALAIFSGTT
FT                   LVGPIVGPILGGFITQSYLEWRWTAWITMIMAAAAGLIGLFVLPETYAPVLLQRKAARL
FT                   RLETKNWALHAKLDESPITIGSVITRYLSRPLVMLLREPILQLITLYMTFIYGFIYLLF
FT                   EAYPVSFIEERGYSLGVGALPFLSIGVGVVLGSAYIFYFTRTRIRQTFVSTGRIRPEDR
FT                   LYPMIPGAFLLPLGQFWFAWTSFPSISPWPQILAGVPIGAGIQIIYLQGLAYLVDVYLV
FT                   NANSAISANAIVRSTVAAGFTMFATPMYHRLGVRCASSLLGFLGVAFIPIPIVFYIYGE
FT                   RVRKLSRYSPTL"
FT   gene            131394..132282
FT                   /locus_tag="ANIA_06450"
FT                   /old_locus_tag="AN6450.4"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family, putative (AFU_orthologue;
FT                   AFUA_5G01040)"
FT   mRNA            join(131394..131756,131902..132282)
FT                   /locus_tag="ANIA_06450"
FT                   /old_locus_tag="AN6450.4"
FT                   /note="transcript_id=CADANIAT00006524"
FT   CDS_pept        join(131394..131756,131902..132282)
FT                   /locus_tag="ANIA_06450"
FT                   /old_locus_tag="AN6450.4"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family, putative (AFU_orthologue;
FT                   AFUA_5G01040)"
FT                   /note="transcript_id=CADANIAT00006524"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006524"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006524"
FT                   /db_xref="GOA:Q5AZ30"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ30"
FT                   /protein_id="CBF69447.1"
FT                   /translation="MSLAGKVALITGASKGIGRATAQRLASEGASLVINYNTDAASAQA
FT                   LVDEIGQDRALAVQADASKLADIDRLVDAAVAKFGKIDILIPNAGILPMRDLEHTTEED
FT                   FDFTYNLMVKGPYFLAQAQKAAKHIPAGGRIILVSTGVTVLSNIAPAYLLYASAKAAVE
FT                   QMARVMAKDLARNGILVNCVAPGPTTTGLFLNGKSDQMLKMVAGFSPFNRIGEPEEIAN
FT                   AVYFLCSKDSSWVSGQTLRVNGGMA"
FT   gene            132653..134483
FT                   /locus_tag="ANIA_06449"
FT                   /old_locus_tag="AN6449.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            join(132653..132928,133015..133377,133447..133655,
FT                   133736..134180,134233..134322,134373..134483)
FT                   /locus_tag="ANIA_06449"
FT                   /old_locus_tag="AN6449.4"
FT                   /note="transcript_id=CADANIAT00006525"
FT   CDS_pept        join(132653..132928,133015..133377,133447..133655,
FT                   133736..134180,134233..134322,134373..134483)
FT                   /locus_tag="ANIA_06449"
FT                   /old_locus_tag="AN6449.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006525"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006525"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006525"
FT                   /db_xref="GOA:C8V0D4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0D4"
FT                   /protein_id="CBF69449.1"
FT                   /translation="MAILVRLFFALFVVSVYFFRVRLRLSHIPGPFLASLTNINRRQWV
FT                   TTGRAHTIHTELHRQYGKVVRAGPNTVFVSDPAAIPAIYRFNEPYQKSEFYDALMPYVR
FT                   GKSIPDVFATRDEHIHRTMKQPIAAIYSMSNLVSFEPYVKSTIEYFFSRLDSLFVETGK
FT                   VCNFGLWLHLFASDVMGEITFSRRLGFLETGGDMENVMANNWKFFVQAAPATQMPWLDY
FT                   FWKRNPLLPGSVKPNKVIEFGVARIQERLHLSEKHPDHVNSRDFLSRFIAAKEKNSQIG
FT                   PDAIMTWANSNIQAGSDTTAILLSALFYHLLKNPTSLAALCTEIDAAAKRGCLSSILTW
FT                   KETRDLPYLDACVKEAARLHPPISLPLERVIPESGTVIGGFKIPGGTRVAMNPWAVHRD
FT                   RDVFGADADTWRPERWLEGEEKAKTLYNSLLTFGGGHRSCLGKNISYLEIYKLVPSILL
FT                   RYEIGLAEPEKEWHLENRWFVMPSRFYVRLKARNGVTKL"
FT   gene            complement(139085..146905)
FT                   /locus_tag="ANIA_06448"
FT                   /old_locus_tag="AN6448.4"
FT                   /product="polyketide synthase, putative (JCVI)"
FT   mRNA            complement(join(139085..140043,140102..144522,
FT                   144684..146242,146291..146905))
FT                   /locus_tag="ANIA_06448"
FT                   /old_locus_tag="AN6448.4"
FT                   /note="transcript_id=CADANIAT00006526"
FT   CDS_pept        complement(join(139085..140043,140102..144522,
FT                   144684..146242,146291..146905))
FT                   /locus_tag="ANIA_06448"
FT                   /old_locus_tag="AN6448.4"
FT                   /product="polyketide synthase, putative (JCVI)"
FT                   /note="transcript_id=CADANIAT00006526"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006526"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006526"
FT                   /db_xref="GOA:Q5AZ32"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032088"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041068"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ32"
FT                   /protein_id="CBF69451.1"
FT                   /translation="MAPAPSALVFGSQTTLPSVEAASRLRAALLLDPRLYRMRTSIESL
FT                   PEIWPALAISDPALERVAGPAEKSLRQLCRWLSHSEFPDATEISELPATFVTPFTVILH
FT                   TVLYMHYTDENGSRGHADVLRAVRNNGGVQGFCTGFLTAVSVATSPDLEALSRQASVAL
FT                   RLAVAIGAYIDLDLLDSDVSSVAVRSRAGKKGLEETLAQFPGAYISVITDELNATVTAP
FT                   RASLDALSQSLASNGLSAKRFDLRGRFHHPAHQKALEGLYNLVASNPVFQFSHSELLAP
FT                   VYSNIDGQLLSSDSIIDTLLQSILVQRCDWYASISTALHKRSNGEKTSVVQFSLVECIP
FT                   PSVLRQARLSVQRITDVPVQNSPATVPAPLNAVRARIQTSEPIAIIGMGCKFPGADTLD
FT                   EYWQLLAQGTSMCRTMPEERFKTSSLRRSPGEKLKFWGNFVNDVDAFDHRFFKKSSREA
FT                   ASMDPQQRLVLQVAYQTLESAEYSGLSGIKASRDVGCYLGLCASDYTDNVASHPPNAFS
FT                   SLGTLRAFLSGKISHFFGWTGPSITYDTACSSSAVAIQAACRALQTGECSMALAGGVSL
FT                   YTSPNFYQNLSAASFLSPTGPTKPFDAKGDGYCRGEGVGLVFLKPLSSALADHDNIMGV
FT                   IAAAAVNQNQNSTAITVPHSESQIELYRKVVSEAGLHPHDVSFVEAHGTGTPVGDPIEF
FT                   TSIRTVFGGSNRANPLAIASVKGNIGHTEGAAACINNYGAAGSNAAMIVTEAPTGARSE
FT                   KQGTLPKCPIYVSANTVSSLKEYCKELLRSLRGRSPDCLASLAFQLANSQNRGFPHALI
FT                   TSVTSKAELEDQLSAVVENRNNSLHTVAPTERPVVLAFGGQVARSVGLSRQVYDSSAVL
FT                   RTHLSNCDDILTSAGLNSIFPAIFRKEPIADVVLLHSALFSAQYACAMTWIEAGVIPAA
FT                   LIGHSFGQLTALSVGRVLSLKDGLGLITERAKLMRDAWGPEHGSMVSVQADVQTVARLM
FT                   KAAETKDPKDALEIACFNGPTSHVVVGSADAADRLEAALTQESIRYKRLAVSHGFHSKF
FT                   TEPLLLGLEQCAERLTFRTPKYAIETCSSGSSWSEFNASMIVQHTRTPVYYTEALARIE
FT                   AKLGACTWLEVGTGGSVAGMIRGALNVPSDHLIQAVNLAGETGTAALADATVNLWKSSH
FT                   KLQFWAFHRSERECYQPLELPPYQFEKTRHWLDWKDTMTEQATVTQSTREETSVEEFLT
FT                   FVKYKDSTKQQAEFRISTEHEKYSFFVKGHAVLAEPLCPAPLYIDLACKAGQMVYSDTS
FT                   ETLIIPSVEDLEIQAPLGVGDRVIILRLQQSPFLKTAWTFCFCSRPVMGNSAEEQLHAS
FT                   GTVVLRENDTKTAAEFSRFGRLVSSKRVQEMKSDPDCHILQGPVVYQLFSRVVSYADYY
FT                   KGVQSVYASGAEVTGRIRLPPTVKDADTRRPLLVDNFIQTAGIHVNCLTDVGAKEVYVC
FT                   TKVDRVQSAAAFTEDLANVDASWIVHSSYHPTSEKEVVNDIFVFNAATGELAMFILGAH
FT                   FTRVQISSLGRVLSRANTADAAPIKVAVPVQSPALRAQPKRVLLPPLTKRSITRPTLEI
FT                   SEKLKKTLSRVVEVPVADIHDGGILADLGVDSLLGTEVLTEINQVFNVSIPADEFALLT
FT                   DVASISKCLASYLGVHDSGSQPEDLADADSVESDSDMPTGAVTSGITTPDDAVSRLADL
FT                   LAENLEYDGTIEASNNLADLGLDSILSIELANDIKKIFNCDVDMSQLNMESTFADLIAL
FT                   VPALNIEQSLSSVPASLTTQGSDFEMAQHAFEQIRFDYDIYTKETGFYDFWKRVYPAQS
FT                   RLVLAYTVEAFAQLGCDLALMHPGDRLPKIGYLPAHEKLVQQLYNILRDGMLVATSDSG
FT                   FVRSDKPVDPTSSTRLLEEINTIAPQHASEHSLLHITGSKLADCLTGTADPLNLLFRSK
FT                   ANRDLLAEVYLNGPMYAAISRLLCSFLGNAFSDRQSSGTFQILELGGGTGGTTGHVLDY
FT                   LVRSGIPFTYTFSDVSGSFVAAARKKFAGRPYMEYQVIDIEKEPADSLTGKFHAVISTN
FT                   CIHATTNLEISTGNIHRMLRPDGFVALVEFTRNMYWFDLVFGLLEGWWLFEDGRQHVIA
FT                   SESFWNTSMRKAGFQHVSWTDGDSFEARTLRIIAGFRAPAVNEIYTPRLDSRDTETAVE
FT                   SVMYKQADGIPLFADIYYPPSVSNEPRPIALMIHGGGHIMLSRKDIRPKQTAHLHTLGF
FT                   LPVSIDYRLCPETTLTEGPMRDVSDAMAWARSTLCSLPLLCPGLTLDPSRVVVVGWSTG
FT                   GHLAMTTAFTSIERGLSPPDAILAFYCPTDYEDRVWTQPNYPENTDVDGLSLMKYNLLE
FT                   GVQDRPITAYNIPLTSRSNSKAGGTPAGGWMAPDDPRSRIVLHMNWKGQCLPVLLRGLP
FT                   PSNSLSPGDAEKLISQPQPEIEEIQRVSPYAQIRRGVYRTPTFVIHGTDDDLIPYEQSV
FT                   RTVQALKDMGVRAEVSVPQGKAHLFDMFKDADGSSWEVVKRGYDFLKEEVSGK"
FT   gene            147470..149765
FT                   /locus_tag="ANIA_06447"
FT                   /old_locus_tag="AN6447.4"
FT                   /product="O-methyltransferase, putative (AFU_orthologue;
FT                   AFUA_4G14580)"
FT   mRNA            join(147470..147887,147958..148084,148138..148445,
FT                   148502..148558,148658..148868,148965..149270,
FT                   149339..149412,149465..149508,149748..149765)
FT                   /locus_tag="ANIA_06447"
FT                   /old_locus_tag="AN6447.4"
FT                   /note="transcript_id=CADANIAT00006527"
FT   CDS_pept        join(147470..147887,147958..148084,148138..148445,
FT                   148502..148558,148658..148868,148965..149270,
FT                   149339..149412,149465..149508,149748..149765)
FT                   /locus_tag="ANIA_06447"
FT                   /old_locus_tag="AN6447.4"
FT                   /product="O-methyltransferase, putative (AFU_orthologue;
FT                   AFUA_4G14580)"
FT                   /note="transcript_id=CADANIAT00006527"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006527"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006527"
FT                   /db_xref="GOA:Q5AZ33"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ33"
FT                   /protein_id="CBF69453.1"
FT                   /translation="MERFPRSAADAQQLLQLAELFKQSAEIIAEEWNKEDFSRIKAETN
FT                   SIKSNLGSLDTARILPSPRLHEATRTVLAITGAATELVAEPYSRIQEVACQYFESRALF
FT                   VAAERRIPDLLAGAGEYGLSVGEIAEATGIEERKLSRILRCLCSIHIFRQIGTDRFANN
FT                   RISAALKNNEPLRAYVQLFNLDIYTASDQLPKYLLSSQGASYKVHETAWQKAVGTTKAR
FT                   WDWLAERVSLDEVRPKEAPYPGLPDVRHLQPGPDGKYARPELDNFGLAMVGGGKVSGAA
FT                   HAYDFPWASLGDALVVDVGGGVGGFVLQLLPAYPQLRYIVQDRAEVLQQAQEEIWPVEA
FT                   PEAVADGRVQFMEHNFFQPNPVKGADVYWLRGIFYCVQILSALRTSMAPTSRILVCDQV
FT                   MNTTAGCDEIPPAPSPLPANYGYYMRYPHHRDLAMMSIINGIERTPAQFTELVKQAGLK
FT                   VNKIWNCRSMVGIVEIGLKNEKDRHHRRLSYMGFGNYTQLGIGFFSSAKGPVRDELQAD
FT                   EQA"
FT   gene            complement(150122..150595)
FT                   /locus_tag="ANIA_11509"
FT                   /old_locus_tag="AN11509.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(150122..150233,150340..150388,
FT                   150462..150507,150569..150595))
FT                   /locus_tag="ANIA_11509"
FT                   /old_locus_tag="AN11509.4"
FT                   /note="transcript_id=CADANIAT00006528"
FT   CDS_pept        complement(join(150122..150233,150340..150388,
FT                   150462..150507,150569..150595))
FT                   /locus_tag="ANIA_11509"
FT                   /old_locus_tag="AN11509.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006528"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006528"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006528"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0D7"
FT                   /protein_id="CBF69454.1"
FT                   /translation="MAVVKVKVKRRRPEVSFILGGILEARIYKEKELPAGPSSACEQED
FT                   QKYCDKMRRPIMRPRRIESIAIDWLLSAASFG"
FT   gene            150920..151771
FT                   /locus_tag="ANIA_06446"
FT                   /old_locus_tag="AN6446.4"
FT                   /product="putative Myb-like transcription factor
FT                   (Eurofung)"
FT   mRNA            join(150920..150944,150992..151160,151219..151771)
FT                   /locus_tag="ANIA_06446"
FT                   /old_locus_tag="AN6446.4"
FT                   /note="transcript_id=CADANIAT00006529"
FT   CDS_pept        join(150920..150944,150992..151160,151219..151771)
FT                   /locus_tag="ANIA_06446"
FT                   /old_locus_tag="AN6446.4"
FT                   /product="putative Myb-like transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006529"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006529"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006529"
FT                   /db_xref="GOA:Q5AZ34"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ34"
FT                   /protein_id="CBF69456.1"
FT                   /translation="MVGSRHPDQCAKRWHHSLDPNVKRGPWTMEEDSSLLEAVQKIGRD
FT                   WKEIGRELFPSRSTTDIKNRYVILSRRRGPSPAIPENCSSIDIETHSSSLADSKPPIPA
FT                   ELLTPEVDFSIANTPCELDSSNLAPDTLSINMTLPSDLPSYLSLPLPDTAETDHALDES
FT                   STAWEIPDWTAFDNQCLFTPGASELEGSFTSRNHEEPPQPLPVPDIPGPSTLVLEDLRP
FT                   ETVNLVIDTLLRTNSKFGMRMYNTGS"
FT   gene            complement(152599..154597)
FT                   /locus_tag="ANIA_06445"
FT                   /old_locus_tag="AN6445.4"
FT                   /product="GMC oxidoreductase, putative (AFU_orthologue;
FT                   AFUA_3G08070)"
FT   mRNA            complement(join(152599..152645,152701..154162,
FT                   154216..154333,154389..154597))
FT                   /locus_tag="ANIA_06445"
FT                   /old_locus_tag="AN6445.4"
FT                   /note="transcript_id=CADANIAT00006530"
FT   CDS_pept        complement(join(152599..152645,152701..154162,
FT                   154216..154333,154389..154597))
FT                   /locus_tag="ANIA_06445"
FT                   /old_locus_tag="AN6445.4"
FT                   /product="GMC oxidoreductase, putative (AFU_orthologue;
FT                   AFUA_3G08070)"
FT                   /note="transcript_id=CADANIAT00006530"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006530"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006530"
FT                   /db_xref="GOA:Q5AZ35"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ35"
FT                   /protein_id="CBF69458.1"
FT                   /translation="MALRYLNKFSLLSLAVPTLAAPIGSSFGVPGTDALYDYVVVGAGN
FT                   AGAPVAYRLAETGHTVALVEAGSLYEYGNGNLSQIPANSLFFIGKDPEWTNNLVDWNFV
FT                   TSPQAEWNNASVHYASGKVLGGSTGRNLMTYHLPTKGSLDRWAEDVSDESWNFDNMLPY
FT                   IMKSQRFTPPNNNLRFRNATPTYDPAVLGRRGRLDVTYPNYANGLASWLVRGFRDIGLA
FT                   AIRGLNGGQLIGSAYTLSTIQPGNQHRASSKTAYLDPLIGRNLNLIIYQSTHAKRILFS
FT                   NDTVATGVRVSSEGQEYTLSARNEVIVSAGAFKTPQLLMVSGIGPAANLERYGIPLVAD
FT                   RPGVGQNLQDHTLAGPSYRVNAITGSSNSIPEFITEAQRQYNSNPPRGVLTNTGVDILG
FT                   WEKVPEQLRGNFSTETEDALASLPEDWPELEYLPVYGYFGDQNNYMVTPNDGFNYLTIA
FT                   AAVVSPLSRGTVDIASNDTEVNPIIDPRWFAHPGDIQVAVAGFRRSRALMASPAMAGIT
FT                   LGGESYPGTDVQTDDEIVEWLREASNTVHHACCTAGMGPRDNPDSVVDTQGRVIGVSGL
FT                   RIVDASIMPFLPPGHPISIIYGLAERIAESILADA"
FT   gene            155233..158463
FT                   /locus_tag="ANIA_06444"
FT                   /old_locus_tag="AN6444.4"
FT                   /product="NRPS-like enzyme, putative (JCVI)"
FT   mRNA            join(155233..157947,158059..158463)
FT                   /locus_tag="ANIA_06444"
FT                   /old_locus_tag="AN6444.4"
FT                   /note="transcript_id=CADANIAT00006531"
FT   CDS_pept        join(155233..157947,158059..158463)
FT                   /locus_tag="ANIA_06444"
FT                   /old_locus_tag="AN6444.4"
FT                   /product="NRPS-like enzyme, putative (JCVI)"
FT                   /note="transcript_id=CADANIAT00006531"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006531"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006531"
FT                   /db_xref="GOA:Q5AZ36"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ36"
FT                   /protein_id="CBF69459.1"
FT                   /translation="MARNQQLRPFKRPAIRLYPAVNETELIRTLPEVVEFNAQANPDHV
FT                   FCLQAKKSPNKSILSLVSVTNRQLKQAISQCVGWLKSNLKLQLPSLLHGSVEKGAPVAL
FT                   LMESDIGLFIYEIALIGLGVPVLLLSARLSAPAINSLLQRTSAAAIIVSGRLEATAREA
FT                   AETLPAAVFSPLPFEAFLSTNEGLPDNDSICHPYHYIDESDRNVLILHSSGTTGLPKPI
FT                   YVSHRHLLSFVNCHRLDLESEAQGVNVSTLPLYHGFGLVAPALAMGVGKTVCFPPGSTV
FT                   PSAGATLDLLRISNAASFMTVPSILEDIAFLGDEGIQALAGLDYVTFGGGILKPSVGEE
FT                   LAVHGVKLLNHYGTTESGPLAPIFVPQDDYNWRFFRLRDDLRLQLDEIAPNGNERRFKL
FT                   TTFPFGLEQPFEIQDQLVCNPDYPGSDFNAVGRNDDTIVLATGEKVQPQILESILCESS
FT                   LVKSAIAFGEHQFEIGVLVQLAADVPPKNYSKLREQLWPLVARANESMDGHARIQSSEA
FT                   VLLLPSTVTIPRTDKGSIARKDVYKMFEADIAGVYRKLESAGPVLCLDMETLEEDLKLL
FT                   ISRCTDWPPDWAVTDDLFERGMNSLQAIRVQRALVAAVTRSLRGVCQPERIGRDFVYIH
FT                   PSVRAMADFFREPVNGLQLPNGFSTRGWAPDQLVQRFALTSKDGRATVLLTGATGSLGS
FT                   HCLLSLIQSPNIKRVICLVRPEDSFTDPRLRLQKSLESKKLHLSSTQWSMVDVLGCHTA
FT                   SQYLGLTREQYTILQESVTYILHAAWPMDFHWKLPSFQSQFQSLHNLLALARDIHNRRP
FT                   SIKPRLTFISSIATVGQYARVHGVRMVPETSVDSVECLNPIGYAEAKLVCERMLEHARL
FT                   HYPHEMTVSYVRMGQIAGSSTTGFWNINEHIPALTLSWIPVDVAAQSITELLLSPAPAE
FT                   LIYHIENPIRQSWHDMLQTIAAVLHLSASDALPWNEWQEQVAAAGDTDNPAKKLQDFFA
FT                   NDFIRMGCGEVVLGTDKARKASATLRRVDAVSEGCVRGYLQYWKEIGWLK"
FT   gene            159216..163453
FT                   /locus_tag="ANIA_06443"
FT                   /old_locus_tag="AN6443.4"
FT                   /product="ABC multidrug transporter (Eurofung)"
FT   mRNA            join(159216..159473,159521..163453)
FT                   /locus_tag="ANIA_06443"
FT                   /old_locus_tag="AN6443.4"
FT                   /note="transcript_id=CADANIAT00006532"
FT   CDS_pept        join(159216..159473,159521..163453)
FT                   /locus_tag="ANIA_06443"
FT                   /old_locus_tag="AN6443.4"
FT                   /product="ABC multidrug transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006532"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006532"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006532"
FT                   /db_xref="GOA:Q5AZ37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ37"
FT                   /protein_id="CBF69461.1"
FT                   /translation="MRLSSEAKIAESGGQPPTAGSRSETGSESTEAESADPKAQKWYQR
FT                   SLNPLRWQKIPPVPEERTVSREYGASFFSIASFQWMAPLMKVGYLRPLELQDIWTVNPD
FT                   REVDVLTKRFEVSLEKRTNAGAKRPLLWALYDTFRFEFLLGGFCHLISSLLIVFAPYLT
FT                   RYQIAFATEAYVAQRSGQPAPRIGRGMGFVVGITVMQAIQSLCTNQFLYRGQMVGGQIR
FT                   AVLILQIFNKAMKLSGRAKAGGVQSPEQQEKIKELKAAKDQALKKPGSPPADDKGWGNG
FT                   RIVALMSIDVDRINLACGMFHISWTAPVSIIVALILLLVNLTYSALAGFGLLVIGMPFL
FT                   TYAVRFLFKRRRNINKLTDQRVSLTQEILQGVRFVKFFGWESSFLDRLKEIRHHEIRSI
FT                   QTLLAVRNGILCVSMAIPVFASMLSFITYALSNHVLDPAPIFSSLALFNSLRMPLNLLP
FT                   LVLGQITDAWTALNRIQEFIVAEEQKEDIERDEHMPEAVRMDRASFTWERKAADKEAEK
FT                   VEKKANPRRTEPKSEAPTDSAESDEPFQLRDMTLDIRRDELVAVIGTVGSGKSSLLAAL
FT                   AGDMRLTDGSVRLSTSRAFCPQYTWIQNTSLRDNILFGKDYDEKWYDQVIDACALKPDL
FT                   EILPNGDATEIGERGITISGGQKQRLNIARAIYFNAELVLLDDPLSAVDAHVGRHIMDK
FT                   AICGLLKGRCRILATHQLHVLSRCDRIVVMDDGRIHAVGTFDELSRDNDLFKQLMSTAS
FT                   QDSKEDEEEATEVVEEEAEKQAQQEPTKPAAALMQQEEKATDSVGWTVWKAYIRASGSY
FT                   FNALAILFLLAFANVVNVWTNLWLSYWTSNHYPSLSTGQYIGIYAGLGAGSALTMFIFS
FT                   TYMSTAGTNASRQMLQLAMTRVLRAPMSFFDTTPLGRITNRFSKDIGVMDNELCDAMRM
FT                   YAITITMIVSIMILIIVFYHYFAIALVPLFLLFLTASNYYRSSAREMKRHESILRSAVY
FT                   ARFSEAITGTASIRAYGVQNQFRSSLRDSVDTMNGAYFLTFSNQRWLSVRLDAVAVLLV
FT                   FVTGVLVVTSRFDVSPSISGLVLSYILAIAQMLQFTVRQLAEVENNMNATERVHYYGTQ
FT                   LEEEAPAHIPSNPVPESWPPHGEITFDNVAMRYRPGLPLVLKNLSMNISGGERIGIVGR
FT                   TGAGKSSIMSALFRLTELSSGRITIDGVDISTIGLHDLRSRLAIIPQDPTLFRGSIRSN
FT                   LDPFNEHSDLELWDALRKAHLIDSDTKDSAVDASNPNGNANAQRLTLDTAVDEEGLTFS
FT                   LGQRQLMALARALVRNARIIICDEATSSVDFATDQRIQETMAQGFEGKTLLCIAHRLKT
FT                   IIHYDRICVMDQGSIAEIDTPLNLWEKEDGIFRAMCERSGISREDIVGQVEKE"
FT   gene            complement(163538..167165)
FT                   /locus_tag="ANIA_06442"
FT                   /old_locus_tag="AN6442.4"
FT                   /product="amino acid transporter (Eurofung)"
FT   mRNA            complement(join(163538..163740,163791..165236,
FT                   165474..165656,165862..166161,166231..166457,
FT                   166579..166964,167053..167165))
FT                   /locus_tag="ANIA_06442"
FT                   /old_locus_tag="AN6442.4"
FT                   /note="transcript_id=CADANIAT00006533"
FT   CDS_pept        complement(join(163681..163740,163791..165236,
FT                   165474..165656,165862..166161,166231..166457,
FT                   166579..166964,167053..167165))
FT                   /locus_tag="ANIA_06442"
FT                   /old_locus_tag="AN6442.4"
FT                   /product="amino acid transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006533"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006533"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006533"
FT                   /db_xref="GOA:Q5AZ38"
FT                   /db_xref="InterPro:IPR002227"
FT                   /db_xref="InterPro:IPR008922"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ38"
FT                   /protein_id="CBF69463.1"
FT                   /translation="MAASWLRLVALMLLLVPSLARNIPRAGNCTSLNRRKSWNALTRVE
FT                   KTGKRAFNRDQEARLTNSEYIQAERCLMNHAPIVGNVKDAKNLWDELHDLHISQGNYVH
FT                   YVGHFLPWHRYLVRAHEVLLQTLCGYKGAHPYWDEVTDYEAGPLQRSPVFDPVVGFGGN
FT                   GFGRNRCIQNGPFKDTTLRIRSNERNGEYCLSRAFNQTAFTWANRRNIEECFALQKYTD
FT                   AWQCYNQYPHAAGHIAVGGVMEDPTESNGDPLFYLHHAYLDRLWWRWQQADLPGRLSDM
FT                   GGPNVVPPDLMRLMGMPPVSAALLDYNGDPGGETTLAHVLWMNGLVPNATVAEVMDIGG
FT                   QVYSWIGCVVLSVMPSCGSCNFSKAERPDTSLMRLVQETIVGHWLICSISPSNAASQAH
FT                   ATTLSPSLPASPQHRASQHSISTTPGTRDMASSTEISDAESKKVTMPSGAEKFEAPPKY
FT                   LPAEDGDLVAEMSERERNIYEHGTAKFNRLGWKRLTIVLIVEAIALGSLSLPSTFATLG
FT                   MVAGVICTVGLGFLAIYTSYVVGQVKLKFPLVHHYPDAGKLLFGRFGYELVNFMLIFQL
FT                   LFLTGSHTLTGAIAWIDITQSDVCSVVFAVVSAIILFLLAVPPSFTEMAILGYIDFASI
FT                   ILAIGITMIATGVESTNAPGGLSAVNWSAWPKEDITFTDAFIAMTNIIFAYSFAMCQFS
FT                   FMDEMHTPSDYVKSIWALGLTEIVIYTLTGAIVYAFVGQDVQSPALLSAGHLMSRVAFG
FT                   IALPVIFISGSINTVVAARVVHGRIFKDSPIRFINTKMGWITWLAMIAVGTVIAFIIAE
FT                   VIPFFNDLLSISSSLFISGFTFYFPALMWFMLIREGSIFSSRKNMALAALNALCFCIGV
FT                   VTLVAGTYSSIKDIIDKYNANAVRGVFSCSKPN"
FT   gene            complement(168122..168755)
FT                   /locus_tag="ANIA_10817"
FT                   /old_locus_tag="AN10817.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(168122..168755)
FT                   /locus_tag="ANIA_10817"
FT                   /old_locus_tag="AN10817.4"
FT                   /note="transcript_id=CADANIAT00006534"
FT   CDS_pept        complement(168287..168613)
FT                   /locus_tag="ANIA_10817"
FT                   /old_locus_tag="AN10817.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006534"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006534"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006534"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0E3"
FT                   /protein_id="CBF69465.1"
FT                   /translation="MVRMSLGYPIDDDCPIRQASTWQEGWRYCWEAGACACDRSPYRLQ
FT                   PHSFRASSSLPATNHCLVHLFDATAEDGPANAIVTYHCKGRWGLLGMPSRTIGPEATDC
FT                   RIEP"
FT   gene            complement(170814..171984)
FT                   /locus_tag="ANIA_06441"
FT                   /old_locus_tag="AN6441.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(170814..170913,171107..171375,
FT                   171424..171624,171721..171984))
FT                   /locus_tag="ANIA_06441"
FT                   /old_locus_tag="AN6441.4"
FT                   /note="transcript_id=CADANIAT00006535"
FT   CDS_pept        complement(join(170814..170913,171107..171375,
FT                   171424..171606))
FT                   /locus_tag="ANIA_06441"
FT                   /old_locus_tag="AN6441.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006535"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006535"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006535"
FT                   /db_xref="GOA:Q5AZ39"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ39"
FT                   /protein_id="CBF69467.1"
FT                   /translation="MEFPANTRRRVHRISIYLRCLALIASLAAVISFAYSQDAHDRGVV
FT                   LTEDLGHHLVTPATGTTEYAFIWSLIILSIELSSPVTIHPGIYVAFDLLAWTAVTTGVS
FT                   LYLAMHEPYYTGDGYTCGRDYREYRDCGGKQVANVEHFGTAMGFLAVERRKAGDSETRV
FT                   TQASAASLVEMKATSYDDNG"
FT   gene            172567..173302
FT                   /locus_tag="ANIA_06440"
FT                   /old_locus_tag="AN6440.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(172567..172810,172860..173302)
FT                   /locus_tag="ANIA_06440"
FT                   /old_locus_tag="AN6440.4"
FT                   /note="transcript_id=CADANIAT00006536"
FT   CDS_pept        join(172567..172810,172860..173302)
FT                   /locus_tag="ANIA_06440"
FT                   /old_locus_tag="AN6440.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006536"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006536"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006536"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ40"
FT                   /protein_id="CBF69468.1"
FT                   /translation="MESAGLTFLNTTGASLSTATAKRMRAHITRANFAKRRQRLAIAGA
FT                   SESNAKRRQRGLNQTEEEDGAPSLRLAPCNPSNIEAFHQIQELVFLEGRHTPGSASEAA
FT                   WFNLIASEPALVEASLAVAVRQWSPDNSCQSKADYHSYTAVRLIKQRITSIATPSDGVL
FT                   GAVITMALGASLVHDDIAWKIHMDGLARIVSERVSRGPHSLPAWFIDLIVQWVYLRLWL
FT                   SVANPA"
FT   gene            174504..175633
FT                   /locus_tag="ANIA_06439"
FT                   /old_locus_tag="AN6439.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(174504..174671,174725..175633)
FT                   /locus_tag="ANIA_06439"
FT                   /old_locus_tag="AN6439.4"
FT                   /note="transcript_id=CADANIAT00006537"
FT   CDS_pept        join(174504..174671,174725..175633)
FT                   /locus_tag="ANIA_06439"
FT                   /old_locus_tag="AN6439.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006537"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006537"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006537"
FT                   /db_xref="GOA:Q5AZ41"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ41"
FT                   /protein_id="CBF69470.1"
FT                   /translation="MARQWVLNGQEGFETSLEYQQGVNIPSVHDLKPNEVLVKMYAASL
FT                   NYRELVIAGPMGINGPITPPIVPGCDGAGLVEAVGPSVREFSPGDRVVTYIAPKLVEAH
FT                   GDDAHAGVAEAVASMGQGSDGTLRSWAVFPEAGLVHSPRTLDWLSAATLPCTWLTAWNA
FT                   LFGLNGKQAGPDSWVLVQGTGGVSIAALQLAVAAGATVVATTSTVEKADRLKALGAAHV
FT                   VNYRNNPESWGKEARLLTPAERGFDFVVDVGGNETFPHSLAAIRVDGVVLAVGQVGDST
FT                   AEPVPIFAALIHNCIIRGILAGSCNQFKELVRFIDEKKLVPAMDDVIFELAQAKDAYRR
FT                   LKERKHFAKVMIRIDHPL"
FT   gene            176191..178571
FT                   /locus_tag="ANIA_06438"
FT                   /old_locus_tag="AN6438.4"
FT                   /product="hypothetical dipeptidyl aminopeptidase
FT                   (Eurofung)"
FT   mRNA            join(176191..176196,176256..178571)
FT                   /locus_tag="ANIA_06438"
FT                   /old_locus_tag="AN6438.4"
FT                   /note="transcript_id=CADANIAT00006538"
FT   CDS_pept        join(176191..176196,176256..178571)
FT                   /locus_tag="ANIA_06438"
FT                   /old_locus_tag="AN6438.4"
FT                   /product="hypothetical dipeptidyl aminopeptidase
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006538"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006538"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006538"
FT                   /db_xref="GOA:Q5AZ42"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZ42"
FT                   /protein_id="CBF69472.1"
FT                   /translation="MKLSVLSVLLVSVAQAAAAPWRPREPRAAGSKRLTFNETVISAAL
FT                   SPSSISVQWIATENDGDYVYQEEDGSIKIESIVTNRSQTIVPAEKIPADAYSYWISPDL
FT                   SAVLWATNYTKQYRHSFFADYYIQDVETLETVPLVEDMVGDIQYAEWSPSGDSIAFVRG
FT                   NNLWTWSDGTVTAITKDGGPDMFHGVPDWIYEEEILGDRFALWFSPDSELLAFLTFNET
FT                   GVPTFTVQYFMDNQEIAPPYPRELDIRYPKVSETNPTVKLNILQLSDNTVSTIPIDVFD
FT                   PSELIVGEVAWVTDTHTELAVKAFNRVQDESKVVIVETASGETKIAHERDGTDGWLDNL
FT                   LSISYVGPLALGSGDASSAYYVDLSDHSGWTHLYLFSTSGGDPIPLTEGEWEVTSIVSI
FT                   DQERELVYYLSTQHHSTERHLYSVSYRTFEITPLVDDTVEAYWSVSFSAKAGYYILTYA
FT                   GPSVPYQELYSVNQTAPLRTLTSNAALIEKLEEYALPNISYFELEIPSGEKLNVMQRLP
FT                   VGFSPDKKYPVLFTPYGGPGAQEVSKRWQSLDFNAYIASDPELEYVTWTVDNRGTGYRG
FT                   REFRSLVAKQLGKLEAEDQVYAAKQAAKLDWVDSEHIAIWGWSYGGYLTGKVLETDSGA
FT                   FSLGLLTAPVSDWRLYDSMYTERYMKTLSTNAEGYNTTAIRHTDGFKNVEGGFLIQHGT
FT                   GDDNVHFQNAAALGDTLIGNGVTPEKMQVQWFTDSDHSIRYNGGNVFLYRQLAQRLYKE
FT                   KNRAKKEQHQWSKRSQDWVV"
FT   gene            182146..182837
FT                   /locus_tag="ANIA_11508"
FT                   /old_locus_tag="AN11508.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(182146..182150,182181..182216,182642..182837)
FT                   /locus_tag="ANIA_11508"
FT                   /old_locus_tag="AN11508.4"
FT                   /note="transcript_id=CADANIAT00006539"
FT   CDS_pept        join(182146..182150,182181..182216,182642..182837)
FT                   /locus_tag="ANIA_11508"
FT                   /old_locus_tag="AN11508.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006539"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006539"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006539"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0E8"
FT                   /protein_id="CBF69473.1"
FT                   /translation="MMHCHSLGQSVSVRQLRMEAAMTNQQTIIISSSEDLLPRNMPFTC
FT                   TDHAAASDQRETSLLQSEPWSVDYRVQESEHKL"
FT   gene            complement(185272..186313)
FT                   /locus_tag="ANIA_06437"
FT                   /old_locus_tag="AN6437.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(185272..186136,186186..186313))
FT                   /locus_tag="ANIA_06437"
FT                   /old_locus_tag="AN6437.4"
FT                   /note="transcript_id=CADANIAT00006540"
FT   CDS_pept        complement(join(185272..186136,186186..186313))
FT                   /locus_tag="ANIA_06437"
FT                   /old_locus_tag="AN6437.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006540"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006540"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006540"
FT                   /db_xref="GOA:Q5AZ43"
FT                   /db_xref="InterPro:IPR025676"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ43"
FT                   /protein_id="CBF69475.1"
FT                   /translation="MKSAISPDIWETKRMLITKLYKDEEWPLKQVIKLVQTRDFHPSES
FT                   QLRSRLKKWHITKPSRKKYDGSRRLSGAKKNQNQNQPQSQNTMAQKPLSDSLSRLPLSS
FT                   TYHTLHSQPHSQPLAQQLSQRRVDETDSFSETSRPSVSTVPDLSTSPANRYILPSSPHE
FT                   DANPPFTSTSAMYPSSTIMAPSTPMTPAVYGMDDSKRPADAQPVYFYPPESSPHAFPAT
FT                   AAVSYPTHAYGPYSDPSPLAVVEHPQLDYMGYHAVHPYLAHQKTNQYGVPLSELPPPLL
FT                   DGSWASHYHDSHAHQPLSPHSYYSDEAGGLQSLAPLAPPAPIYQTGHVM"
FT   gene            complement(188001..189264)
FT                   /locus_tag="ANIA_06436"
FT                   /old_locus_tag="AN6436.4"
FT                   /product="ABC multidrug transporter (Eurofung)"
FT   mRNA            complement(join(188001..188003,188140..188359,
FT                   188456..189264))
FT                   /locus_tag="ANIA_06436"
FT                   /old_locus_tag="AN6436.4"
FT                   /note="transcript_id=CADANIAT00006541"
FT   CDS_pept        complement(join(188001..188003,188140..188359,
FT                   188456..189264))
FT                   /locus_tag="ANIA_06436"
FT                   /old_locus_tag="AN6436.4"
FT                   /product="ABC multidrug transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006541"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006541"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006541"
FT                   /db_xref="GOA:Q5AZ44"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ44"
FT                   /protein_id="CBF69477.1"
FT                   /translation="MEQVILNAYKTQTAKQVRSDIPTILRSSFLYASSEALQFFCMALG
FT                   FWYGGTLLGHHEYSIFHFYVCFSEVIFGAQAAGSVFSYAPGMSKAKHAAGELKALYSRK
FT                   PKIHGHNVMRGRWSGVGASAAMRNVLPLPPRSLQGSIEFRNVYFRYPTRMTVPVLSGLS
FT                   FSIRPGQFVAFVGASGCGKSTTIALLERFYNPLPGSGGIYVDGRDISSLDLQSYRRQLA
FT                   FVGQEPALFQGTIKENILLGMEEGEVDDGQIIAACKDANIYDFIISLPKGGMLSGGQKQ
FT                   RIAIARALLREPRILLLDEATSALDSESEQVVQAALDTAARGRTTVAVAHRLSTIQRAD
FT                   VIY"
FT   gene            complement(195512..196533)
FT                   /locus_tag="ANIA_06435"
FT                   /old_locus_tag="AN6435.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(195512..195735,195791..196073,
FT                   196141..196533))
FT                   /locus_tag="ANIA_06435"
FT                   /old_locus_tag="AN6435.4"
FT                   /note="transcript_id=CADANIAT00006542"
FT   CDS_pept        complement(join(195512..195735,195791..196073,
FT                   196141..196533))
FT                   /locus_tag="ANIA_06435"
FT                   /old_locus_tag="AN6435.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006542"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006542"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006542"
FT                   /db_xref="GOA:Q5AZ45"
FT                   /db_xref="InterPro:IPR002076"
FT                   /db_xref="InterPro:IPR030457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ45"
FT                   /protein_id="CBF69479.1"
FT                   /translation="MHIPTPTLSRPFGVQLWPHFSRAFTALSGKSPADFQLVPGETPMT
FT                   TLQGTLLSLATYYVVVLGGRQLMKSQARFKLRIPFIIHNFILTVISGVLLALFLEQILP
FT                   TLSNDGVLHAICDARGGWTDELVLLYYLNYLTKYLELADTVFLVLKKKPLTFLHTYHHG
FT                   ATALLCYVELVGRTSVSWVPITLNLMVHVVMYWYYFQSARGIRIWWKRYITLLQIAQFV
FT                   IDIGFIYFASYTYFASTYFPWVPNAGYCMGEEYAAGFGVFIISSYLLLFISFYLTTYRE
FT                   KAPRFLSQARALGAKKGL"
FT   gene            complement(197545..199456)
FT                   /locus_tag="ANIA_06434"
FT                   /old_locus_tag="AN6434.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            complement(join(197545..197722,197789..197976,
FT                   198020..198377,198443..198998,199088..199183,
FT                   199224..199236,199364..199456))
FT                   /locus_tag="ANIA_06434"
FT                   /old_locus_tag="AN6434.4"
FT                   /note="transcript_id=CADANIAT00006543"
FT   CDS_pept        complement(join(197545..197722,197789..197976,
FT                   198020..198377,198443..198998,199088..199183,
FT                   199224..199236,199364..199456))
FT                   /locus_tag="ANIA_06434"
FT                   /old_locus_tag="AN6434.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006543"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006543"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006543"
FT                   /db_xref="GOA:Q5AZ46"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ46"
FT                   /protein_id="CBF69480.1"
FT                   /translation="MSLVMAVPHAFSVSDFGDIPTVLVSALSFILVSVWIKTSIDISQL
FT                   ETKLGFLSGRSAYKFNSLHKKYGKIVRFAPNQLSFNTIKGMRNIYGAGLGKSNTFLKTG
FT                   FYKAISRRNIFTATDPYYHATVRKLFSPSLSPGCMAAHEPVIKGCIARFHALVKQRMQS
FT                   QKAISLNDLYYSLSVDMVSEVLLGKSLGCIERGRPFFWTEQLPRIFYWATIRDQFKGSG
FT                   VPTLIKWMLRQILRKGIRQRSEEARMRLIREQLKATHTRRDVMVEVLERADSSTLPEDE
FT                   IAENFSAIMLAGFHTTSHAICATIWLVLSHPETRERLQNELRTAFQSTDEISLDVLAKL
FT                   PWLNAVITEALRVYPPVPLGGARISPGAYVDGFVAFLTGPQVEVSTSLYALHHNGEYFK
FT                   NPYKFAPERWVNPESTDRKEAVQPFLLGSRSCIAKYFAQQMLLLTLASFFVEFDGQYVG
FT                   KVKDWTTESRCYAFWELPELKVQLQERFASAEVSE"
FT   gene            200262..203031
FT                   /locus_tag="ANIA_06433"
FT                   /old_locus_tag="AN6433.4"
FT                   /product="Diacylglycerol acyltransferase family
FT                   (AFU_orthologue; AFUA_4G14150)"
FT   mRNA            join(200262..200818,200875..201513,201592..201975,
FT                   202044..203031)
FT                   /locus_tag="ANIA_06433"
FT                   /old_locus_tag="AN6433.4"
FT                   /note="transcript_id=CADANIAT00006544"
FT   CDS_pept        join(200262..200818,200875..201513,201592..201975,
FT                   202044..203031)
FT                   /locus_tag="ANIA_06433"
FT                   /old_locus_tag="AN6433.4"
FT                   /product="Diacylglycerol acyltransferase family
FT                   (AFU_orthologue; AFUA_4G14150)"
FT                   /note="transcript_id=CADANIAT00006544"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006544"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006544"
FT                   /db_xref="GOA:Q5AZ47"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ47"
FT                   /protein_id="CBF69482.1"
FT                   /translation="MAKNKTKTSVLFLANSEHGQTNIVLAIIHELLVRGGIDIHLASFP
FT                   VLEKRLNKLLHDNETAYDAEYSTRIHFHPVRGPSNTEIFIRTGKRGAFHPPGYTGSVLG
FT                   FKSLCEDIWGWTEEEYVDIYESCVEIINAIKPSLCAIDFFFLQGRDAAYNAGQTTVLLN
FT                   TTSLSHIVLGLQKNAKWAWKYPMPGTGFPYPLPPHLIPLNTMAVLKTAKMYHGSGRRRE
FT                   IRDWRIKHKIHGRFPFADSWMPNRLHLSPALKELDWPFDVPDNVVPCGPILLPVAPVKT
FT                   QDPEMFAWLHRGPTVLINLGTLYAPNPSVVLEIATGVKTFLASCSDRKIQVLWKLPKHP
FT                   HDQEEIYTQSVTPLQKEMEADQVRIRSWFEVEPLAMLQTGQIVCSVHHGGANSWYEAIQ
FT                   NGVPHVVLPAWQDCYENAARAEWLGIGAYGNKSRAPDIGGKELSKALIKVLGNKSYLEK
FT                   ASKLQKLCQKKEGRLEAADRIADLAARPDKSMIAVPEVDENDPRVVTVTNGKGETLQTV
FT                   NSVDEGAVNKSILRRLLEIITVAFISNTWFLLPLLGYSLLLVPHNGFRILVLSYILHIK
FT                   FFSNAHKTSAPKPSKWLRSSLMWKLHASYFPIRLYRSASLSPRRKYVIGAHPHGIACHG
FT                   IAGAFTADATGFETLFPGIVNRFLVKDGMFTAPLLREYLFARGQSGVSKDSCIQHLTRG
FT                   GYDLRGMGKAITISVGGSREYNIARPGTMGIVVKLRKGFIRLAVETGADLVPVLVFGEN
FT                   DLFAPIQFSRYSIKGLIAWAWEKAAGHKVAFSLGRFCMFIPFRRPLHVVVGRPISVKQQ
FT                   RFDVSEKYVEELQGQYIDELNRIWADWRNVFEEDASVKFEIVE"
FT   gene            complement(203167..203948)
FT                   /locus_tag="ANIA_10816"
FT                   /old_locus_tag="AN10816.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(203167..203459,203532..203948))
FT                   /locus_tag="ANIA_10816"
FT                   /old_locus_tag="AN10816.4"
FT                   /note="transcript_id=CADANIAT00006545"
FT   CDS_pept        complement(join(203167..203459,203532..203922))
FT                   /locus_tag="ANIA_10816"
FT                   /old_locus_tag="AN10816.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006545"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006545"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006545"
FT                   /db_xref="GOA:C8V0F4"
FT                   /db_xref="InterPro:IPR025509"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0F4"
FT                   /protein_id="CBF69484.1"
FT                   /translation="MLFFSRLTASLPCQPRLRMRFHRRISRLGGDSGAFPSVYAADRSC
FT                   HTGGQKTNSSSKSACKAQSQTDQNQKSDTSALLTRRFWTCRSTWRRAGINTLRCLVGCT
FT                   VGDFAALWTLQTYCPELGMGTIMAASMASGITTSIILETVLLRHGPDRLPWSAAVRTAM
FT                   GMSLVSMAAMEAAENLVDYHLTGGVINLNDPAFWIAAGVSIGAGFLAPLPYNYWRLRAL
FT                   GRSCH"
FT   gene            complement(204476..205690)
FT                   /locus_tag="ANIA_06432"
FT                   /old_locus_tag="AN6432.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(204476..205690)
FT                   /locus_tag="ANIA_06432"
FT                   /old_locus_tag="AN6432.4"
FT                   /note="transcript_id=CADANIAT00006546"
FT   CDS_pept        complement(204476..205690)
FT                   /locus_tag="ANIA_06432"
FT                   /old_locus_tag="AN6432.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006546"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006546"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006546"
FT                   /db_xref="GOA:Q5AZ48"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR026055"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ48"
FT                   /protein_id="CBF69485.1"
FT                   /translation="MEGTMPANEYVRHFENAVVLLTGATGSLGGCLLYKLALRLPTKKI
FT                   YALCRGSVGESVRKWESTMPQQIDEILDTGKVELITGDLSKPGLGLNPAIREEMREEVT
FT                   AVINTAANISLVEELKDSVRDNCQTAIALFQEVSEFRHVRHFIQFSSLAVNAFLTGGLI
FT                   EERLYSPPRTVDEEDDRLGLPGADSSKLQYDDRYPWPYVQAKHMLERLLLRQSSSISIL
FT                   IIRPAAIGPAIAEPFPLYGPDKAIPMHSLILCFSVSDLGRVANINRPFEEVPVDLVANC
FT                   CLLHLASGTTGVVHCASELYVRQTAVELMATARQCITPLEIAELFRTPRASTAILWQNK
FT                   YRLDNIDDVPVFEVDCSRSEWQKQVTGPLALRPVDHDPQAHLQRRIRRMYRALLGRNRS
FT                   DNRYP"
FT   gene            206271..214310
FT                   /locus_tag="ANIA_06431"
FT                   /old_locus_tag="AN6431.4"
FT                   /product="polyketide synthase, putative (JCVI)"
FT   mRNA            join(206271..206839,206918..206991,207095..207411,
FT                   207461..207584,207642..207712,207789..207800,
FT                   207859..210876,210933..211029,211088..211113,
FT                   211164..211974,212019..212350,212381..212476,
FT                   212525..212871,212917..213379,213435..214310)
FT                   /locus_tag="ANIA_06431"
FT                   /old_locus_tag="AN6431.4"
FT                   /note="transcript_id=CADANIAT00006547"
FT   CDS_pept        join(206271..206839,206918..206991,207095..207411,
FT                   207461..207584,207642..207712,207789..207800,
FT                   207859..210876,210933..211029,211088..211113,
FT                   211164..211974,212019..212350,212381..212476,
FT                   212525..212871,212917..213379,213435..214310)
FT                   /locus_tag="ANIA_06431"
FT                   /old_locus_tag="AN6431.4"
FT                   /product="polyketide synthase, putative (JCVI)"
FT                   /note="transcript_id=CADANIAT00006547"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006547"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006547"
FT                   /db_xref="GOA:Q5AZ49"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ49"
FT                   /protein_id="CBF69487.1"
FT                   /translation="MDANGEPKTEAAQHSMSNQSLLDMGGSAPIAIVGIGTRLPGGVNS
FT                   VPSMYEFLRKKKDGLREVPLSRFNIAGFHNDGDVAYSMRQQKSYFLDEDISMMDALFFG
FT                   SSEMETAGSDPRARLLLEVVYECLENAGKTRYRGEKIGCYIGAWGVDWSELTLKDGQQR
FT                   NPMIGAAAGSFFLSSYIAWSLDLRGPTLLRLYGSVARSLPVTIFWRVLVRDPDGFGRAE
FT                   AVNAVLLKPLDDAIRDGDVIRAVIRATAVNNDGRTLILTTPSAEAQEDLIRQAYRKAGI
FT                   EDFNETAYFECHGTGTMAGDTAETAAIAKIFHEGIYVGSAKPNFGHSEGTSGLTSLIKA
FT                   ILSLEKKTLLPHIHMREPNPNIPFESGRLMVPQEEIPWPEGRRERLIVFPTRLAYSRLL
FT                   VVSANSEKSLHKRIEDLQEYIKEKPDCLADLAFTLGERRDHLAQRAFLLESEALEIGAF
FT                   HIGTVDCKTTPEVTFVFTGQGAQWPAMGRALIESFGTFRETIQQLDQALQSLREPPAWK
FT                   LEALLGKDCSQEQISRAELAQPSCCAIQIGLVNLLADWGIAPASVVGHSSGEIAAAYAA
FT                   GAITASESIIIAYYRGKAMNKVTRKGGMAAVSIGREQATPYLVDRGVVIACENSQHSVT
FT                   LSGDLDELEDILEKIKADDPDVYCRMLRVDKAYHSHHMHDVAEDYESSLQGLSTSEGSL
FT                   FMVPLFSSVIGIKVTESSQLNGTYWRQNLESPVRFLTAVQAVLDSEEEKSRTFLEIGPH
FT                   SALSGPLRQILSEHPRGKVCSYVASLVRGEDPRTSVLYTAGNLYNSGVAVNLRAINCEG
FT                   NMLVDLPPYPWQHDTRYWDQTPAVEAWRLRKHPHHELLGSRVLGSTDIEPSWRNNLSLD
FT                   DAPWLYGHRIMGKTLFPGAGYIAMAGEAIQQLVSRPNVSYQISHLVLKHALFLDSNECV
FT                   ELITNLRPVRISDIQDSEWHEFSITAVQAGEATRLCLGQVRVAPPSVAPTMPLTGSTKL
FT                   KRRVMSAAWYKALREAGMDYNREFRGLDDIYGDPVRYEATATVKTNNVSPGRYVMHPTT
FT                   IDRCLQVLSIAMFRGLARSINIRSLPVLFEEIFIGPEHAELHVQAQADLGNGSFIRGDL
FT                   GAMADDETIFSIKGMRLHVLGDEGYSYQESELSARPVWMPHIDFLPPRSLAKPPRPVNI
FT                   VSELRDRIIDLYIAQTAPRVQYVEPTEEHLHKYKRWLMISENRIARQSTWRLSDYGYAH
FT                   DCPFDSSNPAAMTNWIRERSRDYPIIAPVVNCTQKVLDNIGGLLDGSCNALHLLMEDDG
FT                   LKEVYELLLSFDSCHEFFATLGHSNPELNILEVGAGTGSATARFLDYLHAPDGSRMYAR
FT                   YTFTDVSAGFLAAAKEQFSRYDTMEYAVLNISQDPAQQGFELSSYDLIIASNVVHATPS
FT                   LSCSLANLKSLLAPGGRLLLQEITEECILAEYIFGLLPGWWVGEHDQRIERPYVLVDRW
FT                   REELTGVGFNGIDFAIHEQNSPVVNLVATYPTTPLGANAVSLLVQEPRCQWVLDVEKIF
FT                   QKQGYKVEIYSLDQPPPAEGEVVSLLDASGPFLFNMTEGDFQQLKNSILSASVKHILWV
FT                   SKMSQFTSSDPRYGLIHGFLRALHFECHSEGKSFSTFDIEEFDERSIHSLLKVHDHWRR
FT                   AAPSEESRRDEYALVDGVVQVSRFEATDIEKELQIPVEDTAPRRLCIETTGLINSLYWK
FT                   QDQHIMPGKGKSSDIHGDANGLTQIKDIITALGLIASPDQLGLEGSGVVESVGTGVTNV
FT                   SKGDRVIFLGPGCFATHVTVPAAKAIPLPGNWSLEEGATSPIVSLTAAQCLLRLGNLRR
FT                   GQSSDTLVQSVLIHAAAGGVGIAAIRICKGVGAKIYTTVGNDEKAQYLVDTFGIPRAHI
FT                   FHSRNASFYDDLMRETGGRGADIVLSSLSGELLRTSWKCVAPHGIMFDISRRDVLAEAM
FT                   LPMKHFVDRRSFVTVDLGEYMEEAAANNSTDFSNPVKDGLVGPIAPVSCFAAADVANAF
FT                   RYMQSGQHMGKIVVRMPDNISELPTRDTRAHISFSPDTAYLLCGGLGGLGRALSNWMVE
FT                   RGARCLLYLSPSAGVGDDHQEFAEELECQGCEVVYVKGTASDASDVSRAISQSPKPIKG
FT                   VVQLALTLKDASLQRMTFEDWTTPLTAKVHGTWNLHQAFQDTPLDFFLMFGSIAGITGM
FT                   AGQCNYSAANSFIHALSRYRHSLNEPASVLDLGPVADIGYVSRNPELMKTFSGRYEWRF
FT                   IKEQEVLDAVEALIHHSTFPNTTPFTQGNRYDPNHIILGLIPIAPWGRRRGDTRFAILS
FT                   NVAQRDQSGAAEADDIVDFMAQVESDPEMLNRPSTEEFLILKVGTMIKSPSAKTRTKDS
FT                   IAAKHDLQVLANIQIDSLIAIEARAWARRRLGVQISLSEITAAGNVKGLVGLAIQEMKK
FT                   RYSIA"
FT   gene            complement(218571..220905)
FT                   /locus_tag="ANIA_06430"
FT                   /old_locus_tag="AN6430.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(218571..220223,220270..220810,
FT                   220859..220905))
FT                   /locus_tag="ANIA_06430"
FT                   /old_locus_tag="AN6430.4"
FT                   /note="transcript_id=CADANIAT00006548"
FT   CDS_pept        complement(join(218571..220223,220270..220810,
FT                   220859..220905))
FT                   /locus_tag="ANIA_06430"
FT                   /old_locus_tag="AN6430.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006548"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006548"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006548"
FT                   /db_xref="GOA:C8V0F7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0F7"
FT                   /protein_id="CBF69489.1"
FT                   /translation="MISAPGPERRRRRPAVSCSLCRRRKIKCNRESPCSNCIKSKAEPC
FT                   VYESDSSSRPQQHLGFNQTLELGLCKASERQMLPPDAVTSQVPSYASRSLLSSARDSSS
FT                   RTSQASASEVESLKTKIRQLEEQLSSATQPAESPPRPSPNSRIETSTSQIAGTFHINHE
FT                   RRLLHDSQFVNRNLVIHKSRLFGSSHWAQAASMFRDVFEMIEPFIRGSGSKASAGIRRC
FT                   KELARIIKTQRTPQWPTPPTQDLPPKGVADELVDCYLRTIETTFRVLHVPTFRSEYDAL
FT                   WVSEARPSIAFTVQLKLVLALGSVTYDERFSMRPSAVRWVFEAHTWLSDPDFKPQLNIQ
FT                   CLQSRILLLLAREIINVGGDSSWISAGGLLRTALHMGLHRDPSVLPPRSALAVEMRRRL
FT                   WNTILELSLQSSISSGGPPLISLGDFDCAPPGNFDDEQLLAEDPVPKSDDEYTQTAIAR
FT                   ALRGTYPQRLAIVKFLNDLSSYGTYEETLRLDADLRESYRAICRILRGYPSNGPSPSQF
FT                   EKCMLDFIIHFYVCCLHIPYIEKSLRAPAYAFSRKVAIESALKMWCAIYPSSRFMSNTR
FT                   REISGSVENKLTRFVECGFGFFRTGVIIAAMFVTLELKAQLLDDDSLGPSPYRVDLFSL
FT                   LCEAKDRCWNMIQCGETNVKGYLLICLVTAQIEGLMHGVEPSKLPELLLRAAEEAEDRC
FT                   LDFMEEKADLGRSGGSVEVMDESANTAPFMGDWEFIVSVCNLENCSMPTAFR"
FT   gene            221236..222640
FT                   /locus_tag="ANIA_06429"
FT                   /old_locus_tag="AN6429.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(221236..221628,221681..222640)
FT                   /locus_tag="ANIA_06429"
FT                   /old_locus_tag="AN6429.4"
FT                   /note="transcript_id=CADANIAT00006549"
FT   CDS_pept        join(221236..221628,221681..222640)
FT                   /locus_tag="ANIA_06429"
FT                   /old_locus_tag="AN6429.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006549"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006549"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006549"
FT                   /db_xref="GOA:Q5AZ51"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ51"
FT                   /protein_id="CBF69490.1"
FT                   /translation="MFDSVSDPQRTMAAPEQTIRDLEASSDSTIYIRPGTTNEKASQET
FT                   PTNPESFSPAPDGGIKAWLVAIGASCTIFSTLGFSNSFGVLQEYYAVHQLQNESSDRIA
FT                   WIGSLAAFLQFATGAIAGPLFDRYGAWVIRPPAIAYVFALMMTSLCTKYWQFMLAQAVL
FT                   VGISSGMLQFPAMAAVSQYFDKKRGAALGLAIAGSSIGGVVFPIALSKMLNSSSISFGW
FT                   AIRIIAFIMLPMMLFTCLTVTARLPSRTTAFFIPSALSSPLFVLLILAMFFMFLGMFSP
FT                   IFFIPTYAVSRGMDATLASYLSAILNGASTFGRIIPGILADRFGRINAFGLGGLATGII
FT                   ICCMNEAQSNASLIVFSAVFGFWSGTVISGGSAALTAVPKNPQEFGTYLGMGIALSGCA
FT                   VLIGPPVSGVLVDHYGGFFELSIFSGIVCLAGGIIALLSKAVTDQGLFGRI"
FT   gene            complement(222917..223737)
FT                   /locus_tag="ANIA_06428"
FT                   /old_locus_tag="AN6428.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(222917..223200,223258..223611,
FT                   223680..223737))
FT                   /locus_tag="ANIA_06428"
FT                   /old_locus_tag="AN6428.4"
FT                   /note="transcript_id=CADANIAT00006550"
FT   CDS_pept        complement(join(222917..223200,223258..223611,
FT                   223680..223737))
FT                   /locus_tag="ANIA_06428"
FT                   /old_locus_tag="AN6428.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006550"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006550"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006550"
FT                   /db_xref="GOA:Q5AZ52"
FT                   /db_xref="InterPro:IPR005103"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ52"
FT                   /protein_id="CBF69492.1"
FT                   /translation="MKSGLLFTTASLALTASAHYVFPALVQDGAATGDWKYVRDWTGSY
FT                   GNGPVEDVTSLDIRCNKDASTNGNATETLPVKAGEEIGFTVRTNIGHPGPLLAYMAKAP
FT                   GDASDFDGDGQVWFKIYEDGPTVTDDGLTWPSDGATNVNFTIPSSLPDGDYLLRVEHIA
FT                   LHGAGTEGGAQFYLSCGQVSVTGGGNGDPAPLVAFPGAYDPTDPGILINIYWPVPTNYT
FT                   PPGPKVWSG"
FT   gene            225257..226710
FT                   /locus_tag="ANIA_06427"
FT                   /old_locus_tag="AN6427.4"
FT                   /product="Endo-beta-1,4-mannanasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5AZ53]"
FT   mRNA            join(225257..225409,225461..225787,225862..226324,
FT                   226408..226597,226644..226710)
FT                   /locus_tag="ANIA_06427"
FT                   /old_locus_tag="AN6427.4"
FT                   /note="transcript_id=CADANIAT00006551"
FT   CDS_pept        join(225257..225409,225461..225787,225862..226324,
FT                   226408..226597,226644..226710)
FT                   /locus_tag="ANIA_06427"
FT                   /old_locus_tag="AN6427.4"
FT                   /product="Endo-beta-1,4-mannanasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5AZ53]"
FT                   /note="transcript_id=CADANIAT00006551"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006551"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006551"
FT                   /db_xref="GOA:Q5AZ53"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZ53"
FT                   /protein_id="CBF69494.1"
FT                   /translation="MIFSTLLSLALLATTATARKGFVTTKGDKFQLDGKDFYFAGSNAY
FT                   YFPFNNNQTDVELGLSAAKKAGLLVFRTWGFNDKNVTYIEDGLPQYGGEGAGTTEVVFQ
FT                   WWQNGTSTIDLEPFDKVVNAAAKTGIKLIVTLVNNWADYGGMDVYTVNLGGQYHDDFYR
FT                   LPQIKKAYKRYVKEMVTRYRNSPAIMAWELANEPRCGADGVRNLPASDECTPELLTSWI
FT                   DEMSTYVKRLDPHHLVTWGGEGGFNYDSDDWAYNGSDGGDFEAELKLKNIDFGVFHSYP
FT                   DWWSKTVEWTNKWIVDHARAARRVGKPVVHEEYGWLTPQGRLDNLGTVSNITRLEAVGG
FT                   WQSISLREKMSDMFWQFGYSGYSYGRNHDDGFTIYLDDAEAQELVYKHAKEVNKLNRRR
FT                   "
FT   gene            229009..230268
FT                   /locus_tag="ANIA_06426"
FT                   /old_locus_tag="AN6426.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(229009..229496,229555..230268)
FT                   /locus_tag="ANIA_06426"
FT                   /old_locus_tag="AN6426.4"
FT                   /note="transcript_id=CADANIAT00006552"
FT   CDS_pept        join(229021..229496,229555..230080)
FT                   /locus_tag="ANIA_06426"
FT                   /old_locus_tag="AN6426.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006552"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006552"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006552"
FT                   /db_xref="GOA:Q5AZ54"
FT                   /db_xref="InterPro:IPR008754"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ54"
FT                   /protein_id="CBF69496.1"
FT                   /translation="MRFLPLLLTAGLGSLQLAAARCGTRNPSERVHAQHRYFLDMEDRE
FT                   AAARASVGVTTREAFDVTIDTFVHVIITNSTAGINMTTLPSQIDEQIDVLNENYLGTGF
FT                   QFNLVNVSYTHNNAWQAISDGSTTEYEVKSTLRQGDYTTLNLYYGKIGDGILGYATFPD
FT                   KVTEQEFIMDGVVCDPQSLPGGKPPYDRGITAVHEIGHWLNLFHTFQPGNSDSMNAGCF
FT                   GHGDYIHDTPAEAYAAFGCPIGRDTCKGAVESNNTYSIPGTDPIHNFMDYTEDECLTHF
FT                   TEGQITRMRNSWKEERVGYTSDSPSAERRGLNLGVAVDADLKGKIAKPGSGW"
FT   gene            complement(231773..232692)
FT                   /locus_tag="ANIA_06425"
FT                   /old_locus_tag="AN6425.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(231773..232052,232150..232357,
FT                   232602..232692))
FT                   /locus_tag="ANIA_06425"
FT                   /old_locus_tag="AN6425.4"
FT                   /note="transcript_id=CADANIAT00006554"
FT   CDS_pept        complement(join(231773..232052,232150..232357,
FT                   232602..232692))
FT                   /locus_tag="ANIA_06425"
FT                   /old_locus_tag="AN6425.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006554"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006554"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006554"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ55"
FT                   /protein_id="CBF69497.1"
FT                   /translation="MRHGQDMQFCAVADIYHAPLNPRNARCVARASPYRIAAKLLVGTT
FT                   SLTPAFLAALRTRFVPCTAGKISSSSLAGGALGKGDAICWTYVASFMASVQPVSISDCR
FT                   GHAVVLLKQCGNDPFCDEAGAAGYEDEGRDWSWGSGMTGDEICLGMGNLAGKNPGGDEA
FT                   RLGYRRTKYLGGELCDEPVTGGEGFARDG"
FT   gene            232510..232965
FT                   /locus_tag="ANIA_10818"
FT                   /old_locus_tag="AN10818.4"
FT                   /product="hypothetical protein"
FT   mRNA            232510..232965
FT                   /locus_tag="ANIA_10818"
FT                   /old_locus_tag="AN10818.4"
FT                   /note="transcript_id=CADANIAT00006553"
FT   CDS_pept        232510..232965
FT                   /locus_tag="ANIA_10818"
FT                   /old_locus_tag="AN10818.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006553"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006553"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006553"
FT                   /db_xref="GOA:C8V0G3"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0G3"
FT                   /protein_id="CBF69499.1"
FT                   /translation="MELVAINPVCAYGPAFGKEDSTTLRSITELTSGNAPGIPRIQWGV
FT                   VDVRDCAELHVLAMTHEEAPAQRFICIGEGMMWMSEMAATVKRNMGDKAKRVTTFQPRI
FT                   SLCELRRFLCRLRGWSCRTWGAIEMFEVTRRETYWSGSGCIRTKRRS"
FT   gene            complement(234558..235316)
FT                   /locus_tag="ANIA_06424"
FT                   /old_locus_tag="AN6424.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(234558..234688,234791..235316))
FT                   /locus_tag="ANIA_06424"
FT                   /old_locus_tag="AN6424.4"
FT                   /note="transcript_id=CADANIAT00006555"
FT   CDS_pept        complement(join(234558..234688,234791..235316))
FT                   /locus_tag="ANIA_06424"
FT                   /old_locus_tag="AN6424.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006555"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006555"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006555"
FT                   /db_xref="GOA:Q5AZ56"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ56"
FT                   /protein_id="CBF69500.1"
FT                   /translation="MDTQASLPGFKEHPIVHGLYYQSDFITRDHEEQLITLFRTQLTWP
FT                   DRPGRISVHYGYTFDYKTFGIDPDIPYKPFPDWLVPLLPKTESRPPDQVCLQYYPPGAG
FT                   IPPHVDSHRGWDQLYALSIGAPVLMRLRHGKTGEERVDVDLEGRSMMCFSGPARLYWTH
FT                   GIAKKKNDHMPDELLGIEKEKRSVLGAMVREAEKGLESEGRMTSPQKADDGDVKA"
FT   gene            complement(235477..236123)
FT                   /locus_tag="ANIA_06423"
FT                   /old_locus_tag="AN6423.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(235477..236123)
FT                   /locus_tag="ANIA_06423"
FT                   /old_locus_tag="AN6423.4"
FT                   /note="transcript_id=CADANIAT00006556"
FT   CDS_pept        complement(235556..236077)
FT                   /locus_tag="ANIA_06423"
FT                   /old_locus_tag="AN6423.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006556"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006556"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006556"
FT                   /db_xref="GOA:Q5AZ57"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ57"
FT                   /protein_id="CBF69502.1"
FT                   /translation="MSTIHTYAITPFIQGLKALTAILKKGEEHAKANNIPLEDLVNASL
FT                   IADMKPLSFQVFIATNTAVKLVSRATFVEPPAQSDTDKTFDDFYKRIDEALAVLEKADA
FT                   QTIAANEGKTFKAPLGPREFEFTPESYTNSYAVPNFYFHLVTAYDILRAKGVPVGKMDY
FT                   LKDFLGDIAA"
FT   gene            complement(236547..237561)
FT                   /locus_tag="ANIA_06422"
FT                   /old_locus_tag="AN6422.4"
FT                   /product="cellulose-binding GDSL lipase/acylhydrolase,
FT                   putative (AFU_orthologue; AFUA_2G00510)"
FT   mRNA            complement(join(236547..236908,236964..237076,
FT                   237122..237561))
FT                   /locus_tag="ANIA_06422"
FT                   /old_locus_tag="AN6422.4"
FT                   /note="transcript_id=CADANIAT00006557"
FT   CDS_pept        complement(join(236547..236908,236964..237076,
FT                   237122..237561))
FT                   /locus_tag="ANIA_06422"
FT                   /old_locus_tag="AN6422.4"
FT                   /product="cellulose-binding GDSL lipase/acylhydrolase,
FT                   putative (AFU_orthologue; AFUA_2G00510)"
FT                   /note="transcript_id=CADANIAT00006557"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006557"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006557"
FT                   /db_xref="GOA:Q5AZ58"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ58"
FT                   /protein_id="CBF69504.1"
FT                   /translation="MKTLPLALLASASTALAIPPQHNRYPARQSATKYLISFGDSYTST
FT                   SFNITGEKPSASNPLGNPPFPGWTSAGGANWIGDLVGTYNNSLLLNYNFAYGGATVNAS
FT                   LVAPYTPEVYSLIDQVAEFNEYLVPPPNFAPWSTNNTLFAIWQHTRGVNDVGGSWYQTN
FT                   PDALATEILTQLFQQIELIYAETNERSPLIIPATDRSPYITQGENADYTVTHLKAAIAS
FT                   WNTQFTEKAAAFAAAHSDAVVKVIDTQPVFNEILDAGGEAADCWNEDGVTCLWFNDYHP
FT                   GLVIQDAVAQAVADAWGDFFVVP"
FT   gene            complement(237921..239085)
FT                   /locus_tag="ANIA_06421"
FT                   /old_locus_tag="AN6421.4"
FT                   /product="urea hydro-lyase/cyanamide hydratase, putative
FT                   (AFU_orthologue; AFUA_1G10870)"
FT   mRNA            complement(join(237921..238076,238247..238286,
FT                   238322..238511,238560..239085))
FT                   /locus_tag="ANIA_06421"
FT                   /old_locus_tag="AN6421.4"
FT                   /note="transcript_id=CADANIAT00006558"
FT   CDS_pept        complement(join(237921..238076,238247..238286,
FT                   238322..238511,238560..239085))
FT                   /locus_tag="ANIA_06421"
FT                   /old_locus_tag="AN6421.4"
FT                   /product="urea hydro-lyase/cyanamide hydratase, putative
FT                   (AFU_orthologue; AFUA_1G10870)"
FT                   /note="transcript_id=CADANIAT00006558"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006558"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006558"
FT                   /db_xref="GOA:Q5AZ59"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR017771"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ59"
FT                   /protein_id="CBF69506.1"
FT                   /translation="MSNSIAKHGFASVPANTNTLFSEVDLKAKSYPIAVPVSETPIPDT
FT                   PLCRRIQECARTRLPQPTYHHSLRVYHYGLAIKRYAFPDWSFSDETYFLACMLHDIGTT
FT                   RENLHATKLSFEFYGGYLALDVLQTQYDAGDAIASKDQAESIAEAIIRHQDLRDVGSIT
FT                   ALGQLVQLATIFDNVGGHASLVHDDTVKDVVEHYPRLKWSSCFAATVAEEVELKPWAHT
FT                   TALGDFKGHILANPYNSFYLRQYAHEYARQLSFSKLSRMSCQNSILDKEFYQRHRTSGT
FT                   PLPKFFTSAANASDRAIFQEGP"
FT   gene            complement(242409..243275)
FT                   /locus_tag="ANIA_06420"
FT                   /old_locus_tag="AN6420.4"
FT                   /product="pirin domain protein, putative (AFU_orthologue;
FT                   AFUA_2G01100)"
FT   mRNA            complement(242409..243275)
FT                   /locus_tag="ANIA_06420"
FT                   /old_locus_tag="AN6420.4"
FT                   /note="transcript_id=CADANIAT00006559"
FT   CDS_pept        complement(242409..243275)
FT                   /locus_tag="ANIA_06420"
FT                   /old_locus_tag="AN6420.4"
FT                   /product="pirin domain protein, putative (AFU_orthologue;
FT                   AFUA_2G01100)"
FT                   /note="transcript_id=CADANIAT00006559"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006559"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006559"
FT                   /db_xref="GOA:Q5AZ60"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ60"
FT                   /protein_id="CBF69507.1"
FT                   /translation="MSKPLTHAKIIARRSADRGYAEHGGWLKTYHTFSFASYYDHRFTN
FT                   FGSLRVLNEDRVAARNGFPTHPHRDAEIFSYILSGELTHRDSMVRKGAEGAQGKDFYRM
FT                   KRGDVQFTTGGTGIAHSEQNESSKPVHFLQIWALPWKYGLKPNYHTKTFDEGAKRKEFV
FT                   PILSPLKAGVEATPKEEEEAVPAIPETIPIHADFVMGAGIVAPNGRFEWIVGSKDGVVQ
FT                   KKKKRNVYVHLPMTKGGKAKIRLDSRDDALLEEGDGAFITGVNAGDILGVESVGEVEAE
FT                   VIVLDSD"
FT   gene            244888..246927
FT                   /locus_tag="ANIA_06419"
FT                   /old_locus_tag="AN6419.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(244888..244920,245131..245267,245454..245466,
FT                   245716..246122,246468..246927)
FT                   /locus_tag="ANIA_06419"
FT                   /old_locus_tag="AN6419.4"
FT                   /note="transcript_id=CADANIAT00006560"
FT   CDS_pept        join(244888..244920,245131..245267,245454..245466,
FT                   245716..246122,246468..246927)
FT                   /locus_tag="ANIA_06419"
FT                   /old_locus_tag="AN6419.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006560"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006560"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006560"
FT                   /db_xref="GOA:Q5AZ61"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ61"
FT                   /protein_id="CBF69509.1"
FT                   /translation="MRGAAGIKSGKEERSDQGQSATTRAKQRRKRHWSWLAAGLNDPPR
FT                   SEPCPPGPARQRISVSMSVPDRGWVILAVSWPLFSICLVLVGLRVWVRTRIIKSWGWDD
FT                   PFILLAFLCATMNSIFVTVSAHYGTGHHASDLSDYQRIESTKFNWLSQGFHVMSTNWGK
FT                   VSVAIFLLRIIHKVKHHRPMMYGGIVLLTVVNTVAMIAAIVKTINLASLAARADYPWDT
FT                   VDLTIWIAVEQYLIILAACIPTLTPLFNIAVRQRTSKKSTSNVNYKAGHHSGRSHPYDG
FT                   LASGGIGKCEPDGYPLAWTRVERARAGSHSDSEDPIMATTESGRGILMTTEFHVQTGSE
FT                   NGDEHVERR"
FT   gene            247738..250016
FT                   /locus_tag="ANIA_06418"
FT                   /old_locus_tag="AN6418.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_2G17840)"
FT   mRNA            join(247738..248072,248148..248340,248400..248444,
FT                   248503..248980,249036..249466,249584..249694,
FT                   249969..250016)
FT                   /locus_tag="ANIA_06418"
FT                   /old_locus_tag="AN6418.4"
FT                   /note="transcript_id=CADANIAT00006561"
FT   CDS_pept        join(247738..248072,248148..248340,248400..248444,
FT                   248503..248980,249036..249466,249584..249694,
FT                   249969..250016)
FT                   /locus_tag="ANIA_06418"
FT                   /old_locus_tag="AN6418.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_2G17840)"
FT                   /note="transcript_id=CADANIAT00006561"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006561"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006561"
FT                   /db_xref="GOA:Q5AZ62"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ62"
FT                   /protein_id="CBF69511.1"
FT                   /translation="MDDPKVQTAETPTRSILDAEKGSGNVDLEELGEREGYVLDTSLVQ
FT                   NQHQHQHLKTTPDGKTVLIPQPSDSPNDPLNWSSFRKHLILIVVSATAFLPDYGSATGA
FT                   VTLIPQAAAWNMTQDHVNHSQVGNVFMLGAGGPLVVALSAYFGRFPVLFWFVVIALATA
FT                   IWCTAAQSFESFMAARILNGFFSTVAQGGGLMFIKDMFFFHEHPRKINIWSAFIVLSPY
FT                   MGPLFAAFITTTQIWQWAFGVYSIETGLCLIAIALFVEETYYDRRNKSYELVPNGPRWK
FT                   RMLGIQQRQSGYIVNTVTDAAMRPIKVIVKPVVLIATLYYLLTFAWVVGINTTLSIFLG
FT                   PLYGFGSKQIGFFYFTPIVAAILGEVTGHWLHDSMAALSSKRNGGRLEPEARLLAIYIA
FT                   TPFMVAGLILLGFALEEAYHYMIAALGWGLYVFGIMIVTVAINAYVLDSYPEASGEVAA
FT                   WINFGRTTGGFVVSYFMVTWAGDQGAKRQFGTMTGIISAYDIIELVEIERFIQKTVLIL
FT                   YSSSITLTWCLRMSASYIICNLRHLSGCF"
FT   gene            251723..253672
FT                   /locus_tag="ANIA_06417"
FT                   /old_locus_tag="AN6417.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_5G00430)"
FT   mRNA            join(251723..251777,251822..251889,251955..253070,
FT                   253227..253279,253409..253459,253567..253579,
FT                   253670..253672)
FT                   /locus_tag="ANIA_06417"
FT                   /old_locus_tag="AN6417.4"
FT                   /note="transcript_id=CADANIAT00006562"
FT   CDS_pept        join(251723..251777,251822..251889,251955..253070,
FT                   253227..253279,253409..253459,253567..253579,
FT                   253670..253672)
FT                   /locus_tag="ANIA_06417"
FT                   /old_locus_tag="AN6417.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_5G00430)"
FT                   /note="transcript_id=CADANIAT00006562"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006562"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006562"
FT                   /db_xref="GOA:Q5AZ63"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ63"
FT                   /protein_id="CBF69513.1"
FT                   /translation="MESQTLFHEPPGTVTIEDLHHGEEAVVVLKPTPSEDPNDPLNWSK
FT                   LRKLVNFALASFYTLATFVLLDIGTVIWVQLNAELDISWSNLNNSFALNLAGLAIGCIL
FT                   IVPFAIKYGRRSIYILSSVVQLATAIWQAKMNTTAELLAINALNGLAGAVSEAIVQMTI
FT                   VDIFFVHQRASANAFYNFMVNTGAYLAPVAAGYCATAQGWRWIWWWTSIMLAINTLLFL
FT                   LAFEETKYIPILFGQAREHVHTDSKARYEQPGMKSSGSTQATGELAMETEAYRRKPYRE
FT                   RLALITKTDNPIWENVKRPLVVLVSFPAVTFTAFVWGCFLSWFSIIATTQSSYLALPPY
FT                   NYNSSQIGLFNLPPFIGGVIGGVLSGPVNDWYVLWRAKRSNGVFEPETRLHMSLPAIIA
FT                   TPIGLLVFGIGLAREVCSSSLLPLCSAYPDEAVYCDGHDADDYPNDRIWYFGE"
FT   gene            255195..255674
FT                   /locus_tag="ANIA_06416"
FT                   /old_locus_tag="AN6416.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            255195..255674
FT                   /locus_tag="ANIA_06416"
FT                   /old_locus_tag="AN6416.4"
FT                   /note="transcript_id=CADANIAT00006563"
FT   CDS_pept        255195..255674
FT                   /locus_tag="ANIA_06416"
FT                   /old_locus_tag="AN6416.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006563"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006563"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006563"
FT                   /db_xref="GOA:Q5AZ64"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ64"
FT                   /protein_id="CBF69515.1"
FT                   /translation="MASSFNDSTIGPRASPTLFPTRTIACRNEPFTQHKITAPSCAMPT
FT                   KPCQYMQAHQQWNTTRYAPQLHRHPQDHQAPLMDTPIPLEGHIFSWTARRQGAGGINAS
FT                   LDEALEDFIAGVDAEMKGGLALMPPDPSSGSNWPGRDVEELGVGRGIVVEWMEMQ"
FT   gene            complement(256164..257635)
FT                   /locus_tag="ANIA_06415"
FT                   /old_locus_tag="AN6415.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(256164..256804,256909..257271,
FT                   257402..257455,257521..257635))
FT                   /locus_tag="ANIA_06415"
FT                   /old_locus_tag="AN6415.4"
FT                   /note="transcript_id=CADANIAT00006564"
FT   CDS_pept        complement(join(256164..256804,256909..257271,
FT                   257402..257455,257521..257635))
FT                   /locus_tag="ANIA_06415"
FT                   /old_locus_tag="AN6415.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006564"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006564"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006564"
FT                   /db_xref="GOA:Q5AZ65"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ65"
FT                   /protein_id="CBF69517.1"
FT                   /translation="MCCPGTSLAKRRVVYAIRGRMLIESQLVAAAICGVGVPLKDHGLG
FT                   KNIWTVPFSDITLIKLSMLFLYLRLFPNTLLRKAVFVSLAITSLWAIGSFLAQVLSCKP
FT                   ISYYWNQWDGEHEGRCASHNSLLLAHSIINIFLDVLVIALPMPVLVKLQMSIEKRVGMC
FT                   LMFAVGLVYVVFLILRQHYSSLHNSFSDRVPSEDFVPVGVWSLLEIDVGIMCSCMPGIR
FT                   ALTKRLYSTLFKTDGQPSSGYRYGSRQSKPGSGGSGSGSAHRVQSSFKSGSSNSNAGGG
FT                   GQFIRLKEVDSREVDTTNHLWPLREFPAVTVPPKDSVRVTRADVQTQGHPWQEYSDDSK
FT                   PSPLLPPARYEDPRAHYCLFSKAAIARASKGSSHFTWFRDGDSTYSKCLN"
FT   gene            complement(260626..262493)
FT                   /locus_tag="ANIA_06414"
FT                   /old_locus_tag="AN6414.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            complement(join(260626..261507,261697..262230,
FT                   262305..262362,262447..262493))
FT                   /locus_tag="ANIA_06414"
FT                   /old_locus_tag="AN6414.4"
FT                   /note="transcript_id=CADANIAT00006565"
FT   CDS_pept        complement(join(260626..261507,261697..262230,
FT                   262305..262362,262447..262493))
FT                   /locus_tag="ANIA_06414"
FT                   /old_locus_tag="AN6414.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006565"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006565"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006565"
FT                   /db_xref="GOA:C8V0H4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0H4"
FT                   /protein_id="CBF69518.1"
FT                   /translation="MIKSLPAAGTLSCLVRMMERSWKYIAIACALWVVQKIYSAITSPL
FT                   RAIPGPFYTSLTRLPLKLSIIAGQRIYFIHSLHQRYGPIVRVSPTEVSIASLPEFREIH
FT                   RVGSPFLKSNWYEKFVMGQHSPGVFAISDPKQHGARRRLFARAMSNTELRRVWEDVVRS
FT                   KVRLAVDRIKGELEADGARCDVLKWWTFLATDVVGHLMFGEDFDMLNIGVKNEYIHVLE
FT                   STMKGSGINAELPLVGCIGRHLPFSVVRSMFRANDYLTNYGKRAVTNARAKSDSSRNIF
FT                   SGMLYEAEKCTDSDSGLSELDIITEAGNMIVAGSDTTAVTLTYLVWVVLSRPQLQREIE
FT                   SEVLALEEGYDDAKLETLPVLNAVIKETLRLYGAAPGSLPRTVPRGGATLGGYFIPEGM
FT                   TVSTQSWTVHRDENLFPDPDSFNISRWLEENDAGFPAAQLAFSPFGAGGRICLGIHLAY
FT                   MELRLAAAEFFRRCRGVRLSPDTTWKIMKPMNYFLIAPTGNRCDIMRG"
FT   gene            complement(263853..265169)
FT                   /locus_tag="ANIA_06413"
FT                   /old_locus_tag="AN6413.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_4G00600)"
FT   mRNA            complement(join(263853..264372,264440..264945,
FT                   265005..265169))
FT                   /locus_tag="ANIA_06413"
FT                   /old_locus_tag="AN6413.4"
FT                   /note="transcript_id=CADANIAT00006566"
FT   CDS_pept        complement(join(263853..264372,264440..264945,
FT                   265005..265169))
FT                   /locus_tag="ANIA_06413"
FT                   /old_locus_tag="AN6413.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_4G00600)"
FT                   /note="transcript_id=CADANIAT00006566"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006566"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006566"
FT                   /db_xref="GOA:Q5AZ67"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ67"
FT                   /protein_id="CBF69520.1"
FT                   /translation="MTANFPIRTHAQRSVLGCSFVFSILAITAVLLRLLAHKIARKKWT
FT                   LSDYFIIMACTFSVGLQCISITGVFRAGIGYDHVSVIVADPRWGTEPIITVSKLIVPLQ
FT                   FVWVLSLSCTKISILFLYLRIFPVRWLVISSYATMAVIVAWAIATILAGCLICRPFAYN
FT                   WDKTIPGGYCGDQVTSFTITGIINLVTDVVVLVLPMRNLSKLQMATYKKITLIAVFGLG
FT                   AVTCVISALRISVLSTMNFADITYTIPKANIFSGIEPCLAVILASVPMMRPLLGRKGGS
FT                   TDATGQTPVYSDSNSHPHPHSKSLSKSRGNRNSRIGDDGFQPLDDDTSQLWLRPLGPKH
FT                   HVGVKVSQDTVTGDGESTGSLESLSETRGKMAKRGPGIGVGSGITVKQEWNVGESR"
FT   gene            complement(267479..269222)
FT                   /locus_tag="ANIA_06412"
FT                   /old_locus_tag="AN6412.4"
FT                   /product="MFS multidrug transporter, putative
FT                   (AFU_orthologue; AFUA_2G00780)"
FT   mRNA            complement(join(267479..267573,267649..267822,
FT                   267897..269022,269084..269222))
FT                   /locus_tag="ANIA_06412"
FT                   /old_locus_tag="AN6412.4"
FT                   /note="transcript_id=CADANIAT00006567"
FT   CDS_pept        complement(join(267479..267573,267649..267822,
FT                   267897..268710))
FT                   /locus_tag="ANIA_06412"
FT                   /old_locus_tag="AN6412.4"
FT                   /product="MFS multidrug transporter, putative
FT                   (AFU_orthologue; AFUA_2G00780)"
FT                   /note="transcript_id=CADANIAT00006567"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006567"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006567"
FT                   /db_xref="GOA:C8V0M4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0M4"
FT                   /protein_id="CBF69522.1"
FT                   /translation="MAGQILQSIASASVWIVAFATLVDNVDERSKGKVTATAMSFISMG
FT                   IFAGPMVSGFLLELVGYWPAWFAALLLLVVDFLARLLMIETPSARKSESASDAQEQSPL
FT                   LAASSGQTAQDHENETGTAAGDAKSAASRGFYRIMLTNPQILASMFNTLALSLTLASFD
FT                   TTLPLHVRDVFGWGSLPVGLIFFCLQIPTIALGPGVGWLRDRIGLRYPTTVSCGLLAPL
FT                   LWLLSVPGEEFPWGKLGGDKTGQVVYILAIVGIGFCLAFTRGAGTFQMMAVIHELERDN
FT                   PSMFGPHGGNSRLSGLIELPFNIGMMVGPLLSGSFSEYLGYYWTCFVLAVIAMLVAISS
FT                   WLYLTAQGQDVREMEEEGMI"
FT   gene            complement(270042..270637)
FT                   /locus_tag="ANIA_06411"
FT                   /old_locus_tag="AN6411.4"
FT                   /product="GNAT family N-acetyltransferase, putative
FT                   (AFU_orthologue; AFUA_3G00870)"
FT   mRNA            complement(join(270042..270570,270630..270637))
FT                   /locus_tag="ANIA_06411"
FT                   /old_locus_tag="AN6411.4"
FT                   /note="transcript_id=CADANIAT00006568"
FT   CDS_pept        complement(join(270042..270570,270630..270637))
FT                   /locus_tag="ANIA_06411"
FT                   /old_locus_tag="AN6411.4"
FT                   /product="GNAT family N-acetyltransferase, putative
FT                   (AFU_orthologue; AFUA_3G00870)"
FT                   /note="transcript_id=CADANIAT00006568"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006568"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006568"
FT                   /db_xref="GOA:Q5AZ69"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ69"
FT                   /protein_id="CBF69524.1"
FT                   /translation="MCFPLSAEHITAKRDRTPLTSTMAVTNPTISLPQNYILRVGTPPV
FT                   PSYLHLRLTSGLSPKTPAQAAAVAAGTWYGCYITYTDPSGDSPEPVPVAMGRIISDGSW
FT                   YFHVVDMAVLPEHQRKGLGDSILKNLLGYIMDNKAEGEPYVNLLADEPGRKLYRRNGFV
FT                   DAMPHSLGMFWEGNR"
FT   gene            complement(273441..276756)
FT                   /locus_tag="ANIA_06410"
FT                   /old_locus_tag="AN6410.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(273441..273463,273561..275239,
FT                   275311..275965,276017..276074,276143..276396,
FT                   276450..276756))
FT                   /locus_tag="ANIA_06410"
FT                   /old_locus_tag="AN6410.4"
FT                   /note="transcript_id=CADANIAT00006569"
FT   CDS_pept        complement(join(273441..273463,273561..275239,
FT                   275311..275965,276017..276074,276143..276396,
FT                   276450..276756))
FT                   /locus_tag="ANIA_06410"
FT                   /old_locus_tag="AN6410.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006569"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006569"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006569"
FT                   /db_xref="GOA:Q5AZ70"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ70"
FT                   /protein_id="CBF69525.1"
FT                   /translation="MSRNSFHTRWKSTTRSAAPLPDPSTKWSQVGPAKEHLVQQLETLY
FT                   WEGVRGEIENIIRTLRIFQAPEYADGLIDNVGENDIHGYDTFLDQVNQQARAFALRYRD
FT                   ERTEYNGLATTRVLDSEKAVRDLTYDIIAERSSARVTAEVRENLTSEPTTTPSLEGIPT
FT                   NELPKTTRKDLVSKGKHGYCFRQQMIEDRPDQRRPKRVPGIPQLVAKSMGTPVEFRVLK
FT                   CAQCHNAITGSMFTRRNEEFATSTICEGCYWAHHYGDQSYVKQYKHSIVEDAIELAERQ
FT                   GSCKCEQNTKQLTGWYHLKFKDGNHYQISATKSCPVFKISQGISNVKYKGLLATAGLEP
FT                   PVRKRFGLSRVASKLKRHSLSTIGQASPLAPEELASKLYLQSSTGRAKADEDVPLFARE
FT                   CVVENPFSYVHMVLRVGPILIERMSETNVLITLKELPVFHDRFHIRGNQHMLRMDLEAA
FT                   AQLWYCEQPVSKPKRYKLAMKQVVGAPFSGLLSEGEEGQAQQETVQLLLAAANALDLGL
FT                   SSAEQSKVLAAATTPILDKLKNILGARLKIYLQAIGERLVDQSTAIETTDPTFCSSLLD
FT                   PAIFGPLFNGPIREFLGGPLYLMSFLCPTATEYPDQRIITKHDVPYGFTEEYLHRYYFG
FT                   RFNDADIIDTLQEYWYDWGSFFGGPLYRYQDTFPWDCSEKWKRCPTKCGDCSITKHVWA
FT                   FPFDSWSLITLHLQREQYLYPPRAGTTAISPVDWVRSRQYILAAADALHRVATAMAQSP
FT                   RLGKVTAWLHEDSRLLQTQPSLSRAKLGGIHRAQPFSHYYELGANQHYFLSEWAMINCA
FT                   EQIKAYEKLRDARMMVFEIPWQIAGTPRYRKSATTHDITYGYVGFQGQRADHRPSDNAG
FT                   ANYYPYYYPITDTRTSGEGYQCADGQFQMTDQTAGDDDPTHGAEHNCGSGCGASTEAGA
FT                   LQGDNGGYGGGYYGGGGYSGCGSGGGGGSGGGGGSGGGGGSGGGGGGSGGGGGGESASD
FT                   PG"
FT   gene            277145..278674
FT                   /locus_tag="ANIA_06409"
FT                   /old_locus_tag="AN6409.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(277145..277682,277728..277840,277892..278674)
FT                   /locus_tag="ANIA_06409"
FT                   /old_locus_tag="AN6409.4"
FT                   /note="transcript_id=CADANIAT00006570"
FT   CDS_pept        join(277145..277682,277728..277840,277892..278674)
FT                   /locus_tag="ANIA_06409"
FT                   /old_locus_tag="AN6409.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006570"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006570"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006570"
FT                   /db_xref="GOA:Q5AZ71"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ71"
FT                   /protein_id="CBF69527.1"
FT                   /translation="MALISPSNLLSLHRASGDQTAALNANPSRKYRYVDSKSKEQPLDI
FT                   PDPALFKDLNTVNHGSPTFPSISECAIHLEMLEAFHTLRHEVIHSPQLDVAFNISPQPT
FT                   TKYRVKKDTRRSRNRQVETVSIADSRFPDRRKQKWTHFLHIAATRFRQWIQVVDTHLEM
FT                   AQLSSHAPRYLLLPPLDVLMIWHAFLLNCDDFKEHCASYNLKHVQSIEFPWSDIHAAID
FT                   SNSWTYTLPKEHSDWLLTTHNIHGDLITTLSEEASQPCLIQNLLHAFYEPKARFESPDA
FT                   SHLAQTLRKARQMQDLNTPLVQNVERQCVFVDKMHAHRWICSPAVNGTLRRAIDRYDNF
FT                   LHLFRLYPNKFLVPTLDIDLVWHTHQCSAVRYRTFVTERVGRFINHEDKIGRGTLDDGF
FT                   TNAEQWYRLHYGKEYQVCLCWSCEAILSAVEELDEDVLDDPDPQIGGLVTDIERKVHYY
FT                   REMEIARRLGRELPVWNHD"
FT   gene            complement(279066..279642)
FT                   /locus_tag="ANIA_06408"
FT                   /old_locus_tag="AN6408.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(279066..279337,279432..279513,
FT                   279607..279642))
FT                   /locus_tag="ANIA_06408"
FT                   /old_locus_tag="AN6408.4"
FT                   /note="transcript_id=CADANIAT00006571"
FT   CDS_pept        complement(join(279066..279337,279432..279513,
FT                   279607..279642))
FT                   /locus_tag="ANIA_06408"
FT                   /old_locus_tag="AN6408.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006571"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006571"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006571"
FT                   /db_xref="GOA:Q5AZ72"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ72"
FT                   /protein_id="CBF69529.1"
FT                   /translation="MPMSWTPEANVKLFIGVLEQIKTQSVKLDYKALAEHMGPECNAKS
FT                   VQNQFTKLKKQAAEEYGNAGANTPDIPSNTPKRRRAPVGSKTGTPAKKKRGDAEVLGGD
FT                   SDAEGETDIDQEILDKVSAELKELA"
FT   gene            complement(280394..282197)
FT                   /locus_tag="ANIA_06407"
FT                   /old_locus_tag="AN6407.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            complement(join(280394..280565,280639..281072,
FT                   281126..281535,281621..281902,281966..282197))
FT                   /locus_tag="ANIA_06407"
FT                   /old_locus_tag="AN6407.4"
FT                   /note="transcript_id=CADANIAT00006572"
FT   CDS_pept        complement(join(280394..280565,280639..281072,
FT                   281126..281535,281621..281902,281966..282197))
FT                   /locus_tag="ANIA_06407"
FT                   /old_locus_tag="AN6407.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006572"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006572"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006572"
FT                   /db_xref="GOA:C8V0M9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0M9"
FT                   /protein_id="CBF69531.1"
FT                   /translation="MDFLMEYGSPAGFFTIFATLWLVYCLLRMLYNVSPLHPLSHIPGP
FT                   NLAAATFLYESWFDLVLGGKYTHKIKRMHEQYGPVVRINPEELHFNDISFANEIYAGPG
FT                   RKRNKQVHYLNIFAGPTTSSMLATVEHGHHRVRRSAVNRFFSRAQISKLESNIKDLALG
FT                   LCDKMIRLAYSCFSGDVISKYCFGEPFGFIAQEEWEPNYRNALKATQAPVHVFRTFPFL
FT                   KRLTDIAPLCARWASPGIREMLIESNEKMPARIRKARQDSKRGITETQPSLFAALLDAP
FT                   LPEAEKTDQRLGGEGFLMIAAGTETTAWTLTVITFHLLNQPDTLNRLRCELQDADALNL
FT                   QWFALERLPYLTAVIHEGLRLSYGVSQRISRIAPTETLVYQGEHNGRRIEYSIPSGTTM
FT                   GMSNAINHHNEDAFPDSDAFIPERWINIDDAQRRRMDSCLTPFSKGSRQCLGINLAYCN
FT                   LYLALTALTLRVLPWMSLYETTVDDVRYHSDLFAPLPKKGTKGVRAIISYP"
FT   gene            complement(285584..286166)
FT                   /locus_tag="ANIA_06406"
FT                   /old_locus_tag="AN6406.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(285584..285774,286049..286166))
FT                   /locus_tag="ANIA_06406"
FT                   /old_locus_tag="AN6406.4"
FT                   /note="transcript_id=CADANIAT00006573"
FT   CDS_pept        complement(join(285584..285774,286049..286166))
FT                   /locus_tag="ANIA_06406"
FT                   /old_locus_tag="AN6406.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006573"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006573"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006573"
FT                   /db_xref="GOA:Q5AZ74"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ74"
FT                   /protein_id="CBF69533.1"
FT                   /translation="MPKGSCVSHARSQCYLEAVHRPNNQALLHASEERRLPSAASESIS
FT                   AHKTSKQKRKEAEERLSGLPEASAQRETQTEADKEQRLSVEQLKQEWRLDEVQDEMH"
FT   gene            286434..287390
FT                   /locus_tag="ANIA_06405"
FT                   /old_locus_tag="AN6405.4"
FT                   /product="secreted glycosyl hydrolase, putative
FT                   (AFU_orthologue; AFUA_4G14420)"
FT   mRNA            join(286434..286610,286672..287163,287282..287296,
FT                   287337..287390)
FT                   /locus_tag="ANIA_06405"
FT                   /old_locus_tag="AN6405.4"
FT                   /note="transcript_id=CADANIAT00006574"
FT   CDS_pept        join(286434..286610,286672..287163,287282..287296,
FT                   287337..287390)
FT                   /locus_tag="ANIA_06405"
FT                   /old_locus_tag="AN6405.4"
FT                   /product="secreted glycosyl hydrolase, putative
FT                   (AFU_orthologue; AFUA_4G14420)"
FT                   /note="transcript_id=CADANIAT00006574"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006574"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006574"
FT                   /db_xref="GOA:Q5AZ75"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ75"
FT                   /protein_id="CBF69534.1"
FT                   /translation="MRLHTLTWLLSLSLASIVTATAPVLRNATVTRGIDLFEIHLPVNW
FT                   KTAVAEGVEFVFVKSTEGIAYRNLRFKSQTGSAAAASTSSNTTILHGAVHFALASQSTG
FT                   AAQADFFISHGGNWTADGATLPGVLEMEGNIPGKLCHGMSATEISDWMMDFSDRYKEVT
FT                   GRRPILFLSAGWWEKCAGNNETFAQEHPLWLANWADEMGDLPAGWKEATFWQYSGSAGD
FT                   GSCKVNLPESASSSLAFPILAEN"
FT   gene            complement(288011..289336)
FT                   /locus_tag="ANIA_06404"
FT                   /old_locus_tag="AN6404.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(288011..289336)
FT                   /locus_tag="ANIA_06404"
FT                   /old_locus_tag="AN6404.4"
FT                   /note="transcript_id=CADANIAT00006575"
FT   CDS_pept        complement(288011..289336)
FT                   /locus_tag="ANIA_06404"
FT                   /old_locus_tag="AN6404.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006575"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006575"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006575"
FT                   /db_xref="GOA:Q5AZ76"
FT                   /db_xref="InterPro:IPR039903"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ76"
FT                   /protein_id="CBF69536.1"
FT                   /translation="MPYTFSYLQFPSAPHLSEIISLYPENEPFCVGYAPSQGRRCRMRT
FT                   NASNRASAMAMLELGTKKVHMGQMPTRDILIYLASCTLCTRFHQGQAEGLAERWRQDIG
FT                   RFLDYEYARPGLQELAGLQNRAYKLLADYQRALEQEQWRHVPTPRSTPATPTVYLRTQP
FT                   TSSLSAYSRSDSIASTRNNVPGDAYSTATPQPASTSTSSSTSRNAGQRRVETRSRISVT
FT                   ETTAREVDSRALHSVSAIEDATNRPGSSTRRSSGATRDMGTREAVGMTRAIAHRTARTT
FT                   TTSTVRTRPVADNLRSTSNHTFESVLLSRLQSSAIHTEPSTASTGATLRTATRRAIEGD
FT                   CGICLEPLRESRDGRSSSSRSESENNGYAATAGGEASGPVRSTAAQDSYGGNDRKHAEL
FT                   TWCKTHCGVNYHAICISTWLATARNPTCPTCRGVWVNDHLET"
FT   gene            complement(291659..293458)
FT                   /locus_tag="ANIA_06403"
FT                   /old_locus_tag="AN6403.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(291659..292389,292453..292912,
FT                   292971..292999,293052..293458))
FT                   /locus_tag="ANIA_06403"
FT                   /old_locus_tag="AN6403.4"
FT                   /note="transcript_id=CADANIAT00006576"
FT   CDS_pept        complement(join(291775..292389,292453..292912,
FT                   292971..292999,293052..293399))
FT                   /locus_tag="ANIA_06403"
FT                   /old_locus_tag="AN6403.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006576"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006576"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006576"
FT                   /db_xref="GOA:Q5AZ77"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR035872"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ77"
FT                   /protein_id="CBF69538.1"
FT                   /translation="MSDLKASVSETANGFHVEGYEKIEYDFTFLDGVFETKNAQLAQLY
FT                   ERWGRCLAIMDKNIYDLYGDDMKRYFDHHEVKLQIHQTMIGEKAKSLETFTSIVDVMND
FT                   FGIMRKEPVLVVGGGLVTDVAGFACAAYRRNTNYIRIPTTVIGLIDASVSIKVAVNYGN
FT                   YKNRLGAYHAPMHTLLDFGFLRTLPEAQVRNGFAELIKISSCAHLRTFDLLDEFCERLI
FT                   QTKFGRADSAEGEVRQAADEINRSGIYKMLKLESPNLHEIGLDRVIAYGHTWSPLHELA
FT                   PPVPLRHGHAISIDMAYSATLANTRGLLSDREHIRLLNLFSRAGLAMDHALFTEELLEK
FT                   ATAAILKTRDGLLRAAVPSPLGSCVFLNDVTREEMGAALRRHKSLMKGFPREGAGIEAF
FT                   VDASDTGYTMNGTEHEGEKEKDGAKVMNGQAHVNGNGNGPTNAQKITSDVEGSVRNVFG
FT                   NGVFNELKKSLPMATRIACAVEEEA"
FT   gene            294118..297112
FT                   /locus_tag="ANIA_06402"
FT                   /old_locus_tag="AN6402.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(294118..294399,294466..295026,295505..297112)
FT                   /locus_tag="ANIA_06402"
FT                   /old_locus_tag="AN6402.4"
FT                   /note="transcript_id=CADANIAT00006577"
FT   CDS_pept        join(294118..294399,294466..295026,295505..297112)
FT                   /locus_tag="ANIA_06402"
FT                   /old_locus_tag="AN6402.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006577"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006577"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006577"
FT                   /db_xref="GOA:Q5AZ78"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ78"
FT                   /protein_id="CBF69540.1"
FT                   /translation="MPEAVSQTVKRGAFDPSKAYAAQEGTTFFNDGREIELLHFVYSHP
FT                   KLDSIRGSPESVLDAIDEYARTRKYLMNVGEDKGRIVCDLIAEVKPKTMVELGGYVGYS
FT                   SILFGAAVRAAGGSRYYSLEMNPEFAAVIMALVDLAGLSDVVKVVIGPSDVSIARLYES
FT                   AALTHIGLLFLDHYKPAYTTDLKLCEELKLITPGSVLAADNVIKPGNPPYLEYVRRSVD
FT                   EKRKHLGVSTNGGGLPGKTVDQYKDKTGFGQMKLSQSRGNPNLIYESRLVESFEPTGVP
FT                   QCGRAYENHGTPGAAGMPWPHSLTQHLILLLHKAEFRIPSSKMAEPFFYSHIPKNILLI
FT                   LLSLMFLPTTAIIAITSLVINYVSKTPEQGRFKESSAPKTILVTGVSMAKGLAIARLLA
FT                   RETPHRIIGADTEPLLFTSPGRYSQSIVKFYRLSSPRPGDPKPYLDSLLSVMRKEEVHL
FT                   WISCSSVIGAVEDGEVMVMAEKEFGKDRFKAVQFDSETVKRFHEKDTFIDYIKSLELPV
FT                   PESYRCTSVEEVTILLNQGREKAKRFIMKPIGVNDKARGKMMTLLPLDSEEATSSYLTA
FT                   LDISKSSPFLLQEYITGEEYCTHSLVVRGDVKAFVACPSSDMLMHYSATPPGSALSMKM
FT                   LEFTTRVAERGGEDFTGHLSFDFLVQGRGEEARLSPIECNPRTHTAVILFQHTPEVAHA
FT                   YLSVFGHNLDSKLKQDKGSSDIVAPATPDYNVYWIGHDLVTLLIIPVVTWIGGIRSTEE
FT                   TKHSLRTFWHHLLHWRDGTWALWDPVPFFALYHVYWPARFVECIFKNRKWSRINVSTTK
FT                   MFEC"
FT   gene            complement(298405..298947)
FT                   /locus_tag="ANIA_06401"
FT                   /old_locus_tag="AN6401.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(298405..298616,298671..298947))
FT                   /locus_tag="ANIA_06401"
FT                   /old_locus_tag="AN6401.4"
FT                   /note="transcript_id=CADANIAT00006578"
FT   CDS_pept        complement(join(298405..298616,298671..298947))
FT                   /locus_tag="ANIA_06401"
FT                   /old_locus_tag="AN6401.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006578"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006578"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006578"
FT                   /db_xref="GOA:Q5AZ79"
FT                   /db_xref="InterPro:IPR001338"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ79"
FT                   /protein_id="CBF69542.1"
FT                   /translation="MQFTIASLIATAVLGLQMASAAPHAPGSSNAAIISQAQEQNTCGN
FT                   AHLSCCESTDNSVSLTQEEEEGLLHLLGGTSSVLSDGLLGKYSGCSSLASVEGILGAGG
FT                   NQGLVSGQCNNHVACCDAGDNELVGFLEPGVAVLKPNSDGIQNGLANVAVPCVPVQVL"
FT   gene            complement(299693..302568)
FT                   /locus_tag="ANIA_06400"
FT                   /old_locus_tag="AN6400.4"
FT                   /product="FRE family ferric-chelate reductase, putative
FT                   (AFU_orthologue; AFUA_1G17270)"
FT   mRNA            complement(join(299693..299714,299835..300010,
FT                   300282..301062,301114..301235,301283..301335,
FT                   301387..301616,301678..301989,302039..302079,
FT                   302128..302568))
FT                   /locus_tag="ANIA_06400"
FT                   /old_locus_tag="AN6400.4"
FT                   /note="transcript_id=CADANIAT00006579"
FT   CDS_pept        complement(join(299693..299714,299835..300010,
FT                   300282..301062,301114..301235,301283..301335,
FT                   301387..301616,301678..301989,302039..302079,
FT                   302128..302568))
FT                   /locus_tag="ANIA_06400"
FT                   /old_locus_tag="AN6400.4"
FT                   /product="FRE family ferric-chelate reductase, putative
FT                   (AFU_orthologue; AFUA_1G17270)"
FT                   /note="transcript_id=CADANIAT00006579"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006579"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006579"
FT                   /db_xref="GOA:Q5AZ80"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ80"
FT                   /protein_id="CBF69544.1"
FT                   /translation="MRPPFSVLTFLVFWIPAAQAGSSIVPVNERCVDSIVTAYTYITFA
FT                   GSTSRKFLDQRCQNALAVTSIYASSNVYCRPEEREAGIARLDGICSDAGLELLSRDSVR
FT                   ENLTEDAIRGMRRVDYGELEMSERIKYPVLLSAEHFRRVFSTMDTWAFESWTHYAYGYL
FT                   GYLYWALVLSIGILNRTVQFFFVSRSDITPSALVLFQNTPFRRIHHFLHTHFLVPTALP
FT                   SHGRRLLCWTFSNRAEALVTLGFWILSIILCSVSYRLSTDNIYWPSTSTQLIRYMADRT
FT                   GIISFANLPLLWLFAGRNNICAWATGWNFATFNVFHRHVAWIATIQAVVHTVLYLVLFF
FT                   ENSNPWRKLSKPYLLWGTLAMALMILILPAAVTWFRHRAYETFLFIHIVFSIILLVGCF
FT                   YHTIIFETHEYWFYLWLPVGIWVFDRGLRIIRVIYSNIHVRFHQGSETKVQATTSTATY
FT                   DRVADLITLTVVPGSAASVRPCPGRYYFLYQPFRLTGWESHPFTLGRWEYQVRAGRGLS
FT                   GSGRSTPRVIKGDETVDVSQIPLLSDSFSSDGPTRESSSAKEPSQVVMNLELTFWIRPY
FT                   DGWTRQLRDRCLRSPDFSTRSTILLEGPYGHEFPLWRYDSVLLLAGGTGIASAVPYIRD
FT                   HIARSEPLRANKLGSGAYSDLYDDDSYTDITPGRPNLGKIITAFAEEAHVSDCSAAVLV
FT                   CGPQKMADEARGAVAEALKRGYHLARIYGHD"
FT   gene            complement(303852..305517)
FT                   /locus_tag="ANIA_06399"
FT                   /old_locus_tag="AN6399.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(303852..304290,304346..305206,
FT                   305257..305517))
FT                   /locus_tag="ANIA_06399"
FT                   /old_locus_tag="AN6399.4"
FT                   /note="transcript_id=CADANIAT00006580"
FT   CDS_pept        complement(join(303856..304290,304346..305206,
FT                   305257..305517))
FT                   /locus_tag="ANIA_06399"
FT                   /old_locus_tag="AN6399.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006580"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006580"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006580"
FT                   /db_xref="GOA:Q5AZ81"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ81"
FT                   /protein_id="CBF69546.1"
FT                   /translation="MGSSYSVPALEEKSPRGETEVALSPPVTDKHKEKESRRFCCPTVI
FT                   FKKTWESAADILAPPYPMEEREPSLSLHRLKDWNETLLADPKNRLAISSLAGASYTDLL
FT                   ANRSALRSDIQVFNVKVPIEGSPITNQRSSGRCWLFASTNIFRVPIMKAYGLKELELSQ
FT                   AYLFYWDKIEKANYFFETIIETANEDISSRLVQKLLQDPVTDGGQWDMVANLVRKYGLV
FT                   PHDIYPDTFNAQNSSRMNWLLTAKLREQAFVLRRLATSAQLKERVQLGVVKQKFLKEIH
FT                   SLVTIMLGPPPSPDREFVWQYNDADGKAKEIRQTPLEFGRQGFSQSTRTRVSPSRLYSL
FT                   VNDPRNEYYRLLTVEKLGNVVEGKPLTYVNVEMKALKKAVIAMLKAGHPVFFGCDVGKF
FT                   SDKVSGVMDSELIDLTLGFNVTLGMNKAERLTSGETAMTHAMVITAVHLEDGEPVRWRV
FT                   ENSWGEGAGEKGWFVMTDRWMDEYTFQAVVDFNLVPAEIRDVLGQEPKILPRWDPMGVL
FT                   A"
FT   gene            complement(306713..307706)
FT                   /locus_tag="ANIA_06398"
FT                   /old_locus_tag="AN6398.4"
FT                   /product="UDP-galactose 4-epimerase, putative
FT                   (AFU_orthologue; AFUA_7G00360)"
FT   mRNA            complement(306713..307706)
FT                   /locus_tag="ANIA_06398"
FT                   /old_locus_tag="AN6398.4"
FT                   /note="transcript_id=CADANIAT00006581"
FT   CDS_pept        complement(306839..307681)
FT                   /locus_tag="ANIA_06398"
FT                   /old_locus_tag="AN6398.4"
FT                   /product="UDP-galactose 4-epimerase, putative
FT                   (AFU_orthologue; AFUA_7G00360)"
FT                   /note="transcript_id=CADANIAT00006581"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006581"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006581"
FT                   /db_xref="GOA:C8V0N8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0N8"
FT                   /protein_id="CBF69548.1"
FT                   /translation="MKIAITGARGTVGRACVKLCSKAGHATVQIDRTEQDFDGTPNSEM
FT                   RTADVANDYDAVVKAFKGCDALIHLAALPDPVGKDDWMVHNNNVNAAFNGFHAAATLGI
FT                   NRVCYASSVNAVGLAYANRPLKFDYLPLDEEAPQRPTDSYALAKEEAEAQARSFVNWFP
FT                   GMNIACLRIHEVAPLKDVQKEHESNWEEAAVKQLWGWVNPEAVARACLLSVERAENLKG
FT                   CQVLNIAAPTTTQSTPSAELAKKYYPNAEIRPGLEGNKAFWTTDKAKRIIGWVHEEKE"
FT   gene            complement(308117..309876)
FT                   /locus_tag="ANIA_06397"
FT                   /old_locus_tag="AN6397.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(308117..308166,308370..309876))
FT                   /locus_tag="ANIA_06397"
FT                   /old_locus_tag="AN6397.4"
FT                   /note="transcript_id=CADANIAT00006582"
FT   CDS_pept        complement(join(308117..308166,308370..309876))
FT                   /locus_tag="ANIA_06397"
FT                   /old_locus_tag="AN6397.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006582"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006582"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006582"
FT                   /db_xref="GOA:Q5AZ83"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR014851"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ83"
FT                   /protein_id="CBF69550.1"
FT                   /translation="MEHIHNVFGLDTFFIINIGIALAGLATWLRSVWNLVNRYADTCIA
FT                   TVYINEHDPLYNDVIQWMNDHIFKDRNFCCVLAVTDNHHRPGKRQGLISAIAGPMNPAD
FT                   ASPPQVLGKSTFELKPFNGSRIFTFRGRWVLFSHSAPSRTITTLQDGAEERIHLKLQTL
FT                   SLSLDPLRALIEEANAYSKKLAKSQISVYRAMSNVRDLVRWNRITTRPSRAISTVILDS
FT                   CKKKAVLDDMREYLREDTRQWYANHGIPYRRGYLFSGPPGTGKTSLSSALAGVFGLDIY
FT                   VLSLLDPNISESHFLRLFSEVPTQCVVLLEDIDAAGMTLKRANEEPVTADTTASFDVMK
FT                   KRARPGAPVPTSPPTPISLSALLNAIDGVSSQEGRILIMTTNAPQDLDPALIRPGRVDM
FT                   HIRFELPSRVEFRELFRSMFSDAPSGPDSEVKGESDIGSDALKLEETKKKNIDMIDLDR
FT                   LAQEFAEALPEGRFSLAEVQGFLLQYKRQPEAACARAAEWATDNKPRQYLPCPPAGPGD
FT                   V"
FT   gene            311442..314040
FT                   /locus_tag="ANIA_06396"
FT                   /old_locus_tag="AN6396.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(311442..311568,311624..311708,311760..312872,
FT                   312920..313333,313386..313621,313697..314040)
FT                   /locus_tag="ANIA_06396"
FT                   /old_locus_tag="AN6396.4"
FT                   /note="transcript_id=CADANIAT00006583"
FT   CDS_pept        join(311442..311568,311624..311708,311760..312872,
FT                   312920..313333,313386..313621,313697..314040)
FT                   /locus_tag="ANIA_06396"
FT                   /old_locus_tag="AN6396.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006583"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006583"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006583"
FT                   /db_xref="GOA:Q5AZ84"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ84"
FT                   /protein_id="CBF69552.1"
FT                   /translation="MSDTLSTPTPPQDASNRPKRRKIAVACDECRSRKVRCDGVQPVCG
FT                   PCAKRADRGAQCKYTSEPEKKKAAQDYIASLENRIRHLESPAYFSGSSEAHSFEGSGHP
FT                   SVCCKFLCRFRGDLFDKSNDFEQATAPNRPLGSTTIPLSPSYTSKVLPPPQTRISFRAD
FT                   PGRSPLSGFPADNQGGNANSLLSGARDFTRRFSEPSESTDGVNAMMGSVEERPSQEFFG
FT                   SSSAASFMRQIKTAVDKRVSSPSQRTPEIAAESRPRSSLISPQKERQSAIHDYVLPPRK
FT                   IADNLMNVYWHYVFPLYPLVDSIRLREEYSRIWTGEPLQSDENMLMCTFNVIFALACQL
FT                   ADFIVPEEREASAAAFFSRAKDLLHFNLWDSGSAALIQCLLLMAQYLQSTNSAHQCWIV
FT                   TGLAVRNAQSMGLHLPQTIACLHSPQEQQLARKIWHGCVLMDRVISMTFGRPAMISKAS
FT                   CGSVPLPATVDEEYIASASESSVEQPADQPSIMAFYAKSLELYDILNDILLSLYKPVVE
FT                   DSPDDVYDLYFNRDTSEDELTIFQLDRALTRWTRSLPAHLRGEPVSGSNGIIFYRQSVV
FT                   LRARFLHVRMLLFRPILSKYCIARDLPSDPLISLTDSFPQRVALQCSIICVNVAREVIE
FT                   LIHTNIPCDGTSGPLPAWWYNILFLVASRLCPSVIEEVTEAAITRSWNCALEILRKYQS
FT                   YSTSARRCVAALEILYERAISEAPAGDIPPQSQSGVSMANTIGDMPLGEGMNTSLLEGF
FT                   DLPDFQDMSWLNSVPSHLY"
FT   gene            314756..316887
FT                   /locus_tag="ANIA_06395"
FT                   /old_locus_tag="AN6395.4"
FT                   /product="Rhamnogalacturonan lyase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q1HFS3]"
FT   mRNA            join(314756..315416,315474..315565,315615..315629,
FT                   315661..316887)
FT                   /locus_tag="ANIA_06395"
FT                   /old_locus_tag="AN6395.4"
FT                   /note="transcript_id=CADANIAT00006584"
FT   CDS_pept        join(314756..315416,315474..315565,315615..315629,
FT                   315661..316887)
FT                   /locus_tag="ANIA_06395"
FT                   /old_locus_tag="AN6395.4"
FT                   /product="Rhamnogalacturonan lyase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q1HFS3]"
FT                   /note="transcript_id=CADANIAT00006584"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006584"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006584"
FT                   /db_xref="GOA:Q5AZ85"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR029411"
FT                   /db_xref="InterPro:IPR029413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZ85"
FT                   /protein_id="CBF69554.1"
FT                   /translation="MRLGVCFSLAAAASVARAALTATENDTSIVLENDRLRATFDKGRG
FT                   SIIDLYLDGQDFLGPQSGSTGIGPYLDCYCTPSGFYTAGSTNPVTELVQGTDSTGTKYA
FT                   GIILNDTYTPTGQEFQQYWFLRDGETGFHMFSRLAYYNETTPFLRNLQELRTLFRPNTD
FT                   LWTHLTSSDLQTAPLPSDEAIAEQIVVQDATWRLNNTPDDAYYQQFSEYFTKYTFSNHW
FT                   RDNDVHGLYADGSTSDGTTYGAWLVMNTKDTYYGLTEQGPLHSDLTVDGIIYNYIVSNH
FT                   HGEGTPNITNGFDRTFGPQFYLFNGGGSSSLEELRDEARSLASPSWNADFYDSIAKHVI
FT                   GYVPSSQRGSVKGTIKLPKNAKSPIAVLTVDGHYFQDNSAVPSSHQYWADIDKNGRFSI
FT                   DRVVAGKYRLTVYADGIFGDFTRDGIVVKARKSTSIKETWKPESAGTEIWRLGTPDKSS
FT                   GEFRHGAARDPTHPRHPPEYLIYWGAYDWQSDFPGGIDYMIGESDPATDFNTVHWAVFG
FT                   PTPDNPVAESNTTHDWRIRFDLSAKQLHARKTATLTIQLAGAKAASGNTDVYNASEPYA
FT                   NLPLRSYINEQEEPLTMVIGYDQSSSCIVRSAVSCYQVREKWEFPASWLKEGSNLLRLS
FT                   LPTNGTNYESAVLPTSVYVQYDALRLELK"
FT   gene            complement(317036..318710)
FT                   /locus_tag="ANIA_06394"
FT                   /old_locus_tag="AN6394.4"
FT                   /product="acyl-CoA dehydrogenase family protein
FT                   (AFU_orthologue; AFUA_6G10880)"
FT   mRNA            complement(join(317036..317741,317806..318031,
FT                   318104..318710))
FT                   /locus_tag="ANIA_06394"
FT                   /old_locus_tag="AN6394.4"
FT                   /note="transcript_id=CADANIAT00006585"
FT   CDS_pept        complement(join(317036..317741,317806..318031,
FT                   318104..318710))
FT                   /locus_tag="ANIA_06394"
FT                   /old_locus_tag="AN6394.4"
FT                   /product="acyl-CoA dehydrogenase family protein
FT                   (AFU_orthologue; AFUA_6G10880)"
FT                   /note="transcript_id=CADANIAT00006585"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006585"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006585"
FT                   /db_xref="GOA:Q5AZ86"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ86"
FT                   /protein_id="CBF69555.1"
FT                   /translation="MSKTFTRDEVAKHNTEDSLWCIIDHRVYDLTDFLDAHPGGSVVLS
FT                   QIAGKDATTDFYNLHRHEVLTKYRDSLCIGTIADEKPEVIDPTPDGLSPVPYAEPLWLR
FT                   PGFKSPYYNESHRRLQKAIREFTSLHVAPEAAEKEKDGTYISQELINKMAETNVLAMRL
FT                   GPGKHLHGRKLLGGVVDGKEFDYLHDLIIAQEMVRVNARGFQDGNMAGMVISLTAVQNW
FT                   LRNEPLRQKVTEEVLSGKKKMCLAVTEAFAGSDVAGLRTTAEKTPDGKYYIVNGTKKWI
FT                   TNGMYADYFVTACRTSKGFSVLLIPRDSAVETTQIKTSYSTTAATAFVEFNNVKVPVDH
FT                   LLGEEHKGFIVVMSNFNHERYMMVCAVVRFSMTVVEECLKWCNQRIVFGKRLIEQPVIR
FT                   QKLARMISLTESNQAWLESIAYQMNNMTYAEQSKNLGGPIGLLKSHVTRCAGEIAEQAT
FT                   NIFGGRGLTQTGMGRVIEMFNRTYKFDSILGGTEEILADLGVRQAYKSFPKAML"
FT   gene            complement(319278..320064)
FT                   /locus_tag="ANIA_06393"
FT                   /old_locus_tag="AN6393.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(319278..319385,319508..319856,
FT                   319904..320064))
FT                   /locus_tag="ANIA_06393"
FT                   /old_locus_tag="AN6393.4"
FT                   /note="transcript_id=CADANIAT00006586"
FT   CDS_pept        complement(join(319278..319385,319508..319856,
FT                   319904..320064))
FT                   /locus_tag="ANIA_06393"
FT                   /old_locus_tag="AN6393.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006586"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006586"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006586"
FT                   /db_xref="GOA:Q5AZ87"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ87"
FT                   /protein_id="CBF69557.1"
FT                   /translation="MAASKEWQKMLKGELYWAWDADLQANRDRCREACKRFNEAGPVSR
FT                   RRRAALWRDIIGDTRPLPPVKQDPAADEKQFDETDPIVDPPFSVDHGLNLKVGKGTFIN
FT                   FDTTILDTCLVTIGERVLFGPHVRIYGATHPIDPAVRRGLEGPEAGKEVHIEDDVWIGG
FT                   SVIVLAGDVPPFHFVAGNPARVIRKIETSMDPVQATEGSETV"
FT   gene            complement(320356..322034)
FT                   /locus_tag="ANIA_06392"
FT                   /old_locus_tag="AN6392.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(320356..320403,320449..321079,
FT                   321124..321257,321301..321524,321656..322034))
FT                   /locus_tag="ANIA_06392"
FT                   /old_locus_tag="AN6392.4"
FT                   /note="transcript_id=CADANIAT00006587"
FT   CDS_pept        complement(join(320356..320403,320449..321079,
FT                   321124..321257,321301..321524,321656..322034))
FT                   /locus_tag="ANIA_06392"
FT                   /old_locus_tag="AN6392.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006587"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006587"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006587"
FT                   /db_xref="GOA:Q5AZ88"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ88"
FT                   /protein_id="CBF69558.1"
FT                   /translation="MTGPACKTCREKCRKCDRGRPSCQRCISKGLVCRGYPDQFRFCGI
FT                   ASRGKWKDARIPALDEEISPQRQETLIKNQIKQSTSGSSTPPEPRRSRRLAIDSMLVKH
FT                   ADEVDDITGLLSLTQTKTLLQHSKKQIGLLYALLGFSAVHLGKLTGNRDMHETTAVEYR
FT                   LKAIRALGELIYKSQTTSLSKEEQDTVFATIQILLLHDIAETGISEHGVHITGAMSVCK
FT                   TILLADGFNGQRQRAVFFIGNLAWLDIIRAFAGTRRLCFTQEIREMVASAGGHRFELVN
FT                   GCPREIFLIIGRALEKAKQYKNDWTTDEDFRSTLLGANQELYSWDPRSKTYPSSDARWV
FT                   NVGIAFQFACILHVHRLLDPLRPANSPEIQEAVLKILDATADVPADCTLIELLIFPLFM
FT                   AGADSLSRHSQYYVLARLREIERRSEIRNPVPADLLGKVWAARSAKDGNENISWRDFTC
FT                   FPELTRQHDYLII"
FT   gene            324377..326050
FT                   /locus_tag="ANIA_06391"
FT                   /old_locus_tag="AN6391.4"
FT                   /product="Serine/threonine-protein phosphatase PP2A
FT                   catalytic subunit (Protein phosphatase 2a)(EC 3.1.3.16)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q9HFQ2]"
FT   mRNA            join(324377..324751,324807..324848,324954..325059,
FT                   325112..325645,325690..325762,325811..326050)
FT                   /locus_tag="ANIA_06391"
FT                   /old_locus_tag="AN6391.4"
FT                   /note="transcript_id=CADANIAT00006588"
FT   CDS_pept        join(324590..324751,324807..324848,324954..325059,
FT                   325112..325645,325690..325762,325811..325883)
FT                   /locus_tag="ANIA_06391"
FT                   /old_locus_tag="AN6391.4"
FT                   /product="Serine/threonine-protein phosphatase PP2A
FT                   catalytic subunit (Protein phosphatase 2a)(EC 3.1.3.16)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q9HFQ2]"
FT                   /note="transcript_id=CADANIAT00006588"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006588"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006588"
FT                   /db_xref="GOA:Q9HFQ2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HFQ2"
FT                   /protein_id="CBF69560.1"
FT                   /translation="MDNNMEIDAARSPEPHHLSPTTDPGSIPTLDGWIESLMTCKQLAE
FT                   EDVRRLCDRAREVLQEESNVQPVKCPVTVCGDIHGQFHDLMELFRIGGPNPDTNYLFMG
FT                   DYVDRGYYSVETVTLLVCLKIRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANVW
FT                   KYFTDLFDYLPLTALIENQIFCLHGGLSPSIDTLDNIRSLDRIQEVPHEGPMCDLLWSD
FT                   PDDRCGWGISPRGAGYTFGQDISEAFNHNNGLTLVARAHQLVMEGYNWSQDRNVVTIFS
FT                   APNYCYRCGNQAAIMEIDEHLKYTFLQFDPCPRAGEPMVSRRTPDYFL"
FT   gene            complement(328113..330188)
FT                   /locus_tag="ANIA_06390"
FT                   /old_locus_tag="AN6390.4"
FT                   /product="homogentisate 1,2-dioxygenase, putative
FT                   (AFU_orthologue; AFUA_6G10810)"
FT   mRNA            complement(join(328113..328501,328554..328716,
FT                   328783..329415,329459..329615,329679..329701,
FT                   330165..330188))
FT                   /locus_tag="ANIA_06390"
FT                   /old_locus_tag="AN6390.4"
FT                   /note="transcript_id=CADANIAT00006589"
FT   CDS_pept        complement(join(328113..328501,328554..328716,
FT                   328783..329415,329459..329615,329679..329701,
FT                   330165..330188))
FT                   /locus_tag="ANIA_06390"
FT                   /old_locus_tag="AN6390.4"
FT                   /product="homogentisate 1,2-dioxygenase, putative
FT                   (AFU_orthologue; AFUA_6G10810)"
FT                   /note="transcript_id=CADANIAT00006589"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006589"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006589"
FT                   /db_xref="GOA:Q5AZ90"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ90"
FT                   /protein_id="CBF69562.1"
FT                   /translation="MPNAQYSGYQAGFGNSFESEAVPGTIPHGQNSPRNVRFGLYAEQV
FT                   TATAFIAPRHCNKKAWLYRARPAAELGANSVLFQTELPDNKDTECSFLPLNPRIHVSPT
FT                   QLAWHPFDIEESETDFVAGLKTVAGSGDPTLREGIATHVYTANKSMTKRAFVNSDGEFL
FT                   IVPQQGALDIQTEFGPLFVQPGEIVVIQRGLRFRVELPDGPSRGYILEIWGSQFELPEL
FT                   GPLGANGLANARDFLYPTAKYEVVKEPWEIIYKLGGKFFKSTQQHSPFDVVAWHGNYVP
FT                   YKYDLTKFVNVGSISVDHIDPSIFCVLTAKSRDLNAPLADVLIFSPRWDVASHTYRPPY
FT                   YHRNAASELMGLIYGDYGGRSDAFKPGSISFECGMVPHGVAYEEFSAATAGETDPPAMR
FT                   ISEGSIAFMFESSRPFTITDFAWKSEKRHEHEPKMWDNLVDHFSEHAKEVEEILAAKAK
FT                   GLRI"
FT   gene            complement(330551..332356)
FT                   /locus_tag="ANIA_06389"
FT                   /old_locus_tag="AN6389.4"
FT                   /product="carboxylesterase, putative (AFU_orthologue;
FT                   AFUA_6G10800)"
FT   mRNA            complement(join(330551..331129,331190..331531,
FT                   331583..331764,331834..331881,331937..332106,
FT                   332172..332356))
FT                   /locus_tag="ANIA_06389"
FT                   /old_locus_tag="AN6389.4"
FT                   /note="transcript_id=CADANIAT00006590"
FT   CDS_pept        complement(join(330551..331129,331190..331531,
FT                   331583..331764,331834..331881,331937..332106,
FT                   332172..332356))
FT                   /locus_tag="ANIA_06389"
FT                   /old_locus_tag="AN6389.4"
FT                   /product="carboxylesterase, putative (AFU_orthologue;
FT                   AFUA_6G10800)"
FT                   /note="transcript_id=CADANIAT00006590"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006590"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006590"
FT                   /db_xref="GOA:Q5AZ91"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ91"
FT                   /protein_id="CBF69564.1"
FT                   /translation="MASPQVQHDGLNATFTGIETQCDGTAVHHFRGIKYASIPGRFERA
FT                   QPVTGFDGRTVDSSRFGPRCPQVDIDVRHLLRIPEDFVIEQEAEDEFECLTVDITCPPG
FT                   AASKDGLPVLVWIHGGSQIMTFCSAASKICDPTRLVADSIKSGQPFIFVSINYRLNIFS
FT                   FGDGGETNLAIKDQRLGLDWVRRNIAGFGGNADNITLAGESAGAIYVHAHLITGPPVKK
FT                   AVLASGSLYLSSPLPVERGNALIKALEAKVQQYGESSLRQATVLSLLRALKESNVNTMW
FT                   IQEDDELRDWETRPEHADEVMIGDTEYESVIWRNGIETFDGPTIAAAFEQNQTYGPTLR
FT                   KMYNVVPDRPTACKLGALDLVNDARYTLPVELISDKMAAAGKRVFKYVVDQVNPWQASA
FT                   RSHHAVDLLFLFGGIDLSFNPSADAVGKDMRRRWIAFVNGRSPWNPEKRFAFGPVGECR
FT                   EISEAGFAARRRVAHLQALREAGIGVYLPIVFALTAGKISLLN"
FT   gene            333443..336221
FT                   /locus_tag="ANIA_06388"
FT                   /old_locus_tag="AN6388.4"
FT                   /product="beta-galactosidase (Eurofung)"
FT   mRNA            join(333443..334397,334433..336143,336212..336221)
FT                   /locus_tag="ANIA_06388"
FT                   /old_locus_tag="AN6388.4"
FT                   /note="transcript_id=CADANIAT00006591"
FT   CDS_pept        join(333443..334397,334433..336143,336212..336221)
FT                   /locus_tag="ANIA_06388"
FT                   /old_locus_tag="AN6388.4"
FT                   /product="beta-galactosidase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006591"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006591"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006591"
FT                   /db_xref="GOA:Q5AZ92"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR032311"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR040605"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ92"
FT                   /protein_id="CBF69565.1"
FT                   /translation="MKLQSCAYLGWGLALAASSAVALSVRNTNKAPSQSVRERASLNHQ
FT                   WKFWHSEQIPDNIVYDLRPDANDSSFQVLKSWVLPVGNDYIKNANAQHERPSTEPDGDI
FT                   PYVHNDFDDSSWDVVRLPHDWAITRPFYTDDDPEIPSAMGRLPVQGVGWYRRKLNFTQE
FT                   DSDKVVLLEIDGAMSYPMVWLNGHLVGGWPYGYNSFQLDLTPYLQQGEENQLAIRVENP
FT                   SGSSSRWYPGGGIYRNVWLTKVNPTHVAHYGTKMTTRDVSSRRATIDFQVQIENKGQKR
FT                   QRVEVATEIFDLDSANGHVRGRKVEQFPRHKVIVDKDNPRLWGPPPDQTPNLYIAVTSL
FT                   YDASGHLLDTYSTEFGVRSVEYNPNTGLSVNGAPVRIQGVNQHHDLGALGAAFNRRAAQ
FT                   RQLELLCDLGVNAIRTAHNPPAPELLEMTDRMGFLVLDEIFDSWAQQKTDLDFHLIFND
FT                   WREPDLRSFLRRDRNHPSVIIWSIGNEVAEQSADDTAAAIATYLRDIVREEDNTRPVTA
FT                   SMNSAWPNSSFAGVVDLISLNYQGEGLRYGPAYSHLEGNRRDPQYSEFHVTHPDKLILG
FT                   SEVAWSLSTRGTFLFPVTNYTSAPVNDTSGGNSTTLEISAYELYSSDPGSSPDRVFATQ
FT                   DEHPFVDGGFVWAGWDYLGEPYPYYDGARSAYSGIIDLAGFKKERFYLYQARWQPDVRM
FT                   AHIVPHWSWPERVGQVTPVHVFTSGDEAELFVNGVSQGRLKRDPLTYRFRWDEVVYEPG
FT                   EVQVVAYKNGSKWATDTVKTAGEPTQLRLTPDRAQIAADGEDLSFVTLEVLDGKGNVVP
FT                   EAKNLIHFEVSGPGEIVATDNGFPADYTAFPSHERTAFHGLALCIVKGELGTHGDIVLK
FT                   ASSNGVGEAEVVIKASRGMP"
FT   gene            complement(336296..338015)
FT                   /locus_tag="ANIA_06387"
FT                   /old_locus_tag="AN6387.4"
FT                   /product="MFS amine transporter, putative (AFU_orthologue;
FT                   AFUA_6G10790)"
FT   mRNA            complement(join(336296..337623,337735..337862,
FT                   337894..338015))
FT                   /locus_tag="ANIA_06387"
FT                   /old_locus_tag="AN6387.4"
FT                   /note="transcript_id=CADANIAT00006592"
FT   CDS_pept        complement(join(336296..337623,337735..337862,
FT                   337894..338015))
FT                   /locus_tag="ANIA_06387"
FT                   /old_locus_tag="AN6387.4"
FT                   /product="MFS amine transporter, putative (AFU_orthologue;
FT                   AFUA_6G10790)"
FT                   /note="transcript_id=CADANIAT00006592"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006592"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006592"
FT                   /db_xref="GOA:Q5AZ93"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ93"
FT                   /protein_id="CBF69567.1"
FT                   /translation="MLTALRYRDRKHPLLLEWRASKGFIVFVVVFAIFTVGDQFLTFCC
FT                   MGLYVYRVTPRRSSLTNPQIVPVTPTALNERAGIAEGDGSLTQNARNEVLIKGSAPAGY
FT                   LADRIESRRWPLILGLVALGASTALLCVGTHIGLWIAGRLCQGVSAAVVWTVGCALLVD
FT                   TVDKEGLGQALGYIGMGMTFGAMGGPLLGGVLYEHGGYYSVFALAFALIALDIVFRVVM
FT                   IEKKDAVRWLAEHEQVQEPVSGTLQLQQPDDIVGREGEDEHEKRSSEPVPLRSNNPFPP
FT                   SSVEQPPKRKQRKAALLTLLESSRILVALWAYFILSLLLTSFDSVLPLFVEETFHWKQT
FT                   AQGLVFIPLTVPHILDPIFGYINDNYPSSRRYLAGGAFFATVPVLVCLRFVMTDSIHDI
FT                   ILLCALLALVGVCIAAMFSIILVEVSYVVQEKEDANPGVWGKGGAMALAYGLSNSAWAG
FT                   GSLAGPFLAGFIRESAGWGTMAWVLALVVGSTGVPVLGFIGGWLFRRCEGRSDRQVRGD
FT                   QRREMPVA"
FT   gene            complement(338298..339555)
FT                   /locus_tag="ANIA_06386"
FT                   /old_locus_tag="AN6386.4"
FT                   /product="mitochondrial NADH-cytochrome b5 reductase
FT                   (Eurofung)"
FT   mRNA            complement(join(338298..338940,339015..339092,
FT                   339179..339555))
FT                   /locus_tag="ANIA_06386"
FT                   /old_locus_tag="AN6386.4"
FT                   /note="transcript_id=CADANIAT00006593"
FT   CDS_pept        complement(join(338372..338940,339015..339092,
FT                   339179..339446))
FT                   /locus_tag="ANIA_06386"
FT                   /old_locus_tag="AN6386.4"
FT                   /product="mitochondrial NADH-cytochrome b5 reductase
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006593"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006593"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006593"
FT                   /db_xref="GOA:Q5AZ94"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ94"
FT                   /protein_id="CBF69569.1"
FT                   /translation="MANLVNRRLVANALAVLALSGIGVYTASNCWIKNASAESRSAEPQ
FT                   KVFGRGPAFKSLRLHSSESVSDNTKRLRFELPGGESSISGLSLTSALLTFSRPEGSWLP
FT                   AVRPYTPISKLDEPGFVDLLVKRYPNGKASTHLHSLKPGDNLFILASIPGFNWTPNKFS
FT                   HVYLIAGGAGITPIYQLAQGILDNPADKTKITVIFGVNTEKDMLLREEFDAYQRAYPDR
FT                   IDVLYTVSRPGSEFRPAPNVRSGYVTRQVLAEVMGGPDEADTKIFVCGPPAMEKALVGG
FT                   GFGQGQPGILQQLGYPRDRIYRF"
FT   CDS_pept        complement(join(340854..340859,340987..341067,
FT                   341270..342073,342106..342453,342675..342740))
FT                   /locus_tag="ANIA_06385"
FT                   /old_locus_tag="AN6385.4"
FT                   /product="transcriptional corepressor (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006594"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006594"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006594"
FT                   /db_xref="GOA:Q5AZ95"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ95"
FT                   /protein_id="CBF69571.1"
FT                   /translation="MSILGIITDIVDCINTLQSTLQRPKVEDNWGPELQTLEGHSDWIE
FT                   TVTFSPDGRLLASGSNDTTIKLWDPASGGLKQTLEGHSSSVQSVAFSPNGQLLASGSSD
FT                   TTIKLWNSASDSLKHTMEGHSDRVESVAFSPNGQLWNPAIGSLKHTIEGHSDWVLSVAF
FT                   SPDGQLLASGSAEKTIKLWDSATCGLKHTLGGHSNWVLPLVFSPDGRLLASGSNDATIK
FT                   LWDPPSGSLKHTLEGHSNKIESLAFSPNGQLLASGSSDATIKLWDTATGSFRHTLKGHS
FT                   DMVLSVVFSPDSQLLESGSGDNTIKLWDPATGILKHSMRTPGIVRSIEFSIELPQLITN
FT                   LGTFSIQAWHTGYPSRSSGKKTAVSVQRNRWVAIQGQKELWIPPEYQPISSAVQDSSIA
FT                   LGCKNGQIIYRHTVELRILSEQTSIVWRKDSKPNT"
FT   gene            complement(340854..342740)
FT                   /locus_tag="ANIA_06385"
FT                   /old_locus_tag="AN6385.4"
FT                   /product="transcriptional corepressor (Eurofung)"
FT   mRNA            complement(join(340854..340859,340987..341067,
FT                   341270..342073,342106..342453,342675..342740))
FT                   /locus_tag="ANIA_06385"
FT                   /old_locus_tag="AN6385.4"
FT                   /note="transcript_id=CADANIAT00006594"
FT   gene            complement(344376..345326)
FT                   /locus_tag="ANIA_06384"
FT                   /old_locus_tag="AN6384.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(344376..345326)
FT                   /locus_tag="ANIA_06384"
FT                   /old_locus_tag="AN6384.4"
FT                   /note="transcript_id=CADANIAT00006595"
FT   CDS_pept        complement(344376..345326)
FT                   /locus_tag="ANIA_06384"
FT                   /old_locus_tag="AN6384.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006595"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006595"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006595"
FT                   /db_xref="GOA:Q5AZ96"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ96"
FT                   /protein_id="CBF69573.1"
FT                   /translation="MPDPQDYTVGWICAIETEHVAAQRFLDHEFGRPDVLAPNDNNDYT
FT                   LGKIGGHHVVIAVLPGGEYGTSSAASIARDMLHRFPKIRFGLLVGVGGGVPSSKRDIRL
FT                   GDIVVSPSQGAGHGGVIQYDFGKEFQEQRFQPTGFLNRQPIILETAVNGLKAQYQRKGH
FT                   QLEEAINTVLENKRKMRRKYKRRELNSDRLFESQVIHPSDREGTCAEVCDMSRLIIREE
FT                   RDDGEDIPAIHYGLIASGNKLIKDAEFRDKLALEQNILCFEMEGAGLMNHFPCLVIRGI
FT                   CDYADSHKNKEWQEYAAMAAAAYAKDLLCRIVPGR"
FT   gene            complement(345868..348353)
FT                   /locus_tag="ANIA_06383"
FT                   /old_locus_tag="AN6383.4"
FT                   /product="carboxylesterase, putative (AFU_orthologue;
FT                   AFUA_6G10780)"
FT   mRNA            complement(join(345868..345907,346053..346092,
FT                   346296..346484,346530..346557,346589..347182,
FT                   347230..347591,347639..347814,347859..348137,
FT                   348187..348353))
FT                   /locus_tag="ANIA_06383"
FT                   /old_locus_tag="AN6383.4"
FT                   /note="transcript_id=CADANIAT00006596"
FT   CDS_pept        complement(join(345868..345907,346053..346092,
FT                   346296..346484,346530..346557,346589..347182,
FT                   347230..347591,347639..347814,347859..348137,
FT                   348187..348353))
FT                   /locus_tag="ANIA_06383"
FT                   /old_locus_tag="AN6383.4"
FT                   /product="carboxylesterase, putative (AFU_orthologue;
FT                   AFUA_6G10780)"
FT                   /note="transcript_id=CADANIAT00006596"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006596"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006596"
FT                   /db_xref="GOA:Q5AZ97"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ97"
FT                   /protein_id="CBF69575.1"
FT                   /translation="MAAVLKTTSFGIIQGKVSDAVTQYLGIKYATLKDRLADAVPIDSH
FT                   EGDALNATIDGPTAVSLPIGCDLELTHVQHTLPKKDLPQSDLDCLNLNIAVPSDAIPTS
FT                   RLPVFVFIHGGGFVIGANSWPQFDYARFVQLSVEKKLPIVAVSINYRLGAFGFLTSEEL
FT                   RNAGYKANNGLRDQRVAIEWVRKHIHEFGGDPDNINVAGMSAGGASVTYHLNSEKPLFK
FT                   RAIAMSGTYFLSQPLPYDAHEQNYQKAISALGLLDATPAERIKALLERPGSDIVSQLPP
FT                   SILAAPAIDGDVVPAAPSHAHTGSTTSDVPKGKNWCIDLMIGDSQMDASIIAFLFPHTK
FT                   IGCARKFIMALKTALQSQPAVVDEILKSYGITDESASDDDAYPAVLNYINDVLFFTPVL
FT                   SFAQGWKGNAYVYYFNEGNPWEGQWKGRTNHILDVSYLFQNFREFLSAEQQAVGTAFAE
FT                   DFFKFCHGQAPWPAITRATVTEGFTARRYGPSTKSPFGTVTQAFGGESQRRRDLYDCTE
FT                   KVSLDELANDRLIALSLEYSAFDLLETVHHDTQCFQSSSSQSGSRSRGSGHSLLCAHTQ
FT                   LSYRGRQNCSIGFDAWAREREHANVLLVELWYAFVGRCASESTFDEHV"
FT   gene            350021..351913
FT                   /locus_tag="ANIA_06382"
FT                   /old_locus_tag="AN6382.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            350021..351913
FT                   /locus_tag="ANIA_06382"
FT                   /old_locus_tag="AN6382.4"
FT                   /note="transcript_id=CADANIAT00006597"
FT   CDS_pept        350021..351913
FT                   /locus_tag="ANIA_06382"
FT                   /old_locus_tag="AN6382.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006597"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006597"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006597"
FT                   /db_xref="GOA:Q5AZ98"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ98"
FT                   /protein_id="CBF69576.1"
FT                   /translation="MKFSQILTGLAGASSLCSALAASTSAPYGLNQGQKIRHNSATAAA
FT                   AVCSADDATYSSESMPAGEYTDWGALGLDDVTSGRQYITIVNLTPHRFKLDSTHSYQMD
FT                   MFDWGDIPPGRARQNIAHYSTRLTANPVDTGGEAYYSIVGTSKKFEIRATTHVPHMYWR
FT                   RTVIDLSDMGLGQREYLDPRAEVPVTLVITGSDSYGFMASLTHGSGNWMKQMYRVIKDR
FT                   PLQHLVMPGTHDSGMSTISGKIVSIGSEANTQTQGLNIYDQLRVGARWFDLRIMSVHQS
FT                   DPSSYEFWVAHVNDETADVPVGNTGESLADIINEVNRFTSENPGEIIFLKLRYLIGIKR
FT                   LPGGAIRWNTAIANKFFSELKKINNRCPNLDTTTKFQRQKASYFMDQNDGKGCVLFLLD
FT                   GSNIPSGVPSSSPSDGIYPASAMTVNDHWSNLATTQPVAEDQIAVWSAINRVSPFTNDQ
FT                   FLISQWLVSADALQTTALTIQNIAIMPTNPALYWAGVNAMSPTKWPNVLLVDYIGVVIT
FT                   DQFAWNQLSAELYTLAIGLNLYMLSENCDVSGQRSPLLPPVAEASKTLAVKSALQKIAP
FT                   SWNGIIFANGTIIDKPPRNLHYGRMELLKNGTVFGNGTVLEKDVPNPYLYSVLA"
FT   misc_feature    352053..358890
FT                   /note="contig 1.208 1..6838(1)"
FT   gene            complement(352165..353739)
FT                   /locus_tag="ANIA_09495"
FT                   /old_locus_tag="AN9495.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(352165..352281,352315..353739))
FT                   /locus_tag="ANIA_09495"
FT                   /old_locus_tag="AN9495.4"
FT                   /note="transcript_id=CADANIAT00006598"
FT   CDS_pept        complement(join(352165..352281,352315..353739))
FT                   /locus_tag="ANIA_09495"
FT                   /old_locus_tag="AN9495.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006598"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006598"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006598"
FT                   /db_xref="GOA:Q5AQD5"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQD5"
FT                   /protein_id="CBF69578.1"
FT                   /translation="MAPPKRLSDVQRKALRDWVHSQSRRPTQKACIAWFQAHYNHRLSQ
FT                   STVSDILSPQYHYLDSECNPSSATRKGIGQWQDLEAILYEWHHTLDCKGAYISGEILIE
FT                   KARQIWSSLPQYRDQPPPAFSSGWLHRFKQRYNIKQRTYHGEAGSVLEDAEEGMKAIRT
FT                   IAGQYNEDDIYNMDETGLFWRMPPSQSLSSVNRPGIRKDKTRISMICCVNASGTDRLPI
FT                   WVIGKAHKPRALRNINTSAIGIRWQWNKNAWMNQIIMREWLLEFYQHIGQRSILLTMDN
FT                   LPAHLSGLELAPPPPNIRICWLPKNSTSRYQPLDQGIIQNLKIYYRKQWLRYMLSHYER
FT                   DLDPLESVTILDCIRWLVRSWHHDVLSSTILACFYKSTLVPDPIQLPVEAPDLKPLYKK
FT                   VQQSGNLSDCMDISFFLNPAEESQEPTSSSNGMFSEVLLEQLITEASGSTDIYSDDLDD
FT                   DTAEPAPLPKPQDALDADASKAPILRSLERLERDLEGEIITARAQGTLDSWLSNV"
FT   gene            354291..355156
FT                   /locus_tag="ANIA_09496"
FT                   /old_locus_tag="AN9496.4"
FT                   /product="EBDP3 [Source:UniProtKB/TrEMBL;Acc:A5Y5I8]"
FT   mRNA            354291..355156
FT                   /locus_tag="ANIA_09496"
FT                   /old_locus_tag="AN9496.4"
FT                   /note="transcript_id=CADANIAT00006599"
FT   CDS_pept        354291..355103
FT                   /locus_tag="ANIA_09496"
FT                   /old_locus_tag="AN9496.4"
FT                   /product="EBDP3 [Source:UniProtKB/TrEMBL;Acc:A5Y5I8]"
FT                   /note="transcript_id=CADANIAT00006599"
FT                   /db_xref="GOA:Q5AQD4"
FT                   /db_xref="InterPro:IPR007905"
FT                   /db_xref="InterPro:IPR033118"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQD4"
FT                   /protein_id="CBF69580.1"
FT                   /translation="MSTVTPPASSFTIDTPTILCILFALSFMPIAYVLGNNLIPSSQTR
FT                   NRILFYWHAYDALTHLFIEGSFLYECFTSYATLPAGFAAPEPAFLGIKDRVYGAAHGSA
FT                   PSARLWQEYAKADKRWATADATVISLELLTVFLGGPAAIYVCYLVWQSSCTQPAPKPTS
FT                   SKSSSPKSTSKSSAAKLESQGASKAKLWLVATALATAELYGGFMTFVPEWLTGSTQLDT
FT                   SNAVYLWFYLFFFNTLWVWIPLWVLWEAAKEVKRAFVLAEGVEGKKVK"
FT   gene            complement(355249..356334)
FT                   /locus_tag="ANIA_09497"
FT                   /old_locus_tag="AN9497.4"
FT                   /product="HAD superfamily hydrolase, putative
FT                   (AFU_orthologue; AFUA_6G10760)"
FT   mRNA            complement(join(355249..355959,356054..356213,
FT                   356262..356334))
FT                   /locus_tag="ANIA_09497"
FT                   /old_locus_tag="AN9497.4"
FT                   /note="transcript_id=CADANIAT00006600"
FT   CDS_pept        complement(join(355249..355959,356054..356213,
FT                   356262..356281))
FT                   /locus_tag="ANIA_09497"
FT                   /old_locus_tag="AN9497.4"
FT                   /product="HAD superfamily hydrolase, putative
FT                   (AFU_orthologue; AFUA_6G10760)"
FT                   /note="transcript_id=CADANIAT00006600"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006600"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006600"
FT                   /db_xref="GOA:Q5AQD3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQD3"
FT                   /protein_id="CBF69582.1"
FT                   /translation="MPGVNPDLPPVRACLFDMDGLLIDSEDLYTDITNQVLHSFGKPSL
FT                   PWSIKAQLQGRPQPEAARIFSDWAQLPISHEEYVSRISALQAELFPTTKPLPGVETLLK
FT                   NLVSTQKGPNPVHIALATSSHTRNYHLKTSHLQDLFSLFPESQRVLGDDPRIGKGRGKP
FT                   LPDIYLLALETINAGLREKGEKEITPEECLVFEDAVPGVEAGRRAGMRVVWVPHPGLLE
FT                   AYKGREEEVLAGLTGEHKEEEKSEAEKEATELAEERLKANSAGTPGKLGDGFAELLTTL
FT                   ENFPYERYGIKVADA"
FT   gene            356546..357490
FT                   /locus_tag="ANIA_09498"
FT                   /old_locus_tag="AN9498.4"
FT                   /product="tetratricopeptide repeat protein 1 (TTC1),
FT                   putative (AFU_orthologue; AFUA_6G10770)"
FT   mRNA            join(356546..356665,356730..357335,357389..357490)
FT                   /locus_tag="ANIA_09498"
FT                   /old_locus_tag="AN9498.4"
FT                   /note="transcript_id=CADANIAT00006601"
FT   CDS_pept        join(356546..356665,356730..357335,357389..357490)
FT                   /locus_tag="ANIA_09498"
FT                   /old_locus_tag="AN9498.4"
FT                   /product="tetratricopeptide repeat protein 1 (TTC1),
FT                   putative (AFU_orthologue; AFUA_6G10770)"
FT                   /note="transcript_id=CADANIAT00006601"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006601"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006601"
FT                   /db_xref="GOA:Q5AQD2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQD2"
FT                   /protein_id="CBF69583.1"
FT                   /translation="MPPDTSSASNGRDLTNHAGSDTENEDEVFHDARFPPEEETRLLAE
FT                   SHSLKAEANNLYSAASYSQAISTYDRALASCPSYLDYEIAVVRSNMSACYLKLGDWKAA
FT                   VDSANACIEGLDRVVPPSQPEDGKEGAAKEADSVVEIPVDDEVNEQAALQRIKENDERK
FT                   RDVARIRAKALMRRARAKSELGGWANLQGAEEDYKLLAGMENLPPSDRKVVQKALRELP
FT                   ARISKAKEVEMGEMMGKLKELGNGILKPFGLSTDNFKFVQDPKTGGYSVNFSS"
FT   gene            complement(358024..358867)
FT                   /locus_tag="ANIA_09499"
FT                   /old_locus_tag="AN9499.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(358024..358279,358444..358611,
FT                   358660..358765,358810..358867))
FT                   /locus_tag="ANIA_09499"
FT                   /old_locus_tag="AN9499.4"
FT                   /note="transcript_id=CADANIAT00006602"
FT   CDS_pept        complement(join(358024..358279,358444..358611,
FT                   358660..358765,358810..358867))
FT                   /locus_tag="ANIA_09499"
FT                   /old_locus_tag="AN9499.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006602"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006602"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006602"
FT                   /db_xref="GOA:Q5AQD1"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQD1"
FT                   /protein_id="CBF69585.1"
FT                   /translation="MSTTFEIPRYDHVPETKEDLDLAELVTIDLSRFDHPEGKEELVQK
FT                   LDHAVKNVGTLLLCQELNITQEEVDRQFALGREFYALPLEEKLKYHSASNLEKGEYNSY
FT                   RPAGHRIRKCHTEVVEKLLRLFAILLELPDDDQLVRDHQYDVEGEDHLRYMHYAARGAE
FT                   ENKRAAEIYSRPYRFGIRDVALQAACCGAANP"
FT   gap             358891..358990
FT                   /estimated_length=unknown
FT   misc_feature    358991..803510
FT                   /note="contig 1.107 303..444822(-1)"
FT   gene            359525..361297
FT                   /locus_tag="ANIA_06381"
FT                   /old_locus_tag="AN6381.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(359525..359757,359943..360094,360147..360522,
FT                   360586..360828,361252..361297)
FT                   /locus_tag="ANIA_06381"
FT                   /old_locus_tag="AN6381.4"
FT                   /note="transcript_id=CADANIAT00006603"
FT   CDS_pept        join(359525..359757,359943..360094,360147..360522,
FT                   360586..360828,361252..361297)
FT                   /locus_tag="ANIA_06381"
FT                   /old_locus_tag="AN6381.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006603"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006603"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006603"
FT                   /db_xref="GOA:Q5AZ99"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZ99"
FT                   /protein_id="CBF69587.1"
FT                   /translation="MSDPSKKPKSPILGLFKEVFNWYPSSYPAEERKLLLGSISPTWSA
FT                   PASAVSPFFVCSEHHLTKSVFVKYLDQTNISNAARWLLPTLEILWGSCTFAQSRVRNVH
FT                   QLYALRFLVGMFEAPVFAETHFILGSWYSGSDLFNRAGTWFICNPLSQIISGYLQAAAY
FT                   TNLSGVGGMPGWRWLFIIDGIFTIPVALIGFLVFPGVPDSPAPFFLTKRDIEIAKDWLS
FT                   RAKIRRPGSLGPDVFKRTAKRWHIYIFLFSYACMILSSYPSSYMNLWLKDEGYSVTKIN
FT                   QYPTIIQTITIVSSWLGTTLASIYPSWIIYTIISTFSLFSTLCMCICCIPTGLKRDQKR
FT                   KQLAGESES"
FT   gene            362518..363468
FT                   /locus_tag="ANIA_06380"
FT                   /old_locus_tag="AN6380.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            362518..363468
FT                   /locus_tag="ANIA_06380"
FT                   /old_locus_tag="AN6380.4"
FT                   /note="transcript_id=CADANIAT00006604"
FT   CDS_pept        362688..363224
FT                   /locus_tag="ANIA_06380"
FT                   /old_locus_tag="AN6380.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006604"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006604"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006604"
FT                   /db_xref="GOA:Q5AZA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZA0"
FT                   /protein_id="CBF69589.1"
FT                   /translation="MPHFHHKRRHSWPYSGSTKDLNERNLPVITVTGPADEFEGQFLTP
FT                   VESNEWFEDDAASAGIVRTQPTHSHRLWHHTKDKPETNRTTTGTVSLRKMMQPPLDRAR
FT                   SLFVLPSTSAKETVSLPDWVQKLSAHPINTKERGRPRDDTRDRLMIEKNHRRCHSERPR
FT                   SWKRPSEDLWTLLEE"
FT   gene            364647..366163
FT                   /locus_tag="ANIA_06379"
FT                   /old_locus_tag="AN6379.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(364647..364880,365397..365441,365487..365537,
FT                   365728..365744,365987..366069,366126..366163)
FT                   /locus_tag="ANIA_06379"
FT                   /old_locus_tag="AN6379.4"
FT                   /note="transcript_id=CADANIAT00006605"
FT   CDS_pept        join(364647..364880,365397..365441,365487..365537,
FT                   365728..365744,365987..366069,366126..366163)
FT                   /locus_tag="ANIA_06379"
FT                   /old_locus_tag="AN6379.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006605"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006605"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006605"
FT                   /db_xref="GOA:Q5AZA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZA1"
FT                   /protein_id="CBF69591.1"
FT                   /translation="MSRPNTPRSYPAGIDTSVPRDSFSSTESPSPLQSTPRRTGSSKSR
FT                   ASSDSRRRYDNTVYHYGRHSNYWLFGGFSVRDTHSVIFVELDQAEQELFIPGAAGAFSA
FT                   QAVVAERATNEGCQLLMVARSLARYTFVHVSSVAEYWSWESQQSVLENKLN"
FT   gene            complement(366478..367580)
FT                   /locus_tag="ANIA_06378"
FT                   /old_locus_tag="AN6378.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(366478..366566,366648..367044,
FT                   367533..367580))
FT                   /locus_tag="ANIA_06378"
FT                   /old_locus_tag="AN6378.4"
FT                   /note="transcript_id=CADANIAT00006606"
FT   CDS_pept        complement(join(366478..366566,366648..367044,
FT                   367533..367580))
FT                   /locus_tag="ANIA_06378"
FT                   /old_locus_tag="AN6378.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006606"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006606"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006606"
FT                   /db_xref="GOA:Q5AZA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZA2"
FT                   /protein_id="CBF69592.1"
FT                   /translation="METKLLMWQTSDLIILGSNYSLSFTIEPPTSAAPGVPFSIPVIVA
FT                   VRSVGNANSDPLQQLGARAVLWDESGTSSTVDLTGNTSTSVRSRTGNSTSGYAVFNRLT
FT                   VKSPGRYKLRVMSVLNTASGVSVQGSIDSGIIHVHSGAAASQPPSPAQIARLQALVPEN
FT                   IGISQADIAAWQQA"
FT   gene            370381..372985
FT                   /locus_tag="ANIA_06377"
FT                   /old_locus_tag="AN6377.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(370381..370464,370817..372985)
FT                   /locus_tag="ANIA_06377"
FT                   /old_locus_tag="AN6377.4"
FT                   /note="transcript_id=CADANIAT00006607"
FT   CDS_pept        join(370381..370464,370817..372985)
FT                   /locus_tag="ANIA_06377"
FT                   /old_locus_tag="AN6377.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006607"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006607"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006607"
FT                   /db_xref="GOA:Q5AZA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZA3"
FT                   /protein_id="CBF69594.1"
FT                   /translation="MTEVQSEAGSEANLDRSLLPKPLATMAIMAPVPYRPPPTPLIQQR
FT                   PLIAPSFTPVQPTSFIPWKLFLQLLAGTVCIFILTVLIWKFPRLLRSFTKGRILREGNT
FT                   TSSRYAKTWYGWVSLQRHEARKRVVRDCMANIHSWNPWRSSRADFEWIWRYSDQKELAT
FT                   YKESGKHQLSWPVFHGHETIGSIWSHCSPSIAEPLTIGGLETASHPIATGALPTPHTPR
FT                   PMATPVRATRTDIPICEGYGNNSLPRHSTVRQLQRDRIGRGFRSDTSTHELSYIGKSFT
FT                   SLSKIPFSRISRRVPLWYLNHTQPSPHSFSMPCLPQAKQSPPYRYARSTVTTRSGRTGS
FT                   EDMPSDIYLTFHRSRKYQVWSARMGLQTLKCLGYSTHTLPRGPPGSPKSAVLGSLSLDA
FT                   AASEIVHQHRQGPKWTSSSDISDLFLYGSDQQHNTRLPVSLPEHKTEGNVQKEWPSLPL
FT                   QRSPLAPLHRPTLITWYENSLPDLQTSITKVEIEKKQSSNRRRKLSNPGKIPHRVTQPK
FT                   NWSNWEVRLIENLDRRLGWIESQLTPGQRPFHFALLANHWLNRDTWIVFDPVSRVDTDK
FT                   RRLWGDPRFNVPYPKPSSVPTPKYPKSARQPAHTPKINSWRVAVNQQRKASGQKVFLHS
FT                   IEHYDSSVEDPPDGHIDPASWVLRRPPQGFGLSSRQGERYYEGGAGWQEKLSDWQKIRR
FT                   GYRIRKAIFEGRVNRRRAKELVYGIARYYQYATKLLQPDNGHCQVGSWELSIDELS"
FT   gene            complement(373709..374234)
FT                   /locus_tag="ANIA_06376"
FT                   /old_locus_tag="AN6376.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(373709..373761,373844..374073,
FT                   374194..374234))
FT                   /locus_tag="ANIA_06376"
FT                   /old_locus_tag="AN6376.4"
FT                   /note="transcript_id=CADANIAT00006608"
FT   CDS_pept        complement(join(373709..373761,373844..374073,
FT                   374194..374234))
FT                   /locus_tag="ANIA_06376"
FT                   /old_locus_tag="AN6376.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006608"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006608"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006608"
FT                   /db_xref="GOA:Q5AZA4"
FT                   /db_xref="InterPro:IPR016340"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZA4"
FT                   /protein_id="CBF69596.1"
FT                   /translation="MFKPSSPLFSGLLWKIPWRISQPQKARQRKRLRAVDKVVDTVSAA
FT                   LARNGQTTKAVERWYREMPREEEMLPRDKYTIFDKKEKTYRKGIHKLPKWTRVSQRVNP
FT                   PGF"
FT   gene            374928..377904
FT                   /locus_tag="ANIA_06375"
FT                   /old_locus_tag="AN6375.4"
FT                   /product="tafazzin (AFU_orthologue; AFUA_2G13960)"
FT   mRNA            join(374928..375037,375139..375889,375974..376104,
FT                   376184..377904)
FT                   /locus_tag="ANIA_06375"
FT                   /old_locus_tag="AN6375.4"
FT                   /note="transcript_id=CADANIAT00006609"
FT   CDS_pept        join(374928..375037,375139..375889,375974..376104,
FT                   376184..377837)
FT                   /locus_tag="ANIA_06375"
FT                   /old_locus_tag="AN6375.4"
FT                   /product="tafazzin (AFU_orthologue; AFUA_2G13960)"
FT                   /note="transcript_id=CADANIAT00006609"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006609"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006609"
FT                   /db_xref="GOA:Q5AZA5"
FT                   /db_xref="InterPro:IPR000872"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZA5"
FT                   /protein_id="CBF69598.1"
FT                   /translation="MDDPLVWGFLPLKYNFGLSSSNRRWGMASHDICYQARSAHSKHGG
FT                   IAQPAVTQAIRLLSKGPFPAEPHLAKPERQSWSLQNVCVDPFSDLPTAYTTDGEDSHLA
FT                   PSAYSCNSYSWVHIFPEGKIHQSPNKTMRYFKWGVARLILEASECPDIVPMWLEGFDQV
FT                   MHESREFPRFLPRPGKEVSVTFGQKVDTEAVFGEMRRRWQKLKAKAELASPETRDLPLG
FT                   ALSDELLYGDEAVELRKEVTKKVRDLVLEVRRSRGHSDEDPKAGLVETWMEEGGKREGK
FT                   MKDESWKTLGVDIIDRGRAHLSDLSHDDSVVDSALALYCSPLTVFISLSIPHYSLSSSS
FT                   HNSQNDRFRTPDRPSVNDLIDHLRRTQLSPSGLDKKNRNIPRYVTPRSVHPSLRNVLEL
FT                   PETPPPRPRPDARRTGLGQRRLRRTPGPPPPESWLSGNTSAAEDEDAELNAAETAKIFH
FT                   RLERLPGSVFPARSSFLHAVLKSMAMHWAWHVDYDGQFLGFLPTHIKVLLLSYIAYYAR
FT                   MQPLGMRGLKPLFDNTADVDVVEHGRLADGNSHVTRLDLSGALGRWISLKQLFAELILS
FT                   KRNAGSAQDGTTKAIPLSWEDEYENDAASGTAGAISKPLSHLRFTNLQYLSLAHPQKAT
FT                   VSWNSLINLLSHLSTITHLSLAHWPVPMVTPNAINARVRHPTHRSLTFSYGGTDSYSAM
FT                   ENNWAESAGILRRLSRATYCLKWLDLEGCADWIPALNWEGVGPNGEMYSTGPEWNGSWR
FT                   DIEWIRLGPGWLPHLQDSELATLSGAASTSNINAPSPRSLASSIHAPAASDVSTETWDV
FT                   ELERQKYRRAKELERFRETMHDAKEVQQRVLRARKDGRGKWVHFSFGLEELTSDVRDRL
FT                   LGEELRNKFL"
FT   gene            complement(378090..380085)
FT                   /locus_tag="ANIA_06374"
FT                   /old_locus_tag="AN6374.4"
FT                   /product="ATP-dependent RNA helicase dbp9 (EC 3.6.1.-)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZA6]"
FT   mRNA            complement(join(378090..379158,379218..379696,
FT                   379753..379829,379878..380085))
FT                   /locus_tag="ANIA_06374"
FT                   /old_locus_tag="AN6374.4"
FT                   /note="transcript_id=CADANIAT00006610"
FT   CDS_pept        complement(join(378090..379158,379218..379696,
FT                   379753..379829,379878..380085))
FT                   /locus_tag="ANIA_06374"
FT                   /old_locus_tag="AN6374.4"
FT                   /product="ATP-dependent RNA helicase dbp9 (EC 3.6.1.-)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZA6]"
FT                   /note="transcript_id=CADANIAT00006610"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006610"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006610"
FT                   /db_xref="GOA:Q5AZA6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZA6"
FT                   /protein_id="CBF69600.1"
FT                   /translation="MKRKLDANDVPSTEANEAEEVKGADRDEDFETLNLDPRLRQALVK
FT                   EKFSKPTPVQAKAIPLALEGKDILARAKTGSGKTAAYVLPILQTILQKKAIDPSMKATT
FT                   GLILVPTRELAEQVQKVITTFAAFCGKDVRSVNLTQKVSDAVQKAMLADYPDIVVSTPA
FT                   RVIANLGTSALSLENLTHLVIDEADLVLSYGYEDDINALSKAIPRGVQTFLMSATLTAE
FT                   VDTLKGLFCRSPVILKLEDKDDHGAGVSQFVVKCAEDEKFLLTYVIFKLQLIKGKVIIF
FT                   VGDIDRSYRLKLFLEQFGIKSCILNSELPVNSRIHVVEEFNKGVYDIIIAADEQEVLGV
FT                   SKSRKSKDATEGDDELLSDEDEETSAKAASTRTDKRRKLSSKEKDYGISRGIDFQNVAC
FT                   VLNFDLPTSSKSYTHRIGRTGRGGKTGMALSFVIPADKYGKHKPTSISSAKHDEAVLAK
FT                   IIKRQAKLGHEVKPYHFDMTQVDAFRYRMSDALRAITRLAIQEARAREIRQELVKSEKL
FT                   KRHFEENPEELRQLRHDGELRAARIQPHLKHIPEYLMPAKGKKGISNEDVGFVSLRKTG
FT                   PENRIRKARDRNRGRGKKPGRKIDPLKTFNRGRK"
FT   gene            complement(380590..382021)
FT                   /locus_tag="ANIA_06373"
FT                   /old_locus_tag="AN6373.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(380590..380890,380943..381097,
FT                   381198..381238,381288..381327,381381..381660,
FT                   381720..381782,381834..381909,381958..382021))
FT                   /locus_tag="ANIA_06373"
FT                   /old_locus_tag="AN6373.4"
FT                   /note="transcript_id=CADANIAT00006611"
FT   CDS_pept        complement(join(380590..380890,380943..381097,
FT                   381198..381238,381288..381327,381381..381660,
FT                   381720..381782,381834..381909,381958..382021))
FT                   /locus_tag="ANIA_06373"
FT                   /old_locus_tag="AN6373.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006611"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006611"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006611"
FT                   /db_xref="GOA:Q5AZA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZA7"
FT                   /protein_id="CBF69602.1"
FT                   /translation="MSDGYDSDRSAYAEEPHPYARGARQGRPHHAQGYDVQSHYAYYSS
FT                   SREIPRHVTVPENPTSSRGTSGHEEEPHYIYSSGRSNSHIYDEGHEPGYEAQFIQYDQE
FT                   PDYEDQFDEREETSRYGNDYRLGTTRRNTNTQVEYPPHTVQLGPYRGSYPEVMPTPGHP
FT                   MSLPSQSVLDPRYMVQPPHYYREGKVFSILWHENDGRAGGTLVSRGPLYRGRFGEPIYS
FT                   TIRRMVVFRQYEQCSWCFAITTYHGRGVAKRGVDPDKHAIVHMRGTTPTLGVGEPRMAK
FT                   EPLEVVPENPSENLDYMSRLNFSKIYTVEHNVKVLPIGRISSRSMTRFLEYARYELAL"
FT   gene            383289..384914
FT                   /locus_tag="ANIA_06372"
FT                   /old_locus_tag="AN6372.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            383289..384914
FT                   /locus_tag="ANIA_06372"
FT                   /old_locus_tag="AN6372.4"
FT                   /note="transcript_id=CADANIAT00006612"
FT   CDS_pept        383289..384914
FT                   /locus_tag="ANIA_06372"
FT                   /old_locus_tag="AN6372.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006612"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006612"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006612"
FT                   /db_xref="GOA:Q5AZA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZA8"
FT                   /protein_id="CBF69604.1"
FT                   /translation="MHLAALQNRRSRTDPTPKSESLRGQSFTESHVPPQHPLPLSSPGL
FT                   SLELDGSYHCINTSDAQGNPVQPAHDSEQYPLDRGSFAPTQPSPNHRAINEGHHEVRQH
FT                   APTTEEESEASRNTREAELLQLYEKFNDLSAKRVRARQSRMALRYKREDELELRVRFMK
FT                   HLNSFFADMDLPEAGPIMEEYQLLQVATEDYLRLEDSYRQEEDELEEQEYLLSISIESL
FT                   TRSQNWGPEPNFQPGTRTWSPVSDDDAAVRELPHCITAYLSRIGDERILQERLADLDSE
FT                   WFFTTERQAQRLQYKLSMEDEDSKYFLKTYDEERARIWKELNNAQMDVVSLHAICLEEG
FT                   HRGFDYEDLSALNIYQHYVDDTLWAPETGPLRLPLDEYFVFSGESQVSSLDQDYPIPLE
FT                   PNSGTADQSPLRRFQFSQALQQTSSIRSNEFINKWMLHQLRISSIGIWHLQRSPRWQSL
FT                   RAQGLREYEISQLILDWWFSDETAQAPSSDNSYLNNADDGDADTFVGYANGQGRHLKKA
FT                   SSQSLVSSPRVSAPKLGPRRYSRP"
FT   gene            complement(385190..386944)
FT                   /locus_tag="ANIA_06371"
FT                   /old_locus_tag="AN6371.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(385190..386768,386898..386944))
FT                   /locus_tag="ANIA_06371"
FT                   /old_locus_tag="AN6371.4"
FT                   /note="transcript_id=CADANIAT00006613"
FT   CDS_pept        complement(385473..386636)
FT                   /locus_tag="ANIA_06371"
FT                   /old_locus_tag="AN6371.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006613"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006613"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006613"
FT                   /db_xref="GOA:Q5AZA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZA9"
FT                   /protein_id="CBF69605.1"
FT                   /translation="MPPAQHAGWFPSILGRSILSSTMRIHQSLQQDSKSDDAFTPTPVD
FT                   KTHTLVARADKTYHPGEGSINPNNINMRGLYALFAILGAGLVLASIWFFFWAKDGGFVW
FT                   KEGDWEEYKSTVLRRKGPDGRTLSNATRSTRLGGGSINGKSFFGEDDGYTVADTAPTYS
FT                   DETATTITEKGPKRKRNLRDKFRRKRNEKYEGEVDEDVRAYRKEKPAQIGGINREADGT
FT                   YYGSDYDTSAPPTQYNQSEMSEVRDYAYEPARHSQGRRDFSFVAGTEETMSQTTTERML
FT                   REPSARRHNRRRERRSRPPPTSSSRQSSPRKRESRGHYTEPLDFSSNSQSRSDYQYSNV
FT                   GTEEEDLGTISYHHPIPGLSKGYRRDGARSRRRDSLSDSDGDETRYS"
FT   gene            390796..393128
FT                   /locus_tag="ANIA_06370"
FT                   /old_locus_tag="AN6370.4"
FT                   /product="hypothetical protein"
FT   mRNA            390796..393128
FT                   /locus_tag="ANIA_06370"
FT                   /old_locus_tag="AN6370.4"
FT                   /note="transcript_id=CADANIAT00006614"
FT   CDS_pept        390796..392712
FT                   /locus_tag="ANIA_06370"
FT                   /old_locus_tag="AN6370.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006614"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006614"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006614"
FT                   /db_xref="GOA:Q5AZB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZB0"
FT                   /protein_id="CBF69607.1"
FT                   /translation="MSRKAPLAASVEEYDEDAHVSLPETRQFANVTAKRSKSDLKKSAR
FT                   VPFVEAASDSGYSSRTAATVNSTQSAPSGSRHPPAPLKVDTSHKKTDLERVRSRTKERP
FT                   RDRSAHPSREDRMHAGPYSAGYPPVHLPRSPSVSHRHERTYTRHYPSNNWDPEQSVYHP
FT                   AHAESRPREYQYYSSQASSYDYPPPSSQTSRYAPAAVVVSSSTRPHGRSARSNSYHANN
FT                   RPVSFNGMMPSMNGIMYSSSPVGRYDHGPPLSSSAYANSPAYSPAPSVYQQPPFYPYPD
FT                   ATSPPERMDRSMSRPREHRQPRPSIFEPPAIDYDTSEEEEEEEEEDVEGELMEPSPPPP
FT                   PPGPPRQARPRHPSHSLDRGEDEYYRSMPRPPLKQRAPPPQIIQKRPGLHHKSATAPSI
FT                   VSERRGSRSLDFTELQDVLSEYGYNRGSGGGTIIPERNRSLRRPSVYHDSSRSAARVAV
FT                   EHSTRRRRPKVYDYGPPDEIEEKVGGAEEYQASQSSKAAAPSMSLSDALLKAKANSQAA
FT                   SDSGSQKSRSASSRGSGSDARTRPGSGALTTTRAEDDDNIVMTLNGVTMNFTQESLGGK
FT                   RISVRSGQTGAVELNIEGKRPKKYLTGGSEYTTASGGSRKGDRKSDRASRRSSRSTYAP
FT                   PRY"
FT   gene            complement(394844..397143)
FT                   /locus_tag="ANIA_06369"
FT                   /old_locus_tag="AN6369.4"
FT                   /product="ABC transporter, putative (Eurofung)"
FT   mRNA            complement(join(394844..394886,394970..395055,
FT                   395126..395403,395488..395641,395691..395770,
FT                   395817..396187,396342..396569,396624..396864,
FT                   396945..397143))
FT                   /locus_tag="ANIA_06369"
FT                   /old_locus_tag="AN6369.4"
FT                   /note="transcript_id=CADANIAT00006615"
FT   CDS_pept        complement(join(394844..394886,394970..395055,
FT                   395126..395403,395488..395641,395691..395770,
FT                   395817..396187,396342..396569,396624..396864,
FT                   396945..397143))
FT                   /locus_tag="ANIA_06369"
FT                   /old_locus_tag="AN6369.4"
FT                   /product="ABC transporter, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006615"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006615"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006615"
FT                   /db_xref="GOA:Q5AZB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZB1"
FT                   /protein_id="CBF69609.1"
FT                   /translation="MACSSSSSSSDGLNAPDVEQNAGSHDFLMNHSVQSFSWSDLTVSV
FT                   RDRRTKQPLNLIESVSGSVQQGELVALMGPSGCGKTTLLNVLARRAASSGAKSSGHCYV
FT                   NGGEVDNATFGRITSYVEQEDALIGSLTVRETLKFAADLSLPGFVSRSERVERIHTLLE
FT                   SFGIQNQASTLVGTPIRKGISGGQKRRVSVASQLITCPKILFLDEPTSGLDSTASYEVI
FT                   SGKTCYYGPVKQVPSYFGSIGYPIPPQTNPAEFILDIVSSDFMSEKNSMRNDVEAIQSA
FT                   WSQSPESSRLKQQRTEFAEKGSRRVVVDEASRPGLLSITISLLHRLLIKSYRDVVAYGI
FT                   RIVMYMGLAIMMGTVWLRLGTEQEYIQPFINAIFFGSAFMSFMAVAYVPAYLEDRATFT
FT                   KERANGLYGALPFIISNFIIGLPFLFLISILFSIVSYWLSNFRPSAPAFFTWVMWLFLD
FT                   LVAAESLVVLVTSIFPNFVIALALVAFANGLWMSVGGFLVSPNILNPFWKYVFHYIDYQ
FT                   AYVFQGMMVNEFAERIYSCASNGSECNCMQMGWDPAGDYRRL"
FT   gene            complement(398078..400365)
FT                   /locus_tag="ANIA_06368"
FT                   /old_locus_tag="AN6368.4"
FT                   /product="arginyl-tRNA synthetase (AFU_orthologue;
FT                   AFUA_2G14030)"
FT   mRNA            complement(join(398078..398152,398204..398617,
FT                   398667..399973,400036..400365))
FT                   /locus_tag="ANIA_06368"
FT                   /old_locus_tag="AN6368.4"
FT                   /note="transcript_id=CADANIAT00006616"
FT   CDS_pept        complement(join(398146..398152,398204..398617,
FT                   398667..399973,400036..400260))
FT                   /locus_tag="ANIA_06368"
FT                   /old_locus_tag="AN6368.4"
FT                   /product="arginyl-tRNA synthetase (AFU_orthologue;
FT                   AFUA_2G14030)"
FT                   /note="transcript_id=CADANIAT00006616"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006616"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006616"
FT                   /db_xref="GOA:Q5AZB2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZB2"
FT                   /protein_id="CBF69611.1"
FT                   /translation="MASTDSLPAAVESLSLQTTSETSKFPNSYPSLNPVDVYREHISEH
FT                   LSAITGIEAEKIYPRLQFTSTLDKGDLLLPVPSLQIKGKSPADLSKELAEKFPESDLIH
FT                   PPIAGGPGGTHLQFFFKEKPLAQRVIGQIFKEKAAYGSNGNQGLRDPKDPSKGRKKIIV
FT                   EFSSPNIAKPFHAGHLRSTIIGGFLANLYTVMGWDVIKMNYLGDWGKQYGLLANGYKKF
FT                   GDEQKLLQDPINHLFEVYVKINNIVSEQEGPIKELKEQIKAKKEKNEDVSKLEQELAKL
FT                   VDVSEDENARRYFKSMEDGDPDALSLWRRFRDLSIKKYRETYARLNIDYDVYSGESQIK
FT                   QESMSKANEILQSTGVSENSDGATIVDFPKHGAKKLGKAVIVRKDGTPLYLTRDIGAIF
FT                   ERDEAYHFDKMIYVVAAQQDLHLAQLFKIVELMGFKDLASRCQHINFGMVRGMSTRKGT
FT                   VKFLDDILRDVADKMHETMKKNEEKYAQIENPVETADILGITSVMVQDMSGRRINGYDF
FT                   NLDAMTSFEGDTGPYLQYAHSRLCSILRKAEANVEELPSANLDLLTESHAVNLVRLLSS
FT                   WHDILMMTNKTLEPTTILTYLFRLTHMISSSYDVLQVIGSEPELKKARLALYEAARQVL
FT                   HNGMRILGLSPVSRM"
FT   gene            400722..401815
FT                   /locus_tag="ANIA_06367"
FT                   /old_locus_tag="AN6367.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(400722..400985,401051..401815)
FT                   /locus_tag="ANIA_06367"
FT                   /old_locus_tag="AN6367.4"
FT                   /note="transcript_id=CADANIAT00006617"
FT   CDS_pept        join(400722..400985,401051..401815)
FT                   /locus_tag="ANIA_06367"
FT                   /old_locus_tag="AN6367.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006617"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006617"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006617"
FT                   /db_xref="GOA:Q5AZB3"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR023610"
FT                   /db_xref="InterPro:IPR027483"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZB3"
FT                   /protein_id="CBF69613.1"
FT                   /translation="MANRQKAIARAIQRAVLRSGAPRISLIQRILSFFRIFYLTLIRYE
FT                   QELFYNLRARVWRLSEEEYLSCFKNDGKSPALIPMGDLGFSGSTFFRTSNSAFLVKSVP
FT                   RHFEHSFFRNDLLKPYYDYMQTYPESLLVWITDYIYAPYSSIGSILRTSPAHHVIMENL
FT                   LYGKEDDGNADKWETYDLKPIDYFYPERDLVPEQLVSEDIISRLADKFEDKVRLSREDY
FT                   DAVKRTLDKDTAFLASANIVDYSLFLVRFPASSNPGRIGRKTQWRVGVSSADGKWKYRS
FT                   VILDFFWAKHTLHAQAMTGAVQAFNIIGRQGPMSITTTAEEYREKFLTMVDEMMEVYAP
FT                   QD"
FT   gene            complement(401601..403272)
FT                   /locus_tag="ANIA_06366"
FT                   /old_locus_tag="AN6366.4"
FT                   /product="NADH-cytochrome b5 reductase 1 (EC
FT                   1.6.2.2)(Microsomal cytochrome b reductase)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZB4]"
FT   mRNA            complement(join(401601..402242,402294..402919,
FT                   402981..403132,403190..403272))
FT                   /locus_tag="ANIA_06366"
FT                   /old_locus_tag="AN6366.4"
FT                   /note="transcript_id=CADANIAT00006618"
FT   CDS_pept        complement(join(402093..402242,402294..402919,
FT                   402981..403132,403190..403194))
FT                   /locus_tag="ANIA_06366"
FT                   /old_locus_tag="AN6366.4"
FT                   /product="NADH-cytochrome b5 reductase 1 (EC
FT                   1.6.2.2)(Microsomal cytochrome b reductase)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZB4]"
FT                   /note="transcript_id=CADANIAT00006618"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006618"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006618"
FT                   /db_xref="GOA:Q5AZB4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZB4"
FT                   /protein_id="CBF69615.1"
FT                   /translation="MSALSLENITGVYAPSALLVVGTFILKKEWVPFAVALAAGFVAWK
FT                   LSVGGSSKPRKVLNPNEFQNFVLKEKNDISHNVTIYRFALPRPTDILGLPIGQHISLAA
FT                   TIEGQPKEVVRSYTPISSDNEAGYFDLLVKAYPQGNISKYLTTLKVGDTMKVRGPKGAM
FT                   VYTPNMCRHIGMIAGGTGITPMLQIIKAIIRNRPRNGGNDTTQVDLIFANVNPDDILLK
FT                   DELEKLAAEDDGFRIYYVLNNPPEGWTGGVGFVTPDMIKERLPAPASDIKILLCGPPPM
FT                   VSAMKKATESLGYTKARPVSKLEDQVFCF"
FT   gene            403724..404638
FT                   /locus_tag="ANIA_06365"
FT                   /old_locus_tag="AN6365.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(403724..403877,403986..404638)
FT                   /locus_tag="ANIA_06365"
FT                   /old_locus_tag="AN6365.4"
FT                   /note="transcript_id=CADANIAT00006619"
FT   CDS_pept        join(403757..403877,403986..404491)
FT                   /locus_tag="ANIA_06365"
FT                   /old_locus_tag="AN6365.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006619"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006619"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006619"
FT                   /db_xref="GOA:C8V0X4"
FT                   /db_xref="InterPro:IPR022036"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0X4"
FT                   /protein_id="CBF69617.1"
FT                   /translation="MTVPVEEEPAFNLTDVDRAVLAQTDEEFAYHGWEELKDIIARGDL
FT                   GILKRKPSDLVRYLAWSKETKAKYGTIINYICQRRLGWQLPTEGPSFNNPIPFADPADY
FT                   KILRNDWPYGLAKGIAHLVVWSRTPIPVQDADGVITAESHALIENFVQRMFVDRLAKED
FT                   GVKDPQDRVLWFKNYTALQSVRGLEHVHILLRDVPDRLIYEWTGE"
FT   gene            complement(404002..408631)
FT                   /locus_tag="ANIA_06364"
FT                   /old_locus_tag="AN6364.4"
FT                   /product="Chromosome segregation protein sudA (DA-box
FT                   protein sudA) [Source:UniProtKB/Swiss-Prot;Acc:Q00737]"
FT   mRNA            complement(join(404002..404956,405007..408163,
FT                   408209..408368,408432..408631))
FT                   /locus_tag="ANIA_06364"
FT                   /old_locus_tag="AN6364.4"
FT                   /note="transcript_id=CADANIAT00006620"
FT   CDS_pept        complement(join(404664..404956,405007..408163,
FT                   408209..408368,408432..408469))
FT                   /locus_tag="ANIA_06364"
FT                   /old_locus_tag="AN6364.4"
FT                   /product="Chromosome segregation protein sudA (DA-box
FT                   protein sudA) [Source:UniProtKB/Swiss-Prot;Acc:Q00737]"
FT                   /note="transcript_id=CADANIAT00006620"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006620"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006620"
FT                   /db_xref="GOA:Q00737"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="InterPro:IPR041741"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00737"
FT                   /protein_id="CBF69619.1"
FT                   /translation="MYVKQIIIQGFKSYKDQTVIEPFSPKHNVIVGRNGSGKSNFFAAI
FT                   RFVLSDAYTHLGREERQALLHEGSGSAVMSAYVEIIFDNSDERFPTGKPELVLRRTIGL
FT                   KKDEYTLDRKNATKNDVMNLLESAGFSRSNPYYIVPQGRVTALTNMKDSERLNLLKEVA
FT                   GTQVYEARRAESLKIMHETNSKREKIDELLDFINERLAELEEEKDELRNFQEKDKERRC
FT                   LEYTIYSREQQEIASFLDSLEEQRQTGVEDTDINRDRFIQGEKEMAQVDAEIAECKQQI
FT                   EFLKVDKAQLEDERREASKALAQVELQAKSLSDNQAAAQESKARHDESLKAVQSAIEER
FT                   QTELKELVPRFISAKDAEDAARAKLTEAETARQRLYAKQGRNSRFKNKSERDKWLQAEI
FT                   KNNNASISSVQSVLSQTQEDINDIENDIALLEPETERLRQQIDGRGDTIQSVEQQVQAA
FT                   KDERDRLMDQRKYVDWPRTSCATLTIHRELWREEAKLDSILINASNEVDRAERNLSQMM
FT                   DHNTSRGIAAVRRIKRQHNLEGVYGTLAELFEVNDRYRTAVEVTAGQSLFHYVVDTDDT
FT                   ATKVLEILQHEKAGRVTFMPLNRLRTKPLNMPKASDTIPMIEKLQYDRAYEKAFQHVFG
FT                   KTIICPNLQVASQYARSHGVNATTPEGDRSDKRGALTGGFHDSRQSRLDAVKNLAKWRD
FT                   EYETKKSRGSEIRKELEELDQLITRAVGELQKLEQQRHQVQNSSGPLRQELRSKRDLLQ
FT                   KQNDNLDAKRRALRNIEGNLAALKDQVDAFEAELSSPFHKALTDEEEARLESLNSNVQE
FT                   YRREYQELSGKRSELETRKSVLEVELRENLNPRLDQLLAQDADIADEDGQGNIKETQRE
FT                   QKRLTKVLDKLAQRLAQVDESMEQANSRVTELTQRNAESRRELEELAKSIEKHQRRMEK
FT                   SMQKKAALTKQAAECAANIRDLGVLPDEAFTKYKNTDSNTVVKKLHKVNEALKKYAHVN
FT                   KKAFEQYNNFTKQRETLTSRREELDASQKSIDDLISVLDHRKDEAIERTFKQVSREFAT
FT                   IFEKLVPAGRGRLIIQRKTDRTQRAEDDLESEDEEAKHSVENYVGVGISVSFNSKHDDQ
FT                   QRIQQLSGGQKSLCALALVFAIQACDPAPFYLFDEIDANLDAQYRTAVAQMLKTISDST
FT                   NGQFICTTFRPEMLHVAEKCYGVSFRQKASTIDVVSREEALKFVEEQKS"
FT   gene            408673..410802
FT                   /locus_tag="ANIA_06363"
FT                   /old_locus_tag="AN6363.4"
FT                   /product="Extragenic suppressor of the bimD6
FT                   mutationPutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:O13330]"
FT   mRNA            408673..410802
FT                   /locus_tag="ANIA_06363"
FT                   /old_locus_tag="AN6363.4"
FT                   /note="transcript_id=CADANIAT00006621"
FT   CDS_pept        408853..410529
FT                   /locus_tag="ANIA_06363"
FT                   /old_locus_tag="AN6363.4"
FT                   /product="Extragenic suppressor of the bimD6
FT                   mutationPutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:O13330]"
FT                   /note="transcript_id=CADANIAT00006621"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006621"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006621"
FT                   /db_xref="GOA:G5EAT2"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017407"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:G5EAT2"
FT                   /protein_id="CBF69621.1"
FT                   /translation="MSSDSTTQAASPAEGLNPSHTYVPNKGYANEDGAVPAMAGQDLTP
FT                   EDEDYEGDEYYDDIFEEELDEGDFNSSNPADLTKAYNRQRRVNELAADPNAPKWTYPKT
FT                   NTQKPTVNTYASVDDEIKSLTRHAAKIKLDNVQSGLAVRGGSGTDRADRATSEQVLDPR
FT                   TRMILLQMINRNIVSEIHGCLSTGKEANVYHAMLQPEDDFDAAPIHRAIKVYKTSILVF
FT                   KDRDKYVTGEFRFRSGYNKSNNRAMVKLWAEKEMRNLRRIYAAGIPCPEPINLRLHVLV
FT                   MGFVGNSKGIAAPRLKDVDFNISDPESKWRELYIDMLGYMRVMYQTCHLVHADLSEYNT
FT                   LYHNDKLYVIDVSQSVEHDHPRSLEFLRMDIKNVSDFFRRKGVPTISERVIFEFIISAE
FT                   GPATVTDELRDAVEKLFSLEPEAADEVDTAVFRQQYIPQTLDQVYDYERDAEKVNAGEG
FT                   DDLVYRDLLAREKPSAPPDDEAETGSEVSGGVSIAESGSEDEEERDPFEKKPPRGKRFE
FT                   DKESKKEHKNKVKEEKREKRANKMPKHLKKRLVSSSSRKRK"
FT   gene            complement(410843..411469)
FT                   /locus_tag="ANIA_06362"
FT                   /old_locus_tag="AN6362.4"
FT                   /product="arsenate reductase (Arc2), putative
FT                   (AFU_orthologue; AFUA_6G13400)"
FT   mRNA            complement(join(410843..411027,411117..411469))
FT                   /locus_tag="ANIA_06362"
FT                   /old_locus_tag="AN6362.4"
FT                   /note="transcript_id=CADANIAT00006622"
FT   CDS_pept        complement(join(410843..411027,411117..411393))
FT                   /locus_tag="ANIA_06362"
FT                   /old_locus_tag="AN6362.4"
FT                   /product="arsenate reductase (Arc2), putative
FT                   (AFU_orthologue; AFUA_6G13400)"
FT                   /note="transcript_id=CADANIAT00006622"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006622"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006622"
FT                   /db_xref="GOA:Q5AZB8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZB8"
FT                   /protein_id="CBF69623.1"
FT                   /translation="MSEEQPWHAAFPSPQTTDPASLPRPMLLQWLQPGSNRTPGADFLL
FT                   VDLRRTDFEGGTIKGSLNLPAQSLYPTLPTLFNLVRSAGVKDVIFYCGSSQGRGTRAAG
FT                   WFADYLRQQGVEESETKSWKLEGGIKGWVRDGEKYTALMEGYDGAVWEK"
FT   gene            411555..412684
FT                   /locus_tag="ANIA_06361"
FT                   /old_locus_tag="AN6361.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(411555..411572,411605..411635,411939..412033,
FT                   412079..412684)
FT                   /locus_tag="ANIA_06361"
FT                   /old_locus_tag="AN6361.4"
FT                   /note="transcript_id=CADANIAT00006623"
FT   CDS_pept        join(411555..411572,411605..411635,411939..412033,
FT                   412079..412684)
FT                   /locus_tag="ANIA_06361"
FT                   /old_locus_tag="AN6361.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006623"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006623"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006623"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZB9"
FT                   /protein_id="CBF69625.1"
FT                   /translation="MTGLRNYNVVINHTTYVINLLSMEEKYNHALSKALATVDPERATL
FT                   TDRTSNFDLIVSPANSYGRLDGGFDDAISRAFCRPPEHSYDTLTKAAQATLYAKWRGFA
FT                   PPGTCTIVPFPQELLKADGSGDNKWGCKWVAICPTMRTPDDVRWDREVVYECVWSLLCA
FT                   VEGWNRDLDENQTGEQRIRSILVTPMATGCGKVSPERWAAQFVLAIKHFVDAVENPERW
FT                   RNLGWKEIYDDMLEVQRTWKVDGNSKS"
FT   gene            complement(412745..414734)
FT                   /locus_tag="ANIA_06360"
FT                   /old_locus_tag="AN6360.4"
FT                   /product="Autophagy-related protein 17
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZC0]"
FT   mRNA            complement(412745..414734)
FT                   /locus_tag="ANIA_06360"
FT                   /old_locus_tag="AN6360.4"
FT                   /note="transcript_id=CADANIAT00006624"
FT   CDS_pept        complement(413061..414734)
FT                   /locus_tag="ANIA_06360"
FT                   /old_locus_tag="AN6360.4"
FT                   /product="Autophagy-related protein 17
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZC0]"
FT                   /note="transcript_id=CADANIAT00006624"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006624"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006624"
FT                   /db_xref="GOA:Q5AZC0"
FT                   /db_xref="InterPro:IPR007240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZC0"
FT                   /protein_id="CBF69627.1"
FT                   /translation="MSAVDSSTSSGHPEREAQHETGLPPLETLISHLVAAKRSLSAINH
FT                   VWRANEIVTSARSALEESVVVSARTGFLRSGLNNQLRLLYNVRAEVEEISLRGRSEFAN
FT                   ALKSLDAADARLKKTLGLLRETIVHASFRPEGEEPKSLHDFVDERGVEELHSTLKSSID
FT                   RTNAAQADLDASNNAFDVELQSIKQALSTYRATTKLASSRGSVSSSGSQSGSSSSLPSI
FT                   SSMPSMVHSLEMHAQEMANLLESLVRHFDLCVTAVKHTEGGGAAAQSITGDMPAGVMGS
FT                   HPGPGHGAGTGPTIEGDFNANPNAPLDPLSASEYREMVSVIVNDAAEAEDVVMEIQDRI
FT                   GEMESVLETLTAQRDSFAAIYNATKEVFSYLSSLASTRLPGYIAQAHAFTAVWNDEHDR
FT                   IKGGLADLSDLNALYDGFLDAYDGLIIEVARRRHVRHRVEKILRDARNKLDALYEEDVN
FT                   ARETFRVEQGDYLPSDIWPGLSREPMRVEFHRISGGPLKGVLQSPDQAQSPQPNEGEQL
FT                   GHQDPQNPGDADSRFGEVIPDLPQELVEQALARLKSKRQR"
FT   gene            415729..418272
FT                   /locus_tag="ANIA_06359"
FT                   /old_locus_tag="AN6359.4"
FT                   /product="Sulfur metabolite repression control protein
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q00659]"
FT   mRNA            join(415729..416367,416415..418272)
FT                   /locus_tag="ANIA_06359"
FT                   /old_locus_tag="AN6359.4"
FT                   /note="transcript_id=CADANIAT00006625"
FT   CDS_pept        join(416005..416367,416415..418088)
FT                   /locus_tag="ANIA_06359"
FT                   /old_locus_tag="AN6359.4"
FT                   /product="Sulfur metabolite repression control protein
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q00659]"
FT                   /note="transcript_id=CADANIAT00006625"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006625"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006625"
FT                   /db_xref="GOA:Q00659"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00659"
FT                   /protein_id="CBF69629.1"
FT                   /translation="MSTEDNHDSQILTARHRSDASEQSFKSLFGGPSSEDGKETEPDTH
FT                   DHNHSFSNAKAPAKFANQNVAPFLARHIPEQYAPLGAQSILPADLSSANSKYCYRHRPD
FT                   QKCRRQADEPSMDKLQRELESLPQGDQQSISHVWSLFSAAPAKHRKLILQGIMAQCCFP
FT                   QLSYISATVRDLIRIDFITALPPEIAFKILCYLDTTSLCKASQVSRGWRALADDDVVWH
FT                   RMCEQHIHRKCKKCGWGLPLLDRKRLRESKREIELRATTWDKGVVGPRSPDASAESPPS
FT                   GKRKLEDDEVAVVKRHCSSLGSDAGVDKDSDFFKTRYRPWKEVYKDRFKVGTNWKYGRC
FT                   SIKTFKGHTNGVMCLQFEDNILATGSYDTTIKIWDTETGEELRTLRGHESGIRCLQFDD
FT                   TKLISGSMDRTIKVWNWRTGECISTYTGHRGGVIGLHFDASILASGSVDKTVKIWNFED
FT                   KSTFSLRGHTDWVNAVRVDTSSRTVFSASDDCTVRLWDLDTKTCIRTFHGHVGQVQQVV
FT                   PLPREFEFEEHDAECENDDLSTTSGDADPPSIQASMGLEPNAAYSQSSAFGTSFDNGRA
FT                   APPRYMVTSALDSTIRLWETTTGRCLRTFFGHLEGVWALGADTLRIVSGAEDRMIKIWD
FT                   PRTGKCERTFTGHSGPVTCIGLGDSRFATGSEDCEVRMYSFQS"
FT   gene            419412..420128
FT                   /locus_tag="ANIA_06358"
FT                   /old_locus_tag="AN6358.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            419412..420128
FT                   /locus_tag="ANIA_06358"
FT                   /old_locus_tag="AN6358.4"
FT                   /note="transcript_id=CADANIAT00006626"
FT   CDS_pept        419412..420128
FT                   /locus_tag="ANIA_06358"
FT                   /old_locus_tag="AN6358.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006626"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006626"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006626"
FT                   /db_xref="GOA:Q5AZC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZC2"
FT                   /protein_id="CBF69631.1"
FT                   /translation="MSIPAIIDPFPEPQAAFQVRYAEPKTLECPRPRQQLDTSKLTEIH
FT                   GRHVRFAPDTTEYMDRKPLRSSPFPTKANITRLDLTLTTANSDADLLPLQPARTPMRVR
FT                   FAAEISIIPRPADSFDHVLSAVDFNTTHLDSTGKTCPVMQHVRFADEFTNHSHAHDVFP
FT                   LIYVRDGERASVSSSRSSSSPSSLGARRADELERSSSLDNFVFVAENCRRRKRRFRRVC
FT                   GKVKELFKERKGKVVL"
FT   gene            complement(420554..421273)
FT                   /locus_tag="ANIA_06357"
FT                   /old_locus_tag="AN6357.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(420554..420738,420797..420838,
FT                   421045..421099,421232..421273))
FT                   /locus_tag="ANIA_06357"
FT                   /old_locus_tag="AN6357.4"
FT                   /note="transcript_id=CADANIAT00006627"
FT   CDS_pept        complement(join(420554..420738,420797..420838,
FT                   421045..421099,421232..421273))
FT                   /locus_tag="ANIA_06357"
FT                   /old_locus_tag="AN6357.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006627"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006627"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006627"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZC3"
FT                   /protein_id="CBF69633.1"
FT                   /translation="MIFTANRITTLTIPVAWVSERDILPVESVYRKVCLYHGRNPPMKS
FT                   AGRIVTIKNKGSSGKKPEGMASSIEKKIYIPPGLNRSTSMGCFGIAYQDQSQYLSTVAL
FT                   SQQ"
FT   gene            422333..422983
FT                   /locus_tag="ANIA_06356"
FT                   /old_locus_tag="AN6356.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            422333..422983
FT                   /locus_tag="ANIA_06356"
FT                   /old_locus_tag="AN6356.4"
FT                   /note="transcript_id=CADANIAT00006628"
FT   CDS_pept        422333..422983
FT                   /locus_tag="ANIA_06356"
FT                   /old_locus_tag="AN6356.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006628"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006628"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006628"
FT                   /db_xref="GOA:Q5AZC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZC4"
FT                   /protein_id="CBF69635.1"
FT                   /translation="MRSIGEGSGPRHSPAQYRPPQRPTRLDPEPAASPEYRLLESEHQS
FT                   HWVRNERLDARRLDRPLRYRSSNLTGTGDHLGASVPYISDSRRHLSSEPGLDRPEDETQ
FT                   TGVSEAWMSRLAIDVEELARAIECPRESEHEQGGNIAAIVILRTPNFQTRTQTQDQNQD
FT                   QEQNQGHGGWTARPPLAATWYQPSTGQSFTASPETSVESESGWDFWDELHQLG"
FT   gene            complement(424730..425893)
FT                   /locus_tag="ANIA_06355"
FT                   /old_locus_tag="AN6355.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(424730..424836,425686..425893))
FT                   /locus_tag="ANIA_06355"
FT                   /old_locus_tag="AN6355.4"
FT                   /note="transcript_id=CADANIAT00006629"
FT   CDS_pept        complement(join(424730..424836,425686..425893))
FT                   /locus_tag="ANIA_06355"
FT                   /old_locus_tag="AN6355.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006629"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006629"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006629"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZC5"
FT                   /protein_id="CBF69637.1"
FT                   /translation="MTGIATVTNTIAPTFSQPEREANLKVELLFPDLCPAMVLKRDGTG
FT                   WVSVGYAFKRAPSWEVADGAGSRSLLSWTVSSAAPYPNYDEQTWTADVSSSHLETEQQG
FT                   "
FT   gene            430085..434865
FT                   /locus_tag="ANIA_06354"
FT                   /old_locus_tag="AN6354.4"
FT                   /product="ubiquitin C-terminal hydrolase, putative
FT                   (AFU_orthologue; AFUA_2G14130)"
FT   mRNA            join(430085..431552,431600..433621,433666..434865)
FT                   /locus_tag="ANIA_06354"
FT                   /old_locus_tag="AN6354.4"
FT                   /note="transcript_id=CADANIAT00006630"
FT   CDS_pept        join(430085..431552,431600..433621,433666..434432)
FT                   /locus_tag="ANIA_06354"
FT                   /old_locus_tag="AN6354.4"
FT                   /product="ubiquitin C-terminal hydrolase, putative
FT                   (AFU_orthologue; AFUA_2G14130)"
FT                   /note="transcript_id=CADANIAT00006630"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006630"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006630"
FT                   /db_xref="GOA:Q5AZC6"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR006615"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR035927"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZC6"
FT                   /protein_id="CBF69639.1"
FT                   /translation="MSGSENKHDSVPPTGREASPSTKRAAPEAEQDVEMGIEKDTQSRP
FT                   GNPDQMDTTASEASTGNDGTSPSDNAYQTPSSMSTYTAPVTGTQNNTKTEASMSSNERP
FT                   SYDDQVAKVTCFMMQPLQEGQKGYVVSMSWLKRVLARSSTHADNIDKSAAEGEIGPVDN
FT                   SDLVLVTDPVNVGLKDEREQPFIPLRPGLQFGEDFEVVPQEGWDLIMQWYGLAEQSPAI
FT                   VRYAHNTSPFGAAENIQYELNPPVYTILKLSNPQKGVTPDTLRDKAKLPVKSLASRHDN
FT                   FQTWLRKAKRSVNVDPLVKVRVWRILGGLGSAAASTNITPAASRSASPAPFSPLVSNAG
FT                   SSYVLDLNTFLSLSEGSQRELLDVKDQSNNPKYNGKMTLDAAGLGEPSVIVLEEGVFGA
FT                   NSDAEWVSDLSQQAMNRLGVPSGSLKPNKLKSKSPATSGRSSPVPEPIRKTRKDGKPRG
FT                   NTGLSNLGNTCYMNSALQCVRSVEELTYYFLNDVYKKDLNPSNPLAHNGDVAKAYANLL
FT                   RNIYDEAGHGSFAPRQLKNTIGRYGPAFSGYGQQDSQEFLLFLLDGLQEDLNRIQKKPY
FT                   IEKPDSTDEMVHNKEALKEFADKCWDIYKARNDSVITDLFAGMYKSTLVCPVCDKVSII
FT                   FDPFNNLTLQLPIENLWSKSIFYFPLHKKPIIIDVEIDKNSSIKALKEFIAKKAGSDPE
FT                   RLVMSEIYKSKFYKMFDNVSSIADCQIGDSDEIGMFELESVPTNYNPDKQTTKSYFSYG
FT                   RSSHEEVPSFDSPKADRMLIPIFNRHEGQRGYRMQRQFFGVPSYVVINREEATDYDAIL
FT                   RKVLSEVATMTTRDFLNEQIETQQQETTEDSDTVIMNEDDAESADDKIKTTSVDGEEGM
FT                   VDVSMRDASDQAEAADDLTLAHSSIPAPFHRLFDMKIARTNEAVPLGFSSVDENKDYNL
FT                   MKSRIQKPTAIEEANKDGDGEQDEDSDDEIDMITERTVTPKPRPQRPLINPGEAIVLDW
FT                   NTDAHEALFSGDVRDPNGPRGAPTWTSIERMPDPELANRRALRTRRKKKGVTLNECLDE
FT                   FNKEEILSENDAWYCPRCKEHRRARKKFELWKTPDILVMHLKRFSASRGFRDKLDVMVD
FT                   FPVEGLDLTGRVEAPEEGKSLVYDLFAVDNHYGGLGGGHYTAYAKNFMTGQWNEYNDSS
FT                   VSRPIDPQNAVTSSAYLLFYRRRSDRPLGGKILEEITESSTRPASESDSQESRGPSPSG
FT                   EGRRLGGSSRNGSSSALAGVGAAHQLGDGGLRTGAKSSEDANPPEYSNSPSYGERSLGG
FT                   TGMDTMTYEDDDYGSGLGNNDTFRLSNPSPSWSFSRVTDAHHGLSQMTELPGSLSDDDN
FT                   DDDDDSNKAVGGGDMSDTDLRLASLADSPFQGPVYPGTPLDETAPTLTTEFPQHDADDD
FT                   DLPVVELHVGEEERLD"
FT   gene            435373..436638
FT                   /locus_tag="ANIA_06353"
FT                   /old_locus_tag="AN6353.4"
FT                   /product="acetyltransferase, GNAT family family
FT                   (AFU_orthologue; AFUA_3G07750)"
FT   mRNA            435373..436638
FT                   /locus_tag="ANIA_06353"
FT                   /old_locus_tag="AN6353.4"
FT                   /note="transcript_id=CADANIAT00006631"
FT   CDS_pept        435373..436638
FT                   /locus_tag="ANIA_06353"
FT                   /old_locus_tag="AN6353.4"
FT                   /product="acetyltransferase, GNAT family family
FT                   (AFU_orthologue; AFUA_3G07750)"
FT                   /note="transcript_id=CADANIAT00006631"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006631"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006631"
FT                   /db_xref="GOA:Q5AZC7"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZC7"
FT                   /protein_id="CBF69640.1"
FT                   /translation="MPTYIHEPPYTLLLTYLSSHLPRSGPLFRRIQHHINSPSPSSTAR
FT                   VLASFSEEENLIPDSGAKQPWIIAYTDIHRGPDTQVWVFSSLESKPKHAITEPERRIAK
FT                   SQLLSFFTFIRTHLVPPYLDWVSSTQPVHKTEVEETGVKKIPPHPLPSVLLGSVHELVI
FT                   GLIVELAGEEKRLRIHRGQNVFYAKYCFPSSSFEHEDVYTKQLEELGYTFTDSIGRYGI
FT                   TERHIPLVKSRTNIPRSTEALLAMGGVALFHSSPSPSRPHEGPVKQSVQDAEEMPIAWA
FT                   FLGFDGSLSSLHVEPEHRGRGLAVAVGREVMKRGVNVFGPSYTFLDLHSRPHSNSNGNS
FT                   SADLDSKGDRAASEVRLTSALDGSTGAAPELPVRLSQKIEEEWFFADVAVGNTASRRVM
FT                   EKMGGKALWDVAWIVVEVEVDN"
FT   gene            complement(436764..438029)
FT                   /locus_tag="ANIA_06352"
FT                   /old_locus_tag="AN6352.4"
FT                   /product="Endo-alpha-1,5-L-arabinanasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5AZC8]"
FT   mRNA            complement(join(436764..437034,437098..438029))
FT                   /locus_tag="ANIA_06352"
FT                   /old_locus_tag="AN6352.4"
FT                   /note="transcript_id=CADANIAT00006632"
FT   CDS_pept        complement(join(436764..437034,437098..438029))
FT                   /locus_tag="ANIA_06352"
FT                   /old_locus_tag="AN6352.4"
FT                   /product="Endo-alpha-1,5-L-arabinanasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5AZC8]"
FT                   /note="transcript_id=CADANIAT00006632"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006632"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006632"
FT                   /db_xref="GOA:Q5AZC8"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016840"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZC8"
FT                   /protein_id="CBF69642.1"
FT                   /translation="MAVIFVLFFLVSMALSARIRPSFNGTALSGTSNKHPFEPGPNTIF
FT                   REEVPPSAAASGFPSAHGTELRTHDPSIIKVGSIYYSYSVGPSITIHQAFSLDGPWTEV
FT                   GALLSGESVIKKGDRKAPWAANTIYINGRYYCYYSVSNSGCRDSAIGVASSAFPGPGEW
FT                   TDHGLIIQSGTGEGSDVFPLNQSNTIDPNVFVDGDGTAYLNFGSFWTGLWQVPLEEELV
FT                   TVKGLQDGTLDAVHLAAEPGKVWRSKLANSKAKTVSTSKTGSPICGDPTGGHPIEGGFM
FT                   AYHAPYYYMWFSWGRCCEFKDPAMRSNGKEYRIRVGRSTSARGPFVDKQGIDLVDGGGE
FT                   TVYGSNGDVFAPGGQGILTDEFGDILYYHYLNSSVSYDFADARLGYNRLEYVDGWPVAV
FT                   Y"
FT   gene            complement(438981..441369)
FT                   /locus_tag="ANIA_06351"
FT                   /old_locus_tag="AN6351.4"
FT                   /product="Sorting nexin-41
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZC9]"
FT   mRNA            complement(join(438981..439229,439282..439395,
FT                   439450..440460,440510..440776,440822..441090,
FT                   441138..441369))
FT                   /locus_tag="ANIA_06351"
FT                   /old_locus_tag="AN6351.4"
FT                   /note="transcript_id=CADANIAT00006633"
FT   CDS_pept        complement(join(439134..439229,439282..439395,
FT                   439450..440460,440510..440776,440822..441090,
FT                   441138..441228))
FT                   /locus_tag="ANIA_06351"
FT                   /old_locus_tag="AN6351.4"
FT                   /product="Sorting nexin-41
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZC9]"
FT                   /note="transcript_id=CADANIAT00006633"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006633"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006633"
FT                   /db_xref="GOA:Q5AZC9"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZC9"
FT                   /protein_id="CBF69644.1"
FT                   /translation="MWNDEDNNPYGAFDSEARLSESLHSTTIESPFNHDYPPPPSSHSS
FT                   NPDISDFSQHPEASDDDEGDYVGQANRAGYSHKSVYDSRIEQLLYENPDMPILITDAGK
FT                   NHEGGGSFIVYTIRTGDLEVRRRYSEFASLRQTLVSLHPTLIVPPIPEKHSMADYAAKP
FT                   TKAKEDAGIIDLRKRMLAVFLNRCRRMKEIREDGVWWRFLDPNVSWSEVLHSHPASSVP
FT                   KNNLKAPPLDPANPTPAHAWLPVPSASAKLKSTSGTSSSPNAEAPGPEILGRFPPESRK
FT                   LSEKDLDPYFINFEASTRELELLLQGNMEKVNRRTLAHLSGLSADLMELGARYNGFSLS
FT                   EQSPTVATAIERVGQAADTSYIETEELSLALGANFAEPMRESAQFASVVRSVLRYRVLK
FT                   RVQEDMTRDELSKKKSLLESLERSEQEAKRIEQYLNRTSPQAPTKQRSLSTSSATSSQG
FT                   GTDESRPSGEETASIDSDFPPTHAEHVSQRYPESGQTSPPAHRKTSSGTFVANKIFGRI
FT                   SHAVHGFVDVDPERTRRDHIGKTKESLVQLEQALGVSEKDVKDASAGVLQDLKRFQKDK
FT                   EADLRRYMVAYARCHLNWARKNLETWTEAKDEVDKIEAR"
FT   gene            complement(441587..442486)
FT                   /locus_tag="ANIA_06350"
FT                   /old_locus_tag="AN6350.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(441587..442486)
FT                   /locus_tag="ANIA_06350"
FT                   /old_locus_tag="AN6350.4"
FT                   /note="transcript_id=CADANIAT00006634"
FT   CDS_pept        complement(441587..442486)
FT                   /locus_tag="ANIA_06350"
FT                   /old_locus_tag="AN6350.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006634"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006634"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006634"
FT                   /db_xref="GOA:Q5AZD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZD0"
FT                   /protein_id="CBF69646.1"
FT                   /translation="MNENTIIAIIIIAVLGSIAGGTFYIYYLHANVKKELTIARIESQR
FT                   EREQQLKAVAATMEQARRASQARSCAQARTQSRPPSRGRSRPRSRPREASLGRTQDQAT
FT                   GKKGKKWKKTQDHEQHQKQEEARSRRSSRKPNPSRAGSLRTTQGEWGASGAMPTSGGQF
FT                   GQSENQQGQDPWPASADSRGDGQWGDQTQNDTWGQAGNKTQGAPGNGQDGNTVLNGDTW
FT                   GDSNNNEQGSGGGRWSPHRNQNKNNGSRDNWNSGSNNNNNNNDDSSGGQQQNVRKWKSH
FT                   DDTANVQDSAQKDDEIHW"
FT   gene            complement(442730..448286)
FT                   /locus_tag="ANIA_06349"
FT                   /old_locus_tag="AN6349.4"
FT                   /product="HEAT repeat protein (AFU_orthologue;
FT                   AFUA_2G14180)"
FT   mRNA            complement(join(442730..443688,443739..444361,
FT                   444412..444552,444605..445119,445165..445475,
FT                   445526..445754,445803..446042,446093..447053,
FT                   447101..447305,447423..448062,448132..448286))
FT                   /locus_tag="ANIA_06349"
FT                   /old_locus_tag="AN6349.4"
FT                   /note="transcript_id=CADANIAT00006635"
FT   CDS_pept        complement(join(442861..443688,443739..444361,
FT                   444412..444552,444605..445119,445165..445475,
FT                   445526..445754,445803..446042,446093..447053,
FT                   447101..447305,447423..448062,448132..448286))
FT                   /locus_tag="ANIA_06349"
FT                   /old_locus_tag="AN6349.4"
FT                   /product="HEAT repeat protein (AFU_orthologue;
FT                   AFUA_2G14180)"
FT                   /note="transcript_id=CADANIAT00006635"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006635"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006635"
FT                   /db_xref="GOA:Q5AZD1"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZD1"
FT                   /protein_id="CBF69648.1"
FT                   /translation="MGTKPVFSAEASAGPTDMEQISQDIQILPEATLDKITKGALVKFT
FT                   LTCDNVEKTRNVFSSLLQTFCSASISHGHTTAACNALSSFLDTAFVSERPETRQLARSR
FT                   DTLVSVFEGFLSRFKDVKPKPMKLVLESLAMIMAKSHHEHGCTAIQRDFVEAVLPSILF
FT                   GEPRSRVKASIIALETLVHKKAILPAELIMLVESWLLRNSERWPTVLQDECRITSIDVP
FT                   RFLQKSSEQAASDAQSKEAAVQILLLGLLNRAKALDLAASCGENLEIVDKLSNHILLRL
FT                   FGISTIGFRYFLGTLPLESLLAGDMSNSSSNELTLLFASLQLGKKIGLVHEDHYFSKFE
FT                   KQGEKPLVLKSEVIGQFLFHHDFSIKMAALSLLITAPSTTKPLSSAAIRVIIKSLPSLH
FT                   AESDPCTRGEILSMVRGLIVRLKGGILANIENPVEPRTTLSKKQPIVYIRDDAETRSCL
FT                   QSYLDFLMADLRTTASYHRHIMAVKTLYLVIESGLDERYIGAGSNKPEQRQVRWKFHME
FT                   IFGPKLLRLLVDLLMDPYDEVRIAALNILKLFPRSVLLDTAGCSNGEPELLNAVTKAEI
FT                   LASNTSRADHADTVALLYHLIFVIADAKDPKDAKWWTTKQGVVQLILEKLEGKLSSSEG
FT                   LFNSSLRDAPLHGYLSALRYIISSPNFYTQVSREGSDSPENWRSIHTRIASLCDRIWEE
FT                   VKPQLCIDSPEGHAAEPIEDLKVGPKDILSYSWRALRESSLLVHATLSNATYGPQGESG
FT                   LTRADYDQIGKSSFTQLAELRHRGAFSTVAQTFAACCQRCGQSGNPEISALPLLWYQEA
FT                   KKIIFEKASKLTRRSAGLPALVGGILLSNPGGPLFQQVIRELQDVAYIPAQLEAHNQTV
FT                   ELPQVHAMNCLREAFTNARLGPHTEGFLMPALNLSAECMGSPIWALRNSGLMLFRALMN
FT                   RMCRTDYQGFGGKSGSEPGARISFQKYPGLVQLLSNLLVPPQKANGAEKADSAMVTERV
FT                   FPALELIAEKIPNAADTDDAKLLGLIREHLKSHVWGIREHAARVYASLLDRSTILHDIQ
FT                   SLLNARDAETENYLHGESLCVRYSLRRLAFTPSALWNERLEATKSVIKSVFAETYLLAR
FT                   SPFVQTTLLEMLSDAVERSVESGAEGETVDLLDYIFDTYNISDTVDFVFDSSNPSFTTL
FT                   STTRAFSLLRRELAWAMTLKALTKGDTENLETFIQKVATLDPNACQWLLERLHETFAAK
FT                   DEYTKLLAGLYASIIVGKPPLEVKIPAILNLASYLQVALETKDAALVPALAWEDLAAQV
FT                   KIGSTTKGFNRDRADADLQLEGCLIGLKSITRDHEILETEVREWATRLRFALAEETEFS
FT                   TRYAAATSISAFARAYRPPRQPPRVDQPFLEIYLILYDLLNDDDEELRDIAASTASYVL
FT                   SYSSVSPQKAVALSPMNASELFAAFVADNFSSSKLLFTRATRYILGLEPRVGDSSSRKP
FT                   FVPVSETTAEIRKESTVLFEEEKQNLFIESVREIDLWSVVLTRLDKATCEEKLLKELYS
FT                   WVSDGLDCLSDIFARPDGEDGLVGWMAKPEAYTLGVRVISLAGVLASKELESSGLLGTD
FT                   AQGALKEKLGRLLETGKSGLLHVDLLERVGMALSRT"
FT   gene            448679..449352
FT                   /locus_tag="ANIA_06348"
FT                   /old_locus_tag="AN6348.4"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM23, putative (AFU_orthologue; AFUA_2G14190)"
FT   mRNA            join(448679..449272,449329..449352)
FT                   /locus_tag="ANIA_06348"
FT                   /old_locus_tag="AN6348.4"
FT                   /note="transcript_id=CADANIAT00006636"
FT   CDS_pept        join(448679..449272,449329..449352)
FT                   /locus_tag="ANIA_06348"
FT                   /old_locus_tag="AN6348.4"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM23, putative (AFU_orthologue; AFUA_2G14190)"
FT                   /note="transcript_id=CADANIAT00006636"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006636"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006636"
FT                   /db_xref="GOA:Q5AZD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZD2"
FT                   /protein_id="CBF69649.1"
FT                   /translation="MSIWDSLSGRKQTKGADGLDASAAPDASSFLSEVALPDPSQLHPL
FT                   AGLNQDTLDYITLEDSALDQLPGSQSVLPSRGWSDDLCYGTGTTYVTALAIGGAWGLAE
FT                   GLKRTPVTAPPKIRLNGVLNSITRRGPFLGNSAGVVAMVYNGLNSFAGYARGKHDAANS
FT                   IAAGAVSGMVFKSTRGLKPMLISGGIVATIAGTWSVAKKALL"
FT   gene            450760..452835
FT                   /locus_tag="ANIA_06347"
FT                   /old_locus_tag="AN6347.4"
FT                   /product="protein kinase, putative (AFU_orthologue;
FT                   AFUA_2G14200)"
FT   mRNA            join(450760..452236,452288..452835)
FT                   /locus_tag="ANIA_06347"
FT                   /old_locus_tag="AN6347.4"
FT                   /note="transcript_id=CADANIAT00006637"
FT   CDS_pept        join(450760..452236,452288..452835)
FT                   /locus_tag="ANIA_06347"
FT                   /old_locus_tag="AN6347.4"
FT                   /product="protein kinase, putative (AFU_orthologue;
FT                   AFUA_2G14200)"
FT                   /note="transcript_id=CADANIAT00006637"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006637"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006637"
FT                   /db_xref="GOA:Q5AZD3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZD3"
FT                   /protein_id="CBF69652.1"
FT                   /translation="MVYPESPAPTERSGSVVVRPELHGSSATAVSSDNELHSISPVNPD
FT                   PDGLGAGSLCTENLSPVSVKNATHKEHHASGLPALQIRTDVSSVSSSVHRLSPHREADF
FT                   YVHHSTSASSLPHRTPSLRALMAPSHSGGSLSPASLLSSPQLIAMGDITPLPSPIGGAS
FT                   PWRLPARRNSQSLSRTSSVVSRTGSSLSLRPSDPSQSSLAGVPEARSRGKTPVIADKPS
FT                   SDKTLDTPAAPKHTRNRSLSEYVPPGRNVAIKPRPVAVSGTGAPLGITSSSSTDSKSNN
FT                   LHREQYLAIHRGIALPTVRPPSPPRSSGFGVSENEPVVIHHSDAHGTEEYYSVRSIRTQ
FT                   QPRLYRKLRQLGHGTFSQVSLAVRVEPEGADSDHGHSDAVSSTQKLVAIKIIEHGPAGG
FT                   ADEERLEVSLKREVEILKSLNHPSLVQLKAFGSDEKRALLVLDYCPGGDLFEVVSNNTR
FT                   PLTPGLIRRIFAELVAAVRYLHEHYVVHRDLKLENVLVNLPKEALQKITDWRTYDRAVV
FT                   TLSDLGLSRRIPEPPESPLLQTRCGSEDYAAPEILMGQQYDGRSTDGWALGVLLYAMME
FT                   SRLPFDALPGTRGDPAKLRARTPHRIARCEWSWYRYADSDGEWDPEKGRGLEGARECVE
FT                   SLLKRNTKRKSLEEIAAMEWVKDAIDVPGGLKRGDKEVP"
FT   gene            453265..455420
FT                   /locus_tag="ANIA_06346"
FT                   /old_locus_tag="AN6346.4"
FT                   /product="hypothetical dihydroxy-acid dehydratase
FT                   (Eurofung)"
FT   mRNA            join(453265..453407,453486..454891,454955..455420)
FT                   /locus_tag="ANIA_06346"
FT                   /old_locus_tag="AN6346.4"
FT                   /note="transcript_id=CADANIAT00006638"
FT   CDS_pept        join(453340..453407,453486..454891,454955..455322)
FT                   /locus_tag="ANIA_06346"
FT                   /old_locus_tag="AN6346.4"
FT                   /product="hypothetical dihydroxy-acid dehydratase
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006638"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006638"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006638"
FT                   /db_xref="GOA:Q5AZD4"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZD4"
FT                   /protein_id="CBF69653.1"
FT                   /translation="MLLSQTRGRLPSALRSLANRAAIRPISTTLPRQKASPKDDEPVLN
FT                   KVSRHITQPVSQGASQAMLYATGLTEADMNKAQVGISSVWYNGNPCNMHLLDLNNRVRE
FT                   GVQKAGLIGYQFNTIGVSDGISMGTSGMRYSLQSRDLIADSIETVMGGQWYDANISIPG
FT                   CDKNMPGVLMAMGRVNRPSLMVYGGTIKPGCASMQGNADIDIVSAFQAYGQFISGEINE
FT                   PQRFDIIRHACPGGGACGGMYTANTMATAIEVMGMTLTGSSSNPAESQAKYDECLRAGE
FT                   AIKRLLVEDIRPSDIMTRQAFENAMVVVNITGGSTNAVLHLIAIADSVGIKLTIDDFQA
FT                   VSDRTPFLADLKPSGKYVMADLHNIGGTPSLLKFLLKEGVIDGSGITVTGETLAKNLEK
FT                   VPDFPEDQKIIRPFSNPIKETGHIQILRGSLAPGGCVGKITGKEGTVFTGKARVFNHED
FT                   DFIAALERKEITKDEQTVVVIRYTGPKGGPGMPEMLKPSSALMGAGLGQTCALITDGRF
FT                   SGGSHGFLIGHIVPEAAVGGPIGLVHDGDVITIDAEKRVLDLDVDEAELAKRRKQWEAD
FT                   KAAGKLPQTGLNLRGTLGKYARNVKDASSGCITDAFD"
FT   gene            complement(455479..456717)
FT                   /locus_tag="ANIA_06345"
FT                   /old_locus_tag="AN6345.4"
FT                   /product="vacuolar protein sorting protein Vps66, putative
FT                   (AFU_orthologue; AFUA_2G14220)"
FT   mRNA            complement(join(455479..456619,456687..456717))
FT                   /locus_tag="ANIA_06345"
FT                   /old_locus_tag="AN6345.4"
FT                   /note="transcript_id=CADANIAT00006639"
FT   CDS_pept        complement(join(455610..456619,456687..456717))
FT                   /locus_tag="ANIA_06345"
FT                   /old_locus_tag="AN6345.4"
FT                   /product="vacuolar protein sorting protein Vps66, putative
FT                   (AFU_orthologue; AFUA_2G14220)"
FT                   /note="transcript_id=CADANIAT00006639"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006639"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006639"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZD5"
FT                   /protein_id="CBF69655.1"
FT                   /translation="MERYTQFRDKGSGIAPFLPVPLQPAPGCCPLPIRALLFIIRLPFL
FT                   IFFFVAYFAVLQWLPIGSLGKKAALWSILAVPSIWWIDLQVEGVRKGHLSRQQSRLPGP
FT                   GSIIAASFTSPIDALYLAAIFDPIFTASYPTTREVEEISLFEAILRAFDSPETHYAPRR
FT                   NAKTTSLSQLQRKYPGRPIVTFAECTTTNGRGILPLSPSLTKIGSTSKIFPVSIRYQTE
FT                   DIVTPIPGHYIGFLWSLLSKPTHCIRVRIAESVTMAGSGNGMTEKMKKSNYDTNYFDLL
FT                   DEVSASKGGVASSRDRVEIDLSPTEKNLLDTVGDALARLGRVKRVGLGVADKIDFLEEW
FT                   RKMHPA"
FT   gene            complement(457373..459179)
FT                   /locus_tag="ANIA_06344"
FT                   /old_locus_tag="AN6344.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_2G14230)"
FT   mRNA            complement(join(457373..458387,458443..458689,
FT                   458756..459179))
FT                   /locus_tag="ANIA_06344"
FT                   /old_locus_tag="AN6344.4"
FT                   /note="transcript_id=CADANIAT00006640"
FT   CDS_pept        complement(join(457373..458387,458443..458689,
FT                   458756..459179))
FT                   /locus_tag="ANIA_06344"
FT                   /old_locus_tag="AN6344.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_2G14230)"
FT                   /note="transcript_id=CADANIAT00006640"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006640"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006640"
FT                   /db_xref="GOA:Q5AZD6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZD6"
FT                   /protein_id="CBF69657.1"
FT                   /translation="MSPTYQHQQPYQDAHDSEEDVPFLPQEHNQIIRHDPSHSQSSTRA
FT                   NGYSGKESVVINGAIRSRLMITLLAMVLAVEVGFVMAGGPMTRIYESIACREYFAQADP
FT                   TKIGPDRQVPEELCKLKEVQSEIAAVTGYMEFFQGMLSVILAAPYGLLADRYGRKKTLC
FT                   LGIPGFILNCVIMFVVMWFDDVFPLRATWASCLTFFFGGGPVVTIAVIFTMMADVTTEE
FT                   ERAVMFFRFGVASMAADFVSSAASSWLMTMNPWFPLILGWGIVIVGAFLALLLPETKNA
FT                   VTPRTFEQSPEMELDPLSSTNEPKISSSSEKFVADPVGDEEGLDIPFLNRPKRRSFFAS
FT                   LATLSRSYLSPYAFIFRTKRVLLLLTAFLVYRLSRGSSWFLVQYISARYNWTIAQANLL
FT                   ISFKPALTIPLFLFIIPYISKHILRGMNSNMKDLTLARASIIFLAVGTLGIGLSPSIAM
FT                   LIPSLIVQTSGSGFAYLARSLITTLVKREETARLFTVIEVLQAVGNVIASLSITTVFQV
FT                   GLDWGGAWVGLAWMMTSTAFCLVGVSIWMFELPPAVEKIEEHGD"
FT   gene            complement(460240..463060)
FT                   /locus_tag="ANIA_10801"
FT                   /old_locus_tag="AN10801.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(460240..461764,461815..462036,
FT                   462086..462756,462822..462926,462996..463060))
FT                   /locus_tag="ANIA_10801"
FT                   /old_locus_tag="AN10801.4"
FT                   /note="transcript_id=CADANIAT00006641"
FT   CDS_pept        complement(join(460240..461764,461815..462036,
FT                   462086..462756,462822..462926,462996..463004))
FT                   /locus_tag="ANIA_10801"
FT                   /old_locus_tag="AN10801.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006641"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006641"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006641"
FT                   /db_xref="GOA:C8V0Z6"
FT                   /db_xref="InterPro:IPR019384"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0Z6"
FT                   /protein_id="CBF69659.1"
FT                   /translation="MDFWSRIIGGSRSLSKSPRATSPTERLTTFKRTCNTLQQIWRSSN
FT                   STAAEQAAIVHARHCIERLNSVLSDESRGPAPHPCLAYAASSQIFVTVTKLALSSYDEA
FT                   MLRSATVLFNTLIDSEVDGVVDNRLFARALVDLVRRADKKSADIEGRLVELLFGVANNI
FT                   RLQPNILPAWFAPRTDDEEQSTGSVEFAGTMRTDDFPLFYLLVEWVHHAGRAGDFARTG
FT                   LLYLIETASRSKDLERWLIESDLATLMATGLGALYSQLGSLGSCLDVEPVVPHVISHSD
FT                   HAQQETALPPALGSSMDSFMAYLLFWQDTIDHCKSAEVVATLLDHFQVLFLEQLLYPSL
FT                   LESSDVEGGSTAAVLTYLYRILASVDQEDLVQRILHFLLASPSGVDVQAPEKKKDMSAS
FT                   RRKSLDVLAAFSQEAARPSPTLFNLRDLVLLGLQSPNRQTVLATLRLLTVILQRYSSFS
FT                   IFLIRTNPTQPAKQRTVGALNAEVGHLLTMATSIMEEPTLDQSFDNYLKDASWILESRL
FT                   ATPPPDNCSETLPCEIRQEDPIVRELLGCLETFFTNTVIVNLALTEVLMSIASSHLMAL
FT                   DGWLLVDPAKYHYVQSDGGSSNDKSEDILDQVHRMYQEPTWSPADTPALTAALRRLVDK
FT                   VQEWRKQVEDFDILIAARRDLLHEDDVRTNQAEQNLGTPAPRSTERYSSNTPRTPPLGF
FT                   DQGTPRGRRDLRNLTSPQRSIVGSPLREVTVNKTHSPPPRDASEARSAAEELRKRLAAP
FT                   FLPESKVSTFNDRTDNSAQEPSPADQEVAVTDEEERKPKAETASLGHVLTNVVILYEFL
FT                   LEISAAVQARGAIFEEAGFHGVGSSLPVDDS"
FT   gene            complement(463259..464263)
FT                   /locus_tag="ANIA_10809"
FT                   /old_locus_tag="AN10809.4"
FT                   /product="putative CCAAT-box-binding transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(463259..463707,463768..464263))
FT                   /locus_tag="ANIA_10809"
FT                   /old_locus_tag="AN10809.4"
FT                   /note="transcript_id=CADANIAT00006642"
FT   CDS_pept        complement(join(463448..463707,463768..464263))
FT                   /locus_tag="ANIA_10809"
FT                   /old_locus_tag="AN10809.4"
FT                   /product="putative CCAAT-box-binding transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006642"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006642"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006642"
FT                   /db_xref="GOA:C8V0Z7"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0Z7"
FT                   /protein_id="CBF69661.1"
FT                   /translation="MTEQDNSYRPRSPDLSTFQPAIPSPVYQFGNPLAHRTSYDASPFF
FT                   TPHYQQPPVASARALQQYIPPYPDHSFDADMARRSSRLSRAVEVAPAPAPEMKYEEPKY
FT                   EEPLYQEPVKPEQPSEPVEHPKLDPAAGIEVKTKFPVARIKRIMQADEDVGKVAQVTPI
FT                   AVSKALELFMISLVTKAAKEAKDRNSKRVTASHLKQAVAKDEVLDFLADIIAKVPDQPT
FT                   GRKHEDDGSDQNEQPKRKRGGRRPKDDSD"
FT   gene            465852..469051
FT                   /locus_tag="ANIA_06342"
FT                   /old_locus_tag="AN6342.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(465852..465895,465960..466069,466123..466502,
FT                   466562..466826,466887..467907,467965..469051)
FT                   /locus_tag="ANIA_06342"
FT                   /old_locus_tag="AN6342.4"
FT                   /note="transcript_id=CADANIAT00006643"
FT   CDS_pept        join(465852..465895,465960..466069,466123..466502,
FT                   466562..466826,466887..467907,467965..469051)
FT                   /locus_tag="ANIA_06342"
FT                   /old_locus_tag="AN6342.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006643"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006643"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006643"
FT                   /db_xref="GOA:Q5AZD8"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR033489"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZD8"
FT                   /protein_id="CBF69663.1"
FT                   /translation="MAAAAQPSGLMDIASSLTQDEIPFKLRCAICNKLALNAFRLPCCD
FT                   QAICENCQASLPDTCPVCAHTPISSDLCKPNKALRTTLKAFLRTEEKKREKERQERQEA
FT                   QPAPSGTAAPADEALVRQESQQDSNVVEETPANGPLPNAGEDSSAAQPVDTASAAAEAD
FT                   AAGEEQIGTNGVSQVDEHSETVAPDAADQALDVAQKNADGDNIESSESTEQPDQDSQNA
FT                   MPGSGFPNPMGFNMNPGMFPNMAWGTNPMAQFMGGGMMGFPNPMGMAAMGMDPMAASQG
FT                   MFGGYGMNMNGMSNGMNMGMNFNAGQGMYGGWDGSQNNMWNGSQDKFNPNAFANGMGAQ
FT                   IGDPSGFGGYNMSQPNGVHPQMQQQQFSNQELQNGYYGPGNYRGRGRGYFPGGRGRGGY
FT                   VGHMQPNFPHNVNSAALQDNTSSADQPMPSQTEEGATDSTATGDNVPSDGKKAEDGPNT
FT                   ADASSGNQALNQVETNGGNVESVPGADGHPDQAMNAENQLQGIPTVDSLNEPYNVGATA
FT                   APTYMYQGFGRGGGYMRGGFHGRGGSFGGQQQFMPAPNMQPRGPGVEGAPAAPRAMRQG
FT                   LPNTSVFRQRNFHLVGRVPNQPSKGPEVSQTPHAEPTSEDQRPQSSSRSISRARSRSRS
FT                   KPRSRSRSRSRVPSRSSSRRRYRPRSRSVEDDATDYDRPRERRRRPHHDERDRTAEDER
FT                   RSRSPSIDSHRSSLRDKERDRRRARRSRRSHRRRSRSRSASGDRNGDSRDTDRFAEERS
FT                   SSKPRSRNADTLDTHRSGKDRSSRREEDRERDRDSRRRDRERDRDRDRDRDRDRDRDRI
FT                   REKERERDRDRERPRERDRDRERDRKRSRRDRSESAADSDYHSRKAKRGREDDARTSTS
FT                   NRDRPKDTREKTLLTNPPEPEKDPHTLEREARNRERLLKEQQRREAMQADRDAGKSSRR
FT                   RDSRQERAGRRLNYKYDDETDAARAARVEREREAGRWE"
FT   gene            complement(469824..472116)
FT                   /locus_tag="ANIA_06341"
FT                   /old_locus_tag="AN6341.4"
FT                   /product="putative coronin homolog (Eurofung)"
FT   mRNA            complement(join(469824..470078,470139..471300,
FT                   471355..471458,471516..471564,471622..471764,
FT                   471822..471881,471937..471965,472014..472116))
FT                   /locus_tag="ANIA_06341"
FT                   /old_locus_tag="AN6341.4"
FT                   /note="transcript_id=CADANIAT00006644"
FT   CDS_pept        complement(join(469824..470078,470139..471300,
FT                   471355..471458,471516..471564,471622..471764,
FT                   471822..471881,471937..471965,472014..472047))
FT                   /locus_tag="ANIA_06341"
FT                   /old_locus_tag="AN6341.4"
FT                   /product="putative coronin homolog (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006644"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006644"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006644"
FT                   /db_xref="GOA:C8V0Z9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015048"
FT                   /db_xref="InterPro:IPR015505"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C8V0Z9"
FT                   /protein_id="CBF69665.1"
FT                   /translation="MSGRFVRSSKYRHVFGRPTRKEQCYDNLRVSRNAWDTNLVKANPK
FT                   YLSVNWEAGGGGAFAVIPLEERGKLPERIPLFRGHTAVVLDTDWNPFNDDLIASGSDDG
FT                   RVFLWRVPEGFTLSPDVDADDIQDVAPVGKLSGHPKKVGHVLFNPAAENILATASGDYT
FT                   VKIWDIEAGASKLTLNVGDIVQSQSWSANGSLLVTTSRDKKLRVWDVRQERPAHEGQGH
FT                   TGAKNSRSVWLGERDRFATTGFSKMSDRQLALWDIRSPQLPIDGFKTLDSISGVCMPFW
FT                   DDGTQCLYLAGRGDGNIRYFELENDKFEYLSEYKSADPQRGIAFMPKRGVNMHENEVTR
FT                   AFKTVNDTYIEPISFIVPRRAETFQDDIYPPTVGLKPAMSASEWFGGKEAIPPKISMGS
FT                   LYDGQGLKEVTGIQDKPTSNLGTESKPEPKSEPEAKPAPQVKTTESAPETTPVVKPAPS
FT                   MKEQGASMAAMVNKFADDEEAEPAEESSFDEPSKPIERATRSPGTSSPTVKDSPFLQKE
FT                   NSAKISSPVSASPAPADRSQSPAQSTFNAQPTSSPASTTGSTAAGASSVPADAVQREIS
FT                   AIKDLIAEQTKTIASQALQVQNLTAEIESLKAKLG"
FT   gene            472543..475995
FT                   /locus_tag="ANIA_06340"
FT                   /old_locus_tag="AN6340.4"
FT                   /product="Kinesin-like protein klpA
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P28739]"
FT   mRNA            join(472543..472714,472778..472901,472950..473255,
FT                   473673..473804,473857..475421,475471..475995)
FT                   /locus_tag="ANIA_06340"
FT                   /old_locus_tag="AN6340.4"
FT                   /note="transcript_id=CADANIAT00006645"
FT   CDS_pept        join(472706..472714,472778..472901,472950..473255,
FT                   473673..473804,473857..475421,475471..475647)
FT                   /locus_tag="ANIA_06340"
FT                   /old_locus_tag="AN6340.4"
FT                   /product="Kinesin-like protein klpA
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P28739]"
FT                   /note="transcript_id=CADANIAT00006645"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006645"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006645"
FT                   /db_xref="GOA:P28739"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28739"
FT                   /protein_id="CBF69667.1"
FT                   /translation="MENVQSRMQGSRIPGLKEMNPSGTNARSRLPQPGAIANKPTAVPQ
FT                   LARTRSTTESTRIGAGPPSAARSVNGATKAHTRANSYANSSTLTRSASAASRPRGPLSS
FT                   STSGRPKTSMSTSRRPNGHALPRPATSLDTHQEERSYGGLGKRGEWDQDEREQNLESLF
FT                   ETFVSRISQQGQESSGLKDALEVYKSRVGELEEAKSEQTEQNIRLKVELDVSKSRLAEA
FT                   EDALKNAQRDHEIAIDELMSRQRAECESVRYESQKSLDALKAQHESELKELRRQFEREL
FT                   EDEKCARVRELNQLHSKTALDAQLSQIELDKTIKELAATREDLQSLRTELDRERKNTNN
FT                   LRQNLDTAASNSVTLESTISALKARIEFLESGREEQSEAFERLNQQMMDAMAETNAAKE
FT                   KLRREETLRRKLHNQVQELKGNIRVFCRVRPTLENEGASDAAQFTYPDEGEDSKEINII
FT                   GPEEKSSFGTVTRKNHNFSFDHVFGPSAQNSDVFDEISQLVQSALDGYNVCIFCYGQTG
FT                   SGKTHTMSSLDGMIPRAVHQIYETATSLEEKGWRYTMEGNFVEVYNENLNDLLGKAEEL
FT                   DKKKLEIRHDMQRGKTTITDATTVQLESPEMVESLLKRAAANRSVAATKANERSSRSHS
FT                   IFILKLIGENYITGERSEGTLNLVDLAGSERLSHSGATGDRLKETQNINRSLSCLGDVI
FT                   AALGQGKKDGHIPYRNSKLTYLLQFSLGGNSKTLMFVMVSPLQAHLSETLTSLKFATKV
FT                   HNTHIGTAKKQTRVRDV"
FT   gene            complement(476088..479287)
FT                   /locus_tag="ANIA_06339"
FT                   /old_locus_tag="AN6339.4"
FT                   /product="PAK-related kinase (Eurofung)"
FT   mRNA            complement(join(476088..476128,476263..476305,
FT                   476421..478412,478458..478624,478680..478794,
FT                   478841..479287))
FT                   /locus_tag="ANIA_06339"
FT                   /old_locus_tag="AN6339.4"
FT                   /note="transcript_id=CADANIAT00006646"
FT   CDS_pept        complement(join(476088..476128,476263..476305,
FT                   476421..478412,478458..478624,478680..478794,
FT                   478841..479287))
FT                   /locus_tag="ANIA_06339"
FT                   /old_locus_tag="AN6339.4"
FT                   /product="PAK-related kinase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006646"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006646"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006646"
FT                   /db_xref="GOA:Q5AZE1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZE1"
FT                   /protein_id="CBF69669.1"
FT                   /translation="MDAPRTSRFLDPTSAVAAITKHKAEAIRLAREQGAAVREMCRRAK
FT                   TETPPYEFEELIGKGAYGRVYKGHQLPSREVVAIKVLDIDSLDYKSVRDFKDESIKDFI
FT                   HETKVMKQVKDAGAKNINEIIEAVSIHSQLWLVCEYCPGGSVRTLMRATGDRLEERFAI
FT                   PVARELAAGLRAIHDAGIIHRDIKAANVLIHEEGRLQICDFGVAGVLQSQMDKRSTWIG
FT                   TPHWMPPEMFTAKQDHQYSSEVDVWAYGCTLFELATGNPPNANLRERMQIGRQLNRKTP
FT                   QLADGGEYPEGLRDLVAYALNSDPVTRPSMADILLHPYIANSEEEYPTSSLSELVRIYY
FT                   QWSQRGGQRISLFHPGGAAAAEVPDVESDIDEDWNFSTTDDFERRFSVIDLDQLAASLA
FT                   ELEQEIKDTTGQPQQEPADEPAETEMTEQDKANFDERVRRGAAAMEGLFDEEKPSYKYE
FT                   TKNDFVPIEQKAPVSDLPLRTDTDRSSVTSTFIDIDIPSFDSSHYAAGATTAQPFQLAD
FT                   ADTIRANRSSGRNRSFNEGRSRSSSSEVRSSVDIQETFQPRTGPRPPTMDWKFPSFMTA
FT                   PTEEPESESVSEVDSGAEAGSESEPERIARDSLTQPLTFAPAEKRATMEWTFPVMTTST
FT                   DDDHVSPRNSSSAEEDGEPSRHDTLKASDARFSSIGEPGDSDRDISRPSTSASVQSNVS
FT                   ASSDTDYDPFRFDRPPSPPEGSPQSKQQQQFLNNEYPELLTSVGYNRYSHSSIIEGPGP
FT                   DEEEDTTSVWQNNITTTAPPAYPQTSTPMQMQTSYSEPFPTAIPHKDQRMRAFPGIGVA
FT                   PTSTDSESGHGTSFEPLHTARYNPTTLHIPSSIEGMSPIKFPDLVPPRLEVLMDGAGEA
FT                   ATTAELNRLLGDFLDALSATGSALSRTKVSIGGSAGMDQNVYTICITVDYCTQGQTERV
FT                   PQTA"
FT   gene            complement(480153..482232)
FT                   /locus_tag="ANIA_06338"
FT                   /old_locus_tag="AN6338.4"
FT                   /product="hypothetical amino acid aminotransferase
FT                   (Eurofung)"
FT   mRNA            complement(join(480153..480517,480575..481399,
FT                   481452..481696,481755..481829,481885..481921,
FT                   481982..482232))
FT                   /locus_tag="ANIA_06338"
FT                   /old_locus_tag="AN6338.4"
FT                   /note="transcript_id=CADANIAT00006647"
FT   CDS_pept        complement(join(480263..480517,480575..481399,
FT                   481452..481696,481755..481829,481885..481921,
FT                   481982..482134))
FT                   /locus_tag="ANIA_06338"
FT                   /old_locus_tag="AN6338.4"
FT                   /product="hypothetical amino acid aminotransferase
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006647"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006647"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006647"
FT                   /db_xref="GOA:Q5AZE2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZE2"
FT                   /protein_id="CBF69671.1"
FT                   /translation="MSPPAALDMDTNGIGAPKPLTVDGIAAVRAKSAPMPAGVAPATSS
FT                   DMFKSPACYTKPKAKRWDNFFTLEAKSRKTSTLKGAAKFLKNPGLISLGGGLPSPEYFP
FT                   FEELSFKVPTPPGFSPEATRQSGTTLVAGKHDIREGKSLYDLEVSLNYGQSTGSPQLLR
FT                   FVTEHTELIHNPPYSDWQCALTAGSTYAWDTALRLFCERGDYLLMEEYTFSSAQETALP
FT                   QGVNVAPVKMDEQGLLPGDLDDVLSNWDEKVRGARKPFVLYTIPTGQNPTGATQSAERR
FT                   KEIYKVAQKHNIYIIEDEPYYFLQMQPYTGADSAPVPPPANHEEFVKSLIPSYLSIDVD
FT                   GRVLRVESFSKVLAPGSRTGWVVGSEQVIERFLRNTEVSAQHPSGISQLMLFKLLDEHW
FT                   GHLGYFDWLINLRMQYTNRRNIMVQACEKHLPQEIASWIAPAAGMFHWIQVDWKKHPEL
FT                   TSGKTRDSIEEALFHAAINNGVLVSRGSWFKAAGASEDKLFFRATFAAASEENITEAIR
FT                   RFGDALRVEFKL"
FT   gene            484794..485594
FT                   /locus_tag="ANIA_06337"
FT                   /old_locus_tag="AN6337.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(484794..484889,484945..484985,485047..485115,
FT                   485178..485594)
FT                   /locus_tag="ANIA_06337"
FT                   /old_locus_tag="AN6337.4"
FT                   /note="transcript_id=CADANIAT00006648"
FT   CDS_pept        join(484875..484889,484945..484985,485047..485115,
FT                   485178..485265)
FT                   /locus_tag="ANIA_06337"
FT                   /old_locus_tag="AN6337.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006648"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006648"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006648"
FT                   /db_xref="GOA:Q5AZE3"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZE3"
FT                   /protein_id="CBF69672.1"
FT                   /translation="MPLYNVTLKKDSPIEELHKAKEAAKEKGGTIKHEYTLIKGFTVEY
FT                   PDDLVSVFESSEHIHVEQDGEVKTQ"
FT   gene            485944..487449
FT                   /locus_tag="ANIA_10800"
FT                   /old_locus_tag="AN10800.4"
FT                   /product="mitochondrial pyruvate dehydrogenase kinase,
FT                   putative (AFU_orthologue; AFUA_2G13600)"
FT   mRNA            join(485944..486179,486234..487449)
FT                   /locus_tag="ANIA_10800"
FT                   /old_locus_tag="AN10800.4"
FT                   /note="transcript_id=CADANIAT00006649"
FT   CDS_pept        join(485944..486179,486234..487449)
FT                   /locus_tag="ANIA_10800"
FT                   /old_locus_tag="AN10800.4"
FT                   /product="mitochondrial pyruvate dehydrogenase kinase,
FT                   putative (AFU_orthologue; AFUA_2G13600)"
FT                   /note="transcript_id=CADANIAT00006649"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006649"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006649"
FT                   /db_xref="GOA:C8V104"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR018955"
FT                   /db_xref="InterPro:IPR036784"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039028"
FT                   /db_xref="UniProtKB/TrEMBL:C8V104"
FT                   /protein_id="CBF69674.1"
FT                   /translation="MAATIPFLTLSIGRDLRRSALRHRSRMVAARLFATSSHPKLTTTA
FT                   TATTTQNLTPRANDEVARLAASRRRPLTLADLLKYGRPPLSKEALLASANFTLSLLPAR
FT                   LASRIEALRNLPFIVVANPHVSKIYGNYVHSLSTLLPWQKRQVTTLEEENQFAEVLADL
FT                   VHTHSNTIPILARGFLECRKYIDPAEVTRFLDTHLRARIGTRLIAEQHLALHFASRPAG
FT                   DGSAEGREQPRKDAPPSNYIGVIDTALQPARIVRSCEEFVGEICELKYGVRPRLEIHGQ
FT                   PDATFAHVPVHVEYILTELLKNAFRAVIESGNEQEPIEVTIAAAPDVPGNHLQAHEPVT
FT                   NGKPADALDTGAQSDSDVGFHVDTVVGTADANESIKFSTPSSQSITLRIRDRGGGISPD
FT                   VLPQIWSYSFTTFSDLDMGEAGGIDALNTISSNSGQLSSIAGLGYGLPLSRAYAEYFGG
FT                   SIAVQTLWGWGTDVYLTLNGVGKVA"
FT   gene            487998..489761
FT                   /locus_tag="ANIA_10808"
FT                   /old_locus_tag="AN10808.4"
FT                   /product="thiamine pyrophosphate enzyme, putative
FT                   (AFU_orthologue; AFUA_2G13620)"
FT   mRNA            join(487998..488060,488136..489761)
FT                   /locus_tag="ANIA_10808"
FT                   /old_locus_tag="AN10808.4"
FT                   /note="transcript_id=CADANIAT00006650"
FT   CDS_pept        join(487998..488060,488136..489761)
FT                   /locus_tag="ANIA_10808"
FT                   /old_locus_tag="AN10808.4"
FT                   /product="thiamine pyrophosphate enzyme, putative
FT                   (AFU_orthologue; AFUA_2G13620)"
FT                   /note="transcript_id=CADANIAT00006650"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006650"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006650"
FT                   /db_xref="GOA:C8V105"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C8V105"
FT                   /protein_id="CBF69676.1"
FT                   /translation="MVKGQKEKPNEFPKIVTCPNEMVALSMADGYARLTGKPQCVIVHV
FT                   DVGTQGLGAAIHNASCGRAPVLIFAGLSPFTIEGEMRGSRTEYIHWIQDVPDQKQIVSQ
FT                   YCRYSADIRSGKNIKQMVHRALKFATSDPQGPVYLVGAREVMEEEIEPYAVSPYGWRGV
FT                   APPALPAEGVELIAQELASAKEPLVIVGYSGRTARGVEQLVKLADTYKGIRVLDTGGSD
FT                   MCFPADHPASLGMRFGIHEAIKTADFILVADCDVPWIPTQCSPSDSAKIIHVDVDPLKQ
FT                   QMPVFYIPAMATFRAESATAFEQVNAYVESNTELKQFIASDANTVLGQSREEAFRTTRQ
FT                   AINELAVTPAGGPDAALNASYLLSEIRKTLPLDTIWAVESVTLTPIVADQIAATLPNSW
FT                   INCGGGGLGWSGGAALGIKLATDAQAGGGNKGKFVCQIVGDGTYLFSVPGSVYWIARRY
FT                   NIPVLTIVLNNKGWNAPRRSMLLVHPNGDGSKATNEELNISFAPTPDYAGIARAASGGH
FT                   IWAGVAGSVGELGRLLPEAVESVKNGVGAVLEAQLDGTEGKYVRK"
FT   gene            complement(489850..491087)
FT                   /locus_tag="ANIA_06335"
FT                   /old_locus_tag="AN6335.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(489850..490139,490198..490964,
FT                   491012..491087))
FT                   /locus_tag="ANIA_06335"
FT                   /old_locus_tag="AN6335.4"
FT                   /note="transcript_id=CADANIAT00006651"
FT   CDS_pept        complement(join(489940..490139,490198..490936))
FT                   /locus_tag="ANIA_06335"
FT                   /old_locus_tag="AN6335.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006651"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006651"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006651"
FT                   /db_xref="GOA:Q5AZE5"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZE5"
FT                   /protein_id="CBF69678.1"
FT                   /translation="MTTPRRPPPAYTAPTDSTVHGTTQVYRSISETASDPAKRELEKSF
FT                   TIRPCSGQAWIVPAGHICRLTTPNGPQVGDLNIWNANNPRERLWAARTRQIHASHVSVG
FT                   DRLWSNLPYLRPLVTITGDSLAGGQLHEVLDVDGKRKEGKGFGTSQWGGRVHDLLGTRC
FT                   DPYVNLLMGGESFDFHCHSNLTRAVTPYGLTELDVHDVLNVFQVTGLDEEGRYFMETSP
FT                   AKPGEYFEFFAEVDVLCALSACPGGDLSNWGWDDKEDMGATTRPLGVEVYKITEAKALE
FT                   GWKEPQSPKYTGMHGMKMPACENDGAGFVGL"
FT   gene            491394..495143
FT                   /locus_tag="ANIA_06334"
FT                   /old_locus_tag="AN6334.4"
FT                   /product="ribosome biogenesis protein (Bms1), putative
FT                   (AFU_orthologue; AFUA_2G13570)"
FT   mRNA            join(491394..491451,491537..491607,491679..491768,
FT                   491823..495143)
FT                   /locus_tag="ANIA_06334"
FT                   /old_locus_tag="AN6334.4"
FT                   /note="transcript_id=CADANIAT00006652"
FT   CDS_pept        join(491394..491451,491537..491607,491679..491768,
FT                   491823..495143)
FT                   /locus_tag="ANIA_06334"
FT                   /old_locus_tag="AN6334.4"
FT                   /product="ribosome biogenesis protein (Bms1), putative
FT                   (AFU_orthologue; AFUA_2G13570)"
FT                   /note="transcript_id=CADANIAT00006652"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006652"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006652"
FT                   /db_xref="GOA:Q5AZE6"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030387"
FT                   /db_xref="InterPro:IPR037875"
FT                   /db_xref="InterPro:IPR039761"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZE6"
FT                   /protein_id="CBF69680.1"
FT                   /translation="MEQQTNRAHRAPKERKKYDGPNPKAFAFSNPGKGNKAGARSHDIK
FT                   EKRLHVPLVDRLPEEAPPLVVAVVGPPGVGKTTLIKSLIRRYTKQTLSTPNGPLTVVTS
FT                   KKRRLTILECPSDSLAAMIDVAKIADIVLLMIDGNYGFEMETMEFLNVLSTSGMPGNVF
FT                   GILTHLDLFKKQSTLRAAKKRLKHRFWSELYNGAKLFYLSGVINGRYPDREVHNLSRFL
FT                   SVMKNPRPLVWRNSHPYALADRFLDITPPTEIEKDPKCDRTIALYGYLRGTNFPAQGAR
FT                   VHVPGVGDLTVSGIEALPDPCPTPYMDQQIQKATGKSNKRRLGEKQKLLFAPMSDVGGV
FT                   LVDKDAVYIDVKTSNFNEDDEERDTDRGLGEQLVIGLQGERKLLGEADSGVRLFRGGEA
FT                   ITKADDEDNDTGRKHRREVRFAGDDNQGAAEEDEGFESAEDGEDEEEEDQDDMEAGSDD
FT                   GEAEVDVSAPPDFAESFRERQNGPTSRQESDIAFADSDSDLGSISSVEDQILESDMEEE
FT                   EEGSDEEDDGTLRWKDNMLANAKSLHSKRPKYRITDLSRTMYDESMTPAEVIRRWRGEE
FT                   ERDEEPEGEDDEDTFFKKTNVEQEEQAEYRAVPEYDYEELERKWRDEEMIESLRKRFVT
FT                   AKLGDADDGEDEDVEDAFDEDDEGDGAFEDLETGEVFNGIKDDDGEASGEDDEKDGPED
FT                   LEAERARNAKRKEELKLRFEEEDREGFANSKDNSRHDGAEPEEEFGEDEWYDAQKAKMQ
FT                   KQADINRAEFEALDPNSRARAEGYRAGTYARIVLERVPCEFSTKFNPRYPVIVGGLAPT
FT                   EDRFGYVQVRIKRHRWHKKILKSNDPLIFSLGWRRFQTLPMYSTSDNRTRNRMLKYTPE
FT                   HMHCFGTFYGPLVAPNTGFCCVQSFSNKNPGFRIAATGVVLSVDEHTEIVKKLKLTGVA
FT                   YKIFKNTAFIKDMFNSSLEIAKFEGAAIRTVSGIRGQIKRALSKPDGCFRATFEDKILM
FT                   SDIVFLRAWYPIKPHRFYNPVTNLLDIEEGLSGDGGWKGMRLTGEVRREQGIPTPLNKD
FT                   SAYRKIERPERHFNPLRVPRQLAAELPFKSQITRMKSRKDKTYLQKRAVVLGGEEKKAR
FT                   DLMQKLNTLRNEKQAKRAAKQEERRKVYRAKVAEGLEKKAEREKRERDEYWRREGKKRK
FT                   NEDGEGGGSKKRR"
FT   gene            495455..497448
FT                   /locus_tag="ANIA_06333"
FT                   /old_locus_tag="AN6333.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(495455..496433,496489..497448)
FT                   /locus_tag="ANIA_06333"
FT                   /old_locus_tag="AN6333.4"
FT                   /note="transcript_id=CADANIAT00006653"
FT   CDS_pept        join(495963..496433,496489..497448)
FT                   /locus_tag="ANIA_06333"
FT                   /old_locus_tag="AN6333.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006653"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006653"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006653"
FT                   /db_xref="GOA:Q5AZE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZE7"
FT                   /protein_id="CBF69682.1"
FT                   /translation="MLDGSLQVHRRQGAQGQGRTHRRENISNIDVPNGLDRYQGRTTGM
FT                   RPLSLDASSNMQRTAEGISVDCQVWRHESSAVPLEGYTSPQDKSTAGGETVPKEAGGLE
FT                   TSRQIDIERTEASGHTRSSTNLPGAQHSPRVGDIGRRRSQSTGFGSRGSRIAALSVQLR
FT                   TRLSYAAARIEKARQSQSQYQSPTGLLQKNSSTPILSVETLSRTGQPSLGEPGDQFEAG
FT                   SPDGTTVSAPDAPAASSRHPFEGPIRQTLNATIDVNSQTQPDLNKHAEYHPELRPPRLA
FT                   PPADIDPGRVNRQRRRPNPNNPSNPSRYAPFPLHRRGRSQQELVADTEVTRVPETPPLC
FT                   PSNDNGIPFHGWSDNSQSSSMEQDAIETLLFMSSPGTSGYHSNSQNSQRNQDVRNIDDS
FT                   ASQSVKWHGSLNGTQSDRQSGLTGTVETRTGDEIDLMLDQMNSDSDDDADYTFRRSIRV
FT                   EAGSRANDAVGSNVQHGT"
FT   gene            497938..498814
FT                   /locus_tag="ANIA_06332"
FT                   /old_locus_tag="AN6332.4"
FT                   /product="lactoylglutathione lyase (Glo1), putative
FT                   (AFU_orthologue; AFUA_2G13550)"
FT   mRNA            join(497938..498573,498642..498814)
FT                   /locus_tag="ANIA_06332"
FT                   /old_locus_tag="AN6332.4"
FT                   /note="transcript_id=CADANIAT00006654"
FT   CDS_pept        join(497938..498573,498642..498683)
FT                   /locus_tag="ANIA_06332"
FT                   /old_locus_tag="AN6332.4"
FT                   /product="lactoylglutathione lyase (Glo1), putative
FT                   (AFU_orthologue; AFUA_2G13550)"
FT                   /note="transcript_id=CADANIAT00006654"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006654"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006654"
FT                   /db_xref="GOA:C8V109"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C8V109"
FT                   /protein_id="CBF69684.1"
FT                   /translation="MSNLQPSSSEPSIFEVGAFLPGGHNTDPALPENSPTAGFKLNHFM
FT                   LRIRDPKRSLHFYMNLMGMRTVFTMNTGPWTIYYLGYPSTPQDRADLPAWSAKVGGDNR
FT                   TLTSTLGLLELYHVHGSEKPISEGGYEISTGNEPPNLGFGHLGFTVPDVPKALERLRGA
FT                   GVRVIKELSVSTRESIPLSKWEEERGIGVGEIHPNYKAVFDQIAFVADPDGYTVELVPQ
FT                   TMN"
FT   gene            complement(499016..501507)
FT                   /locus_tag="ANIA_06331"
FT                   /old_locus_tag="AN6331.4"
FT                   /product="CCCH zinc finger and RRM domain protein
FT                   (AFU_orthologue; AFUA_2G13540)"
FT   mRNA            complement(join(499016..499417,499513..500513,
FT                   500568..501182,501260..501378,501443..501507))
FT                   /locus_tag="ANIA_06331"
FT                   /old_locus_tag="AN6331.4"
FT                   /note="transcript_id=CADANIAT00006655"
FT   CDS_pept        complement(join(499016..499417,499513..500513,
FT                   500568..501182,501260..501378,501443..501507))
FT                   /locus_tag="ANIA_06331"
FT                   /old_locus_tag="AN6331.4"
FT                   /product="CCCH zinc finger and RRM domain protein
FT                   (AFU_orthologue; AFUA_2G13540)"
FT                   /note="transcript_id=CADANIAT00006655"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006655"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006655"
FT                   /db_xref="GOA:Q5AZE9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR002483"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036483"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZE9"
FT                   /protein_id="CBF69686.1"
FT                   /translation="MQLTEEQAAEVKAWVVKKLEDISDADSDVLADYVLALIRSDAPDD
FT                   EIRKASVENLEDFLREHTANFVEELFATFALKQTPAAPAQVQLPQAATQPSAQAVPLAG
FT                   SSNGSYGPQSHGDNLSRKRTYDDGFSDNHGHENAQSHRNFKNPRRGRGGKSDWTGRDGH
FT                   PPSGPGQFPHSAGGFPVMPPSFPGFDQNDPMATMLALQSMGFPQMPGMPPMPMPPGGGP
FT                   GQQPDQMGPKSTEKCPFYETQGICYLGGACPYQHDTVAGAPKDDEYDPKTSGIVPDSRR
FT                   RLDGSMRGSDRGRGRGRGSDRGGFNNRGRRSEFSAAGPSDDPSMKTIVVEQIPDDKLDE
FT                   FTVREFFSQYGEITDLQLQPHRKLALITYADHATAKAAWSSPKVIFDNRFVKVYWHKPK
FT                   GHDQRAGGNGRETPQTFDAEEFQRQQEEAQKAYEEKLRQRQETEKAKQELERQREELLK
FT                   KQEEEKQRLLQKIGSATSGSATANGGASQSPSDENVSEQTKQLRAQLAALEAEAKSLGL
FT                   DPNHSSDPGTSYRGRGRGFGRGGYPSRGRGYDPSSRGSYRGRGGFPARGRGGVLRLDNR
FT                   PKRIAVSGIKPHSEQDEAFRQFLIGVSEYESITPNPNDENSLIVSFKERYQAEKFMFGP
FT                   RNIPSVGEVQLSWVPNPPISVPSQSSSTSPDQGQGQQTVATPGGSGPDAKTGAGSDEDM
FT                   IMDSVSAEHDQDQARVKENGAATAEVDYDVAEVDDSWGV"
FT   gene            complement(501939..505222)
FT                   /locus_tag="ANIA_06330"
FT                   /old_locus_tag="AN6330.4"
FT                   /product="elongation factor 2 (Eurofung)"
FT   mRNA            complement(join(501939..502238,502294..504728,
FT                   504784..504841,504933..504948,505028..505222))
FT                   /locus_tag="ANIA_06330"
FT                   /old_locus_tag="AN6330.4"
FT                   /note="transcript_id=CADANIAT00006656"
FT   CDS_pept        complement(join(502221..502238,502294..504728,
FT                   504784..504841,504933..504948,505028..505035))
FT                   /locus_tag="ANIA_06330"
FT                   /old_locus_tag="AN6330.4"
FT                   /product="elongation factor 2 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006656"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006656"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006656"
FT                   /db_xref="GOA:Q5AZF0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZF0"
FT                   /protein_id="CBF69688.1"
FT                   /translation="MVNFTIEELRSLMDRKANIRNMSVIAHVDHGKSTLSDSLVSRAGI
FT                   IAGAKAGDARFMDTRPDEQERGITIKSTAISLYAKFADEEDIKEIPQAVDGNEFLINLI
FT                   DSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQALTERIKPVLIINKVDR
FT                   SLLELQVEKEDLYQSFLRTVESVNVIIATYEDKALGNVQVYPEKGTVAFGSGLHGWAFT
FT                   VRQFAVKFAKKFGVDRKKMLERLWGDNYFNPKTKKWTKTQPEVDGKPVERAFNMFILDP
FT                   IYKIFQLVTNDKKDQIPALLEKIEVKLANDEKDLTGKQLLKTIMRKFLPAADAMLEMIC
FT                   IHLPSPVTAQKYRAETLYEGPQDDEAFAGIRDCDPKAPLMLYVSKMVPTSDKGRFYAFG
FT                   RVYAGTVKSGLKVRIQGPNYTPGKKDDLFIKAIQRTILMMGRFVEPIEDVPAGNIVGLV
FT                   GVDQFLLKSGTLTTSETAHNLKVMKFSVSPVVQRSVEVKNAGDLPKLVEGLKRLSKSDP
FT                   CVLTMINESGEHVVAGAGELHLEICLKDLEEDHAGVPLRISDPVVSYRETVSGTSSMTA
FT                   LSKSPNKHNRLYLTAEPLDEEVSKAIEEGKINPRDDFKARARILADEYNWDVTDARKIW
FT                   CFGPDTTGANLLVDQTKAVQYLNEIKDSVVSGFQWATREGPVAEEPMRSIRFNILDVTL
FT                   HADAIHRGGGQIIPTARRVLYAATLLAEPGILEPIFNVEIQVPEQAMGGIYGVLTRRRG
FT                   HVYTEEQRVGTPLFTVKAYLPVNESFGFPGELRQATGGQAFPQSVFDHWAVLPGGSPLD
FT                   PTTKPGQIVAEMRKRKGIKEQVPGYENYYDKL"
FT   gene            complement(506219..516547)
FT                   /locus_tag="ANIA_06329"
FT                   /old_locus_tag="AN6329.4"
FT                   /product="fermentation associated protein (Csf1), putative
FT                   (AFU_orthologue; AFUA_2G13520)"
FT   mRNA            complement(join(506219..515740,516194..516209,
FT                   516328..516437,516524..516547))
FT                   /locus_tag="ANIA_06329"
FT                   /old_locus_tag="AN6329.4"
FT                   /note="transcript_id=CADANIAT00006657"
FT   CDS_pept        complement(join(506219..515740,516194..516209,
FT                   516328..516437,516524..516547))
FT                   /locus_tag="ANIA_06329"
FT                   /old_locus_tag="AN6329.4"
FT                   /product="fermentation associated protein (Csf1), putative
FT                   (AFU_orthologue; AFUA_2G13520)"
FT                   /note="transcript_id=CADANIAT00006657"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006657"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006657"
FT                   /db_xref="GOA:Q5AZF1"
FT                   /db_xref="InterPro:IPR029636"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZF1"
FT                   /protein_id="CBF69689.1"
FT                   /translation="MDLAGRHATPATITAARAKLEPVPPDDEAVIIVAITTRGTEYSTA
FT                   ICTARLAKSPARISGLPEGCTSVLFFLLYFNRLFAALLSYGIRAYTWHYYRAYVDINAL
FT                   QISLIGGRIFFKGIRYHGVNETIFIHGGFLTWNFWKHAVRRTDFSRTGVQNTEDTEYAG
FT                   NRNGSIGEKGGVDCPAALPCRITAKFYGLEWFIYNRTPAYDSILTGFKTAAAASTQSPD
FT                   SESVLSDASLKENQTVAPSSNESSPEQANAADGSTARHGRTMETYTSQEGAPGEQDTRD
FT                   SLSGLLQLLPVKLECDKGAIVMGNENTRSVLTTTFDSATGLIEACCAASPLDLYRQVFS
FT                   FKFDHPVVQMRPNPDYKQTQLAAARRLSTVREEKPGVKRKRDTVFNYQFQKRRIWHSVR
FT                   DLIPYFQTSVESFHVLDRRTGQDTRHTTNVNHDTRWVGLSRYLDQGSQDDHSEWDAIEY
FT                   GRFSTVLDSPSMIVVYFWDNPGVVKAHSVAEGPPPPRSSDINGASPPEWGIDVKVAGGM
FT                   INYGPWADRERVGLQNIFFPNAYRNFQPAEPLRPGDTRQSSAFRFRVEFDQETILRIPT
FT                   RESSKDWQWKGRGDAVRGASKLKKQQRRKQSRAAEGEKGNVGPDIRPFGWFALRIAENS
FT                   TMHYTMDMVPGKSGFSSQLDLDFRDSKMSSSVNHALLWSCPRQLITCDLSVPLSWKALR
FT                   RWKFGVENQDMELFLLRDHIFLLTDLITDWGSGPAPDYHTFVPFIYHLSISFTDIRLYA
FT                   NVNDSNIVSDPTNLSDNRLLVIKGNKLTSDISIPLDKYRAEQNVVDFNVTLQDAEIDFV
FT                   APVWDTLHTFLKNKKTATLETLTIDGTYSYFLSTSPELTDILQLNLHGISPRLYMFGFL
FT                   IKSFMIVKENYFGEEIHFKTLEEYQELAYSGDPTAVHNGINPNKKTNDLDVVLHVTVEH
FT                   PHVFLPETLYDDHNYVQLTAPCLEVDLRFTNYYMDMQFSLAPLSAALKSHWVKEDPKIP
FT                   ETQLFIDGASIYGHRIFGLPPTEPTYVCNWDFDVGSIIGECSPKFLASLASALQSFDFS
FT                   FDNEENVLPPLFPIALHDVTFLRARVALVHISILMDIDALVLKSETITARFNDWAHARF
FT                   SKRMSLLMPDISIAAIDCASLPKSGSVDALEVLPLALLQTSIKLRMVQRRSDISESRRL
FT                   QQAHIRAHDQRTQRTPWLLLDLNELESGTHYPGQDVAPRPTIAIPTMPEPLTRDSGLVG
FT                   LPPKAYPKDNSSQRSFLLRSDSSNSGSGLKQGTRSVKETLSMPSSMHQYQRLSETGRVG
FT                   LRYRSPRYWTRASQQGPQVNPNTWAIPEFTFYRIRLNTSQLPASQVPNAGVSQADPPAP
FT                   KFDPQFSPSESDSTTYTNFMVDLHRGVRGFCTPRFLFVISALAESLELRHPVEIIDSLQ
FT                   KDIVSDIMAYEKSLPNPKKATSFAIRAPLISLKLVNDSDFFSANEAAFRDEYRVEVCRL
FT                   KTEFRTRVERQKGDLIAGIKEAITAHVAAESFSVSLESSQADQHRLKSEVSCMLRDISF
FT                   WIMTTPTIRSNLQVRAFHIATSTKSVEQLAYLVRRTTTMLDSATSSFKHASIRRHKRMR
FT                   FLIYRLTQSAAEMPDPVFLTRISYMLRMASGHLRHHDSWKILSRIRNVFNNLSIEQQKE
FT                   LTAKCSSDDITLHANAKSEVLSSFDQWRAWDLAHVEKSYVMRRVWGFPEDVVENAPLNA
FT                   SFSSTIKLFRFSIDPGPRESDFVVRDLSTVVTSDFRQGELTNHGENPSSLITVESYCLS
FT                   VNLRLRWEILDLVEGLMNAMSTVTLESTASDEVPQNTVVEQKALQVVLGTDSGALTVDG
FT                   INLKLALVGEAIRSSIIWTPLDHKSASASLLISSKSSSLDLSNFSSAMVQWRFTEPHIY
FT                   CFRATETPAAEVQHDWKVAVSSRRMRFDMNDDPLSLAHIADRVIDDEIQFVNHLIQNLN
FT                   LPARRSQDKATSQRPPRHRFQVATFLDDYRLSFRILPSLEYAITGEVARASIISRLGPK
FT                   MEIDFDVKRNLHAFLSNDGGIRQPVSELGFPPINGRIIADISPNRTEMDVDVTIEIIEL
FT                   EASAVRTLLDVLTRPEVSHLISDLKQNMESLKLHFQEVLPFDIGSSQVRKSSDSVFLYR
FT                   ARTSMAGTKIHATAPGLNGKNYSADMEFSLGMIRMRLNNGLEAGYPTEYPEFQVDTSRI
FT                   SFDLSKKATHSADSYCSFAVDAKIKGTSVTDENGKTLQSFHLTSESCNIELYPEAAALV
FT                   VDVAAHLRERIKTLDLSHEVKRLKRLRYRVHSQTKTKTSDVPSFQVPDNGANGDDLFGA
FT                   IFSLGFNNIQVAWNMATFTQGVSHRRADDLVFSIRRVDLSNKKTTSAKLRIENVQLQMV
FT                   PVAGDRRTRSLNSASLPELVFNVAYSSTAEDVRVALQAAGKSLDIRATSDFILPANMIQ
FT                   NSIASAVKTIRDANSITVSKLSDDNTKPRSLFGNKRVRSVLVDVDFAGAIVSLQGKQSK
FT                   DQQSLLTATLKQKVAKESKYGQFVREDDTSTATLRAPGVALKVQFEDSAHEDSTLNAEL
FT                   KIDASTNVLFPSIVPLVRQMSATVKEVMGEQSKPRRPSNTMMLQSQRLMQDTPLDTSDP
FT                   ASVLGRCKLNVGLLICKQEFSLSCQPIARVAATVGFESVYVAINTVQADGDERFLALSV
FT                   SFNDFAASVKHVYSNESTASFEVNSIVMSLMNSRHLGKSKGISAALRVSPVQVMLNARQ
FT                   VQDLLLFREIWVPASDSPDPGAKVEAEPSETQAYIVQRYQQVASAPAFPWNTTIAIEKV
FT                   IIQLDMGSTLGKAQFAIEDLWLSSQKTSVREQVLCIGLKSIGINSKGRLSGLAEFQTIR
FT                   VRTSINWPEESSEIKTPLIQASISFNKLQVKVSFDYQPFLIAHIASFDFLMYNVGGSSD
FT                   EANERLFSILDGGEVQVFCTTLTASQSLALIQAWQRLMQDKQAAYESSLREIERYIRRK
FT                   GSIFSDRLESSQKATKQAEGETELTPISLQTGVVVTIHTIHIGVFPSTFFDNHVFKIEA
FT                   HEAQARFDVSLDKGKIHSALGLTLGQLRVALSPISRSEPVPVEKLLVAETATRVIETRG
FT                   GTILKVPRVVAGMETWQGPGSHQIEYLFRSSFEGKVDVGWNYSRISFIRDMWEAHSRAL
FT                   ASRLGKPLPPSAVRITGGLNAEGGGDKSDQQEKITAVVNVPQSKYNYVAIEPPVIETPQ
FT                   LRDMGEATPPLEWIGLQRDKLPNVTHQIIIVTLLEVAKEVEDAYAKILWSS"
FT   gene            516951..518530
FT                   /locus_tag="ANIA_06328"
FT                   /old_locus_tag="AN6328.4"
FT                   /product="DUF300 domain protein (AFU_orthologue;
FT                   AFUA_2G13512)"
FT   mRNA            join(516951..517892,517944..518302,518359..518530)
FT                   /locus_tag="ANIA_06328"
FT                   /old_locus_tag="AN6328.4"
FT                   /note="transcript_id=CADANIAT00006658"
FT   CDS_pept        join(516951..517892,517944..518302,518359..518530)
FT                   /locus_tag="ANIA_06328"
FT                   /old_locus_tag="AN6328.4"
FT                   /product="DUF300 domain protein (AFU_orthologue;
FT                   AFUA_2G13512)"
FT                   /note="transcript_id=CADANIAT00006658"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006658"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006658"
FT                   /db_xref="GOA:Q5AZF2"
FT                   /db_xref="InterPro:IPR005178"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZF2"
FT                   /protein_id="CBF69691.1"
FT                   /translation="MHGRPPVQHAWPLNHILSKVDISDPYTFLNVKRGILQYTWLKPVL
FT                   AIVSIVMKATDTYKEGYLGLSSGYLWTGILYNISVTISLYSLALFWVCLHHDLAPFRPV
FT                   PKFLCVKLIIFASYWQGFFLSILQWLGALPNGTGDYTPDNLAAAIQDSLTCFEMPVFAV
FT                   AHWYAFSWHDYADSTISAARLPVKYALRDAFGAKDLIEDTKMTMRGENYAYRLFDSGDH
FT                   IIPHAESNSRVRRVMHGMRYERGGKAKYWIPQPGEVNSRTPLLGGFDGSSGSRRNSTLD
FT                   RYRSHSESEETTLDDSDERLFSQARELEFGDFNYPVITANLVPRDQRLASPAPSRSTQQ
FT                   PTLVKKARKNRKSHASSSGRKTSEGHASRSSRQERSETSKLQRRGTDSPKSPGSHRSQL
FT                   VDLVVEDREAEEEERAQIQRAFGSVAVEDEPKHFQRPSGDPVDGGATKDAEGNAESTIK
FT                   QQRLGELEDEGTSPKTPAWDYRDLEEDNVWSR"
FT   gene            519568..521365
FT                   /locus_tag="ANIA_06327"
FT                   /old_locus_tag="AN6327.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(519568..519691,519759..521365)
FT                   /locus_tag="ANIA_06327"
FT                   /old_locus_tag="AN6327.4"
FT                   /note="transcript_id=CADANIAT00006659"
FT   CDS_pept        join(519568..519691,519759..521365)
FT                   /locus_tag="ANIA_06327"
FT                   /old_locus_tag="AN6327.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006659"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006659"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006659"
FT                   /db_xref="GOA:Q5AZF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZF3"
FT                   /protein_id="CBF69693.1"
FT                   /translation="MQEAIEQAGSVFTGWISTCLFCLDSNGDGERAHHQQAIKQRGAER
FT                   EMQICHSQPHLVPPMKLVVYDDLPSPGPPSPSSSFPSWIMDEGRNLVSRASIRASMSFR
FT                   RRSTAPLRISAPTDFRVVAGTSSTLPTRALSTAPAQRPYRPLELSFQDPANRLPELPRF
FT                   SDFNFDFGLDNDQPQAAAIARPPKAFSFMTDASYQSRPQTFISHTRQPSSSFSVPRKPV
FT                   GSGSRRSSLATLELLMERKTPNPTPTRHPLIPHFSVRSSTASVATGLATITFPSPSPPI
FT                   WLDSTVGVGSPPLSNNTPSRALQSHDATASASTIHKTLKPATSQSQYLTQSKSLPSFPI
FT                   RNKTYERVSSPVDTGMGIDVDTQHHPFSATMPMTTPNLSLPPSRSSRVTQWLLQQTTAI
FT                   STAPKTPTSAPPPTFPFAPPSSSSRKPSLSLSSSLSDKLSMRIRSRTLSGSTIAPSTPT
FT                   VPVPVPVPAGAKTTVVSDPPSPPSRATTATARTSTLDSRIEKEFEIPGPYSYASTYPFP
FT                   RQARSQTQSSTQPQFHPAPTIHEVQQQTNLNLDYYAYGHNHHPDNDHDHHRQSAIGVAF
FT                   "
FT   gene            complement(522374..525788)
FT                   /locus_tag="ANIA_10807"
FT                   /old_locus_tag="AN10807.4"
FT                   /product="KH domain protein (AFU_orthologue; AFUA_2G13490)"
FT   mRNA            complement(join(522374..523950,524003..524327,
FT                   524376..524837,524889..525170,525261..525788))
FT                   /locus_tag="ANIA_10807"
FT                   /old_locus_tag="AN10807.4"
FT                   /note="transcript_id=CADANIAT00006660"
FT   CDS_pept        complement(join(522536..523950,524003..524327,
FT                   524376..524837,524889..525170,525261..525788))
FT                   /locus_tag="ANIA_10807"
FT                   /old_locus_tag="AN10807.4"
FT                   /product="KH domain protein (AFU_orthologue; AFUA_2G13490)"
FT                   /note="transcript_id=CADANIAT00006660"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006660"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006660"
FT                   /db_xref="GOA:C8V115"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C8V115"
FT                   /protein_id="CBF69695.1"
FT                   /translation="MHKITNFTGQARHGWERMTPTFGMSRPHAELASHSLRRPHGAPPM
FT                   TPPTGIDPTVNLSFNVPFSSTLAGPDVDDVLHASPKALQRWSFPEGTPEGTPIHQLPVH
FT                   TSNVEALRILCRQITESSNGRVEALVSSSEPKTVPSLQRRPQRLATNVCITGDGETVRK
FT                   MRAKILNDTPILLRCATVDVDTHLITDNQTKEVRPPVLEHLDTLAAYTGTDIFLLTPKL
FT                   RDNDSAVVSSYGYATDNGLDQRFRVCIYGDMESTEHAKTRVLIMIDQILKRHVDAVKLD
FT                   LTTHTLVCGRTRKNIKLIEAATGTAIYFPPPFPRIFGYIPPGAHRRSEDEVYITGETQE
FT                   QIARAKQKLHELVMGVKVYVKDVVVNSNKIDNILLDRLDKVRKVMEMNGSYVLFPQLGS
FT                   QRGIVRIQGTDVLHVERTVREIMALAGQFYSASWWILVPDPTPGAVRTPTHAEVRTMLS
FT                   DICTNSGAEVSFDNLNFTINGSDDAVKAAMTVINQIPFVQRSQYQMRVKIELANEHKEF
FT                   VSGKKNGKINKIMGQSNVQIIFDGFNEYNFYIDVCGNQFESTKSGLDLVEQEMPASISF
FT                   HVPDQYHKRIIGIGGQHIQRIMKKYSVFVKFSNAMDRGGMGKDDDDIKVDNVICRTPAR
FT                   NAQSLDLVKQEIMDMVEKVDAEYVSERVVINRLYHRELLARMPEIDELEKKWNCKIEFP
FT                   STELASDVVTISGPEYQVPQAVDALLGMVPESHELLFQSSPELREFFRGADFREDVCAK
FT                   LKDQYEVDTTVDIPDVQATENGSDSPAFPPEDRVILGYTRNNAGGLKDAIDFLISRLVA
FT                   HGLDATTVKGAIPRPKSDSFEESLPFFDSKLLQHAPTPIATDSPTRPSFTDETSERGSI
FT                   FERLRKPGSISSFSSFIGRKNHSASPASFFKHASSNASKASLVSMESRDSGYRNPWNDS
FT                   GVNLPEDDLPALGSSHSHSSSNGWPARFDTKFPFGTAPGDMTPKHELRASFDSGRPSTS
FT                   NSTSGYPAPIGPPR"
FT   gene            complement(527759..530207)
FT                   /locus_tag="ANIA_10799"
FT                   /old_locus_tag="AN10799.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(527759..530207)
FT                   /locus_tag="ANIA_10799"
FT                   /old_locus_tag="AN10799.4"
FT                   /note="transcript_id=CADANIAT00006661"
FT   CDS_pept        complement(527799..530207)
FT                   /locus_tag="ANIA_10799"
FT                   /old_locus_tag="AN10799.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006661"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006661"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006661"
FT                   /db_xref="GOA:C8V116"
FT                   /db_xref="UniProtKB/TrEMBL:C8V116"
FT                   /protein_id="CBF69697.1"
FT                   /translation="MAATQLPARSAGHKLSTAEEIKEYEKILKISEDIFSGTHPRLKVP
FT                   QQFVRKGVSRNPPAPTTPQNKADKKEVSPSKAASHHIASTVKPVGSPRTNFTNGPSNTT
FT                   ASRILPNPASEIDPIFLEKSEDLVRAELQLQRQRVEREIREQVELKRQESKQKVSIQDA
FT                   TPDFDVSEVLTRAHEIVKPSPAPETAAPSDSIDENSFYSSRAPDSPQHGDHKSSSASSS
FT                   VPGELGTGAIGRRYSDELHRLEALNRPDSDQSMQDTYSIAEPRPSSQRQPHYSETYRTH
FT                   MRQPAEPSDEPEYSPPAPGVAPMERVETYEPPRAVPNGPKRQVVDPRDRYDRRSISPAD
FT                   GVRVVRNHITSPAAPQPSRVSPLAIAKVPSVNQHHESRSEYEPERRGSPEVPAQLPVPR
FT                   KRRRLHDDRPVYKTQGGGSVKPFIKEEPVSPPPFADTPPLYRPRAQEGPVYIDVPSPRY
FT                   TPVVDRREPALRTSGYGMEPYDEALGDQVIPRTASRLAAQRPMRDDQDLRRVASLHQAR
FT                   KPEWGREYAEPQGPHPARNGPYTIVERLPQQDGARYYDELAPRRYASPLPPQYPESYYN
FT                   DYVVQSPPRRIVIDEHGNQYYETIPAPKMSAMPPPATRIPRADLYEAPPPMRQASVRAA
FT                   SVVEDPYSGRRFVQELPQGYRRVTDYARPPPTDRRPYAAPFEVREPYPRSSSVQVHDYA
FT                   ARPSHYAEEAELPRERVVRIPSVRPPTTRYQEPREVIQRVESVHPGGRDTSVYVDDEMR
FT                   RPREYIERPVQYVAARPMARENRYYENGEPERVVLDGPRDVIHRVPQRY"
FT   gene            530802..531907
FT                   /locus_tag="ANIA_06325"
FT                   /old_locus_tag="AN6325.4"
FT                   /product="pyrimidine 5'-nucleotidase, putative
FT                   (AFU_orthologue; AFUA_2G13470)"
FT   mRNA            join(530802..530846,531054..531516,531576..531907)
FT                   /locus_tag="ANIA_06325"
FT                   /old_locus_tag="AN6325.4"
FT                   /note="transcript_id=CADANIAT00006662"
FT   CDS_pept        join(530802..530846,531054..531516,531576..531739)
FT                   /locus_tag="ANIA_06325"
FT                   /old_locus_tag="AN6325.4"
FT                   /product="pyrimidine 5'-nucleotidase, putative
FT                   (AFU_orthologue; AFUA_2G13470)"
FT                   /note="transcript_id=CADANIAT00006662"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006662"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006662"
FT                   /db_xref="GOA:Q5AZF5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZF5"
FT                   /protein_id="CBF69699.1"
FT                   /translation="MTDTRPVFFFDIDNCKSGVNPLTPSRADRFFVHHLSLNSEDAHML
FT                   HMKYYKEYGLAIEGLTRHHKIDPLEFNRLVDDALPLDNILKPDPKLRQLLEDIDRDKVK
FT                   LWLLTNAYVNHGKRVVKLLQVDDLFEGITYCDYANPPLICKPSQLMYDKAEKDAGATDK
FT                   SQCYFVDDSGLNCKAAAARGWQVAHLVEPGLPVPETPASQFQIRSLEELRTCFPQLFKK
FT                   S"
FT   gene            complement(531971..533830)
FT                   /locus_tag="ANIA_06324"
FT                   /old_locus_tag="AN6324.4"
FT                   /product="alpha-amylase, putative (AFU_orthologue;
FT                   AFUA_2G13460)"
FT   mRNA            complement(join(531971..532602,532665..532716,
FT                   532776..533672,533732..533830))
FT                   /locus_tag="ANIA_06324"
FT                   /old_locus_tag="AN6324.4"
FT                   /note="transcript_id=CADANIAT00006663"
FT   CDS_pept        complement(join(531971..532602,532665..532716,
FT                   532776..533672,533732..533830))
FT                   /locus_tag="ANIA_06324"
FT                   /old_locus_tag="AN6324.4"
FT                   /product="alpha-amylase, putative (AFU_orthologue;
FT                   AFUA_2G13460)"
FT                   /note="transcript_id=CADANIAT00006663"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006663"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006663"
FT                   /db_xref="GOA:Q5AZF6"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013777"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR015340"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZF6"
FT                   /protein_id="CBF69701.1"
FT                   /translation="MRRLTCLSAFFLASASVAVASPSAEQWAERSIYQVMTDRFARPAG
FT                   SPGDKPCDPYRYCGGSWTGVIDKLDYIQDLGFTAVQISPVVENIPDNTVYGEAYHGYWP
FT                   QNMYALNEHFGTADELRKLSKELHKRGMYLMVDVVINDMAQAVNSSLDSGSNINWSRLI
FT                   PFNDKKYYHPFCRIEDWNNPDESKNCWFSTEVVALPDLKTEDESVVSMIEIWVKGLVGN
FT                   YSIDGLRVDATKHMDEAYLTSFSEAAGVFTMGEVYTEDTDAVCKYEEVLSGLLNYPMYR
FT                   PMVQAFTAGNMPGLAENVRAVNSKCKDFTRLATFTENHDTPRFASLINDTTLARNAMAF
FT                   NILSDGIPVVYQGQEQHMKGPYAPYNREPLWKTSYNTNGSLYKTTSTLNKLRNHAIRLD
FT                   KHYVSSHSEELYLDGSTYVTRKGSEGSQIVSVFSNQGSQGGPYNLRIPRAYKPGTEVIE
FT                   VLSCKRVTADNEGQLVAKMDKGEPKAFFPVKKMNGSGLCGFKGRRGRKGAICSSAGKGN
FT                   GTRKNDTVNEGTVEQTSAGNGASVTIPMVLLSICVGLAGLFL"
FT   gene            534612..538683
FT                   /locus_tag="ANIA_06323"
FT                   /old_locus_tag="AN6323.4"
FT                   /product="P150 dynactin NUDM
FT                   [Source:UniProtKB/TrEMBL;Acc:Q8J0T2]"
FT   mRNA            join(534612..534827,535096..538683)
FT                   /locus_tag="ANIA_06323"
FT                   /old_locus_tag="AN6323.4"
FT                   /note="transcript_id=CADANIAT00006664"
FT   CDS_pept        join(534612..534827,535096..538683)
FT                   /locus_tag="ANIA_06323"
FT                   /old_locus_tag="AN6323.4"
FT                   /product="P150 dynactin NUDM
FT                   [Source:UniProtKB/TrEMBL;Acc:Q8J0T2]"
FT                   /note="transcript_id=CADANIAT00006664"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006664"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006664"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR022157"
FT                   /db_xref="InterPro:IPR036859"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZF7"
FT                   /protein_id="CBF69703.1"
FT                   /translation="MAELTIGSVIALTDGRQATVRFIGATSFADGEWIGVELTDDTGKN
FT                   DGSVQGERYFDCEPGFGMFVRPTAVASTPSKSPTKQLTSATPASRPSISGSSRPSVAAP
FT                   KPRPTTTKPSMGPPTQSTTSRAARTSLSGPGNKTNRQSLQGTAGTTSSGLSKRPTLRPT
FT                   PTTRTSEEPSPATEGSETLSNDVEGDIEEDLGPQPAHPARTSSSRLLSGQSASPRQSQN
FT                   MAINRELDELRTKLKVMEKKRVEDREKLKDMEALQADRDKLRGIIHTLQVKYKPHERNL
FT                   AELEAKLKEAEARVEELEKLIAEHESLMEIASLDREMAVEMADAHKLECETLKLRVEEL
FT                   ELEVEVLREENEEFGQTMSPEEKSSHGWLQMEKTNERLREALIRLRDMTQQQEAELKDQ
FT                   IKELQQDLEDYAAIRSKYEATKEKLMKSESNLQEVRERLETVEGNEQLVEEMVEKNADL
FT                   EQQIAQLKADISDLEVLKEINDELEWNHVETEKQLQEEIEYRETLYNDQVHKISQQDEV
FT                   IEDLEYTLTRFRELVSNLQADLEDMRASQQITEAEATDLTARSRAMMDLNLKLQSSVAK
FT                   AQTKTIDIELKRIEAEEDSQHLSIVKLYLPEYYENERNSVLALLRFRRVRSKASLMGST
FT                   IEGMISEQASVPPALEDIFNAPDVLEKLLWIDSICGRFGSYIANCSAESFSDIQGAFYE
FT                   LEPVERTLNFWLEGLKKNEINMKKCAVELQRSIALLSHLAETLLPTSLETFADELCMST
FT                   TLTQSYIENSVSSMSRLLSLLQSKLPKAEEGDEEASFLFNKMEGFISQARSLKVATVKI
FT                   NRAVDDLRSRSLALSHDACGPFKQAENAAKDLASLSRQMGENIVQLISDDSRAEPISLQ
FT                   EVLTNMSQISALYQSEAAENNDGMSLIFTMLRSLSGTLEELGSISSDLSITSEFEKRPS
FT                   PWIARAAELKSNKANSPDAEEEIRRLKNEIHEASTALGVKDKTIEEQAIKVELVESRMR
FT                   EASKKAAAVRDLEAKIQEMTTKESALQAVVENQRKDLQNLEAERDEIKAQLDRVKRLSG
FT                   TAGAAASPGTVVDNAASLAAMQENEALRAEIASLQSAVRFLREENRRQTILDPYSVQRS
FT                   SELYAWLDAPLTKKPVPPAQREKIQQTASESRDVLSHLLKLTKESSIADLKASRPNSGT
FT                   ASGWRTSKEKLKYQVLQQRENFERWAEWKNEVVGLEREQDRLVAAKQERAARGGRAGGR
FT                   GHASHPSMGYGMMGRAWQILGMPPDRKANAVQPVEPAIEPTF"
FT   gene            complement(539249..541057)
FT                   /locus_tag="ANIA_06322"
FT                   /old_locus_tag="AN6322.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(539249..540070,540124..540267,
FT                   540332..540877,540941..541057))
FT                   /locus_tag="ANIA_06322"
FT                   /old_locus_tag="AN6322.4"
FT                   /note="transcript_id=CADANIAT00006665"
FT   CDS_pept        complement(join(539249..540070,540124..540267,
FT                   540332..540877,540941..541000))
FT                   /locus_tag="ANIA_06322"
FT                   /old_locus_tag="AN6322.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006665"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006665"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006665"
FT                   /db_xref="GOA:C8V168"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8V168"
FT                   /protein_id="CBF69705.1"
FT                   /translation="MVHRGKLSAACGPCRSRRLKCDHKRPSCSQCIRAKRECSGYRDIS
FT                   SRRFFDQTEEVKRKNSPSFSSSSSPSTASALTSSSHSSQLPPRQQISSPSNPCLQHQVS
FT                   IPLRDQGAAFALSRYLNRSVGNGLPSILNTPSARAATASINAVGLAALSNIHQSPQLMF
FT                   TARQEYGSALAETNAALSDPRQATSDASLIAVTFLGIFEIMVCDGTSLMGKFVKHMDGC
FT                   SRIIQLRGSQQLEDPIGVGLFTLSRRNIVLGNFWLKRSTPPWLVQWSHEAFPYRHEGDD
FT                   MGTDDALFLLMSRVGDLCASLKNGVLIEPAKLVKRALKLDAELAAWAKSFKLTRDYTVV
FT                   TVPEPVGEITGHGKNISPFRHIYSNHYHIYPDTVISACWNDYRFVHLLLLGVLGWIAGH
FT                   LSDKEEIDATRRSEYRETVGYSTMLSQQLSDDVCASVPYHFGATETSFQEDWSSSRTGG
FT                   MIRLLWPLFLAAERDAVTQETRDWIANTLFKIGYGAGIRQALVMSNLLRSGSPLSWLPE
FT                   LARMES"
FT   gene            complement(542511..543954)
FT                   /locus_tag="ANIA_06321"
FT                   /old_locus_tag="AN6321.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            complement(join(542511..542742,542770..542989,
FT                   543058..543401,543518..543954))
FT                   /locus_tag="ANIA_06321"
FT                   /old_locus_tag="AN6321.4"
FT                   /note="transcript_id=CADANIAT00006666"
FT   CDS_pept        complement(join(542511..542742,542770..542989,
FT                   543058..543401,543518..543954))
FT                   /locus_tag="ANIA_06321"
FT                   /old_locus_tag="AN6321.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006666"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006666"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006666"
FT                   /db_xref="GOA:C8V169"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8V169"
FT                   /protein_id="CBF69707.1"
FT                   /translation="MSAVLLGKRYVSTPDPENIKAVLATKFVDFDLGERNAAFRPLLET
FT                   GVFTQDGREWERSRALLRPIFNRAQALPDLLLIEEHVQSRLYRIPRGYDIVNLQQLVRD
FT                   LTLDSAFIHFLAGRPRSQEAGEETSTLNRSVTHSTRPGLISRSPAHENRGKLGRGCGNE
FT                   SESEGWYDLLSKVADTVSDGVQIRSQLLHVLLAARDTTARLLSSVFYMLARHPSVWRKL
FT                   EREVLVEFGLATQGDGKCPLPTYTQLREMKYVRAVLNEGCTRPTFSPPPPPSSPYEHPV
FT                   RNTTHIPPARRRRRRMPAYIRGQEGDRALFYRTMQRFTEIYGDDAEQFRPERWVPLRRG
FT                   WGFLPFSGGPRICLGQQKALTEAVYVVVRMVQTFCDIEARDERPWREQMGLVLSSYYGV
FT                   KVGLKSRNGGS"
FT   gene            545822..550018
FT                   /locus_tag="ANIA_06320"
FT                   /old_locus_tag="AN6320.4"
FT                   /product="Fatty acid oxygenasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5AZG0]"
FT   mRNA            join(545822..546025,546318..546426,546483..546593,
FT                   546709..547311,547389..547559,547811..547846,
FT                   547912..548116,548164..548733,548798..549281,
FT                   549346..549470,549525..549922,549975..550018)
FT                   /locus_tag="ANIA_06320"
FT                   /old_locus_tag="AN6320.4"
FT                   /note="transcript_id=CADANIAT00006667"
FT   CDS_pept        join(545822..546025,546318..546426,546483..546593,
FT                   546709..547311,547389..547559,547811..547846,
FT                   547912..548116,548164..548733,548798..549281,
FT                   549346..549470,549525..549922,549975..550018)
FT                   /locus_tag="ANIA_06320"
FT                   /old_locus_tag="AN6320.4"
FT                   /product="Fatty acid oxygenasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5AZG0]"
FT                   /note="transcript_id=CADANIAT00006667"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006667"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006667"
FT                   /db_xref="GOA:Q5AZG0"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019791"
FT                   /db_xref="InterPro:IPR034812"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="InterPro:IPR037120"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZG0"
FT                   /protein_id="CBF69709.1"
FT                   /translation="MAPFMQNGSDADDLSSSKSKQSTLTSLLSSVHADLLSQAHRIPAD
FT                   IRTLRELSQAGLQGGLIDDKKYLNIMYPHLGASGSHYARTVTPKHPRPAVLPDPGLIFD
FT                   SLLAREGPAKEHPAEISSNLFYFAIIIIHGDFQFRSYTEQTQVRTFTDGLLKPDTFAEK
FT                   RLLSQPPGVCALLVAFNRFHNYVVTELARINEAGRFDLPTGGQEKSPDYVWALQKRDED
FT                   LFQTGRLYIIPSSSNTTTDIDKANACMGNRVTCGLYVSIILNDYLRTILNLNDNPTNSD
FT                   WKLDPRKNLSVFDSEGLPRGVGNQVSAEFNMIYRWHATTSNEDEKWLNELSIRVFGSKV
FT                   DPSTLSVQRYLNGLHEYLGKTAPGEPNTWTFGDLNRGKDGMFADKDLVKLLHDGCEKVA
FT                   ADVNSDPKVAEALEALYGHPDNIELYVGVQAEEAKKPFLPGAGLCPGFTISFAILSDAV
FT                   ALVRGDRFYTVDYSPVNLTNFGFNTAESDPDVANGGVMYKLLMRAFPGWYEPNNVYALY
FT                   PFTIPAKNKEVFEKYGRADTLEFKRPEYTRPPVAITSWKGVVELLNNPKAFRVPCMLAY
FT                   LALRYHIQPWFIYPLTGWYEGNRNTFRLTKHDYMLSGDSVANSEQRTFMAERLYRVPDA
FT                   LEQVRRFYESITADLIRRNSMRLGSSSCQIDIVRDVCNLAHAYFCSEFFNIPLKPKDGH
FT                   NGNGSGNKHLETTDAYTPKELAEALFAQFAYVFLDIDPVQSRKNRVVAYRETQRMGDIM
FT                   TQVVSATSESGYGLASASGYLFNRPSWISGGKNSSGLSMNGYGPQLVKRLREGGKSVEE
FT                   VVWMIIPTAAAACATQATGWAQMLDLYLSDRYFTHWPAIQELARSDKPEAFEKLKRYAL
FT                   EGFRLSTPANGVLRNCNTATTTLKDGSATKSISKGDTVFADFASAGMDPDTFPNPEEIR
FT                   LDRPLQLYIHHGWGTHACLGRAIVTTAAAALLKIVGRLDGLRRANGMQGELFRKEVGGF
FT                   RMFLDEKGESWRVFPQNMKVVFDSLDGLKA"
FT   gene            550171..551880
FT                   /locus_tag="ANIA_06319"
FT                   /old_locus_tag="AN6319.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(550171..550739,550806..550883,550951..551268,
FT                   551338..551699,551790..551811,551844..551880)
FT                   /locus_tag="ANIA_06319"
FT                   /old_locus_tag="AN6319.4"
FT                   /note="transcript_id=CADANIAT00006668"
FT   CDS_pept        join(550231..550739,550806..550883,550951..551268,
FT                   551338..551699,551790..551811,551844..551880)
FT                   /locus_tag="ANIA_06319"
FT                   /old_locus_tag="AN6319.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006668"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006668"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006668"
FT                   /db_xref="GOA:C8V171"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8V171"
FT                   /protein_id="CBF69711.1"
FT                   /translation="MASYNPNPPPSTASATSSFLTIPHDIPSNPILLTAQDILTVLFLS
FT                   PLLPNMIYPLHPLASPLDELYPTYRNLRDLCLQIILLSSQISLLLSFPFAFITLWAIPC
FT                   LVHAVFYISFGIVTSLITWILNERPKWQGNRHDSLIGRPEGREAVNDTGISKEGEVWFF
FT                   INGIATGTHWHKSNLIMLANIFGREIIGIQNSTKGLLLDIAECLIQRDLNYTTHATRVG
FT                   RAQLHSALSSEHTKKVVLIAHSQGGIIASAILDWLHAELGDEELRKLEVYTFASAGRVL
FT                   RNPSRTKNGSKKEGKKGRALGSSNSSGSSHMTTNYIHNQHSHQNPPFNHFHGPVFIREG
FT                   SGHLLNMHYLDTMFSEESGFMDKLIDLPMDGGIVQRPLGDLSRLWKYRGGGSPDDGEYG
FT                   HGDGDKNKVDFKGPEGRGKDVFRVTTNWYKITPAKQLAKYTS"
FT   gene            complement(551995..558148)
FT                   /locus_tag="ANIA_06318"
FT                   /old_locus_tag="AN6318.4"
FT                   /product="Chitin synthasePutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:O13281]"
FT   mRNA            complement(join(551995..552026,552091..557315,
FT                   557371..557559,557616..558148))
FT                   /locus_tag="ANIA_06318"
FT                   /old_locus_tag="AN6318.4"
FT                   /note="transcript_id=CADANIAT00006669"
FT   CDS_pept        complement(join(551995..552026,552091..557315,
FT                   557371..557559,557616..557728))
FT                   /locus_tag="ANIA_06318"
FT                   /old_locus_tag="AN6318.4"
FT                   /product="Chitin synthasePutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:O13281]"
FT                   /note="transcript_id=CADANIAT00006669"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006669"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006669"
FT                   /db_xref="GOA:G5EB74"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036037"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB74"
FT                   /protein_id="CBF69713.1"
FT                   /translation="MVGTLPAGHTPSHVQSSLPSLPAHLQSDTHLTAHLASRFHVGLPT
FT                   ARLSSHALISLNNYTSSSKGPDGGKEGSAMGETEDLARRAYTRLGARGENQAIVFLGES
FT                   GAGKTTLRSHLLSSFLSFSSTPLSSKLSYAAFIFDTLTTTKSLTTPTASKAGLFLELQY
FT                   DASSSVNPTLIGGKIIDHRLERSRIASVPTGERSFHVLYYLLAGTSAAEKAHLGLDSPI
FT                   HVTTAGGRLSSADHKRWRYLGHPTQLKVGINDADGFQHFKTALRKLEFPRSEIAEICQI
FT                   LAAILHIGQLDFGSGQATLTGAEESGGYSHEGGETVTVVKNKDVLSIIAAFLGLGVGEL
FT                   EASFGYRTKTIHRERVTVMLDPKGARRSADELSRVLYSLLVAYVIENVNQRICAAEDSV
FT                   ANTVSIIDFPGFAQACSTGSTLDQLLNNAACESLYNFCLRSFFDRKADMLEREEVAVPA
FT                   TSYFDNTDAVRGLLKQGNGLLSILDDQTRRGRTDAQFVEAVRRRFENKNPAITAGASGS
FT                   GNGYGMVSQNARSSFTVKHFAGEVDYSATGLLEENGEVISGDLMNLMKSTRSDFVRELF
FT                   GQEALQTVAHPKEKTAIMQAQVSSKPLRMPSMARRKTSPASRLTFDATPAEDPYETESQ
FT                   TGSSAKNSSAKRKSGMLMGGMQCAAGQFLSSLDIVNKCLTSGNLNPYFVFCLKPNDRRI
FT                   ANQFDSKCVRTQIQTLGIAEISQRLRNADFSVFLPFAEFLGLAEVGNVVVGSDKEKSEV
FT                   VLDEKRWPGNEARVGSTGVFLSERCWADLAKVGERVIPSFAAEDDGGDALLHPRTANYA
FT                   DSKVRLLNPSDHSPGAYIYGDESKQASNTSRDFDGRSDAGYSAFNSGDMFHNLETREQM
FT                   LEKGNEKQMEEVDEVPVSGSRKRWMAIVWLLTFYIPTPAIRYIGRMKRKDIQIAWREKF
FT                   AINLLIWLACAIAVFIIVGFPSLICPTQHVYSPAELSSHDGKDGHSSYTSIRGLVLDLG
FT                   EFMDSHYPGIVPDSALKKYAGVDSTALFPVQVSALCLGKDGNVDPKVLLDYKPTNFSGS
FT                   VTSTSSGDPNSVYHDFRYFRDDYRPDWYAEQMIYLRANYYKGWIGYSSEYLHTLASKSQ
FT                   NVASINGKIYDLTSYIAGGRRIQGREGDDTTGIDTDFMDSLVVDLFQQKAGEDITKYWE
FT                   DLPLTPKLRVDMMDCLNNLFIVGHVDTRNSTQCQFARYFILAISVLICSVIVFKFFAAL
FT                   QFGKKNVPENLDKFIICQVPAYTEDEESLRRAIDSMARMQYDDKRKLLVVICDGMIIGQ
FT                   GNDRPTPRIVLDILGVPESVDPEPLSFESLGEGMKQHNMGKVYSGLYEVQGHIVPFLVV
FT                   VKVGKPSEVSRPGNRGKRDSQMVLMRFLNRVHYNLPMSPMELEMHHHIRNIIGVNPTFY
FT                   EFILQVDADTVVAPDAATRMVSSCLNDTRIIGVCGETSLTNAKTSAVTMIQVYEYYISH
FT                   NLTKAFESLFGSITCLPGCFTMYRIRSAESGKPLFVSKEIVEAYSEIRVDTLHMKNLLH
FT                   LGEDRYLTTLLLKHHPKFKTKYNFRAQAYTIAPESWTVFLSQRRRWINSTVHNLVELIP
FT                   LQQLCGFCCFSMRFVVFIDLISTIIMPVTVAYIVYLIVWLVRDTSTIPWTSFLLLAAIY
FT                   GLQAIIFIVRRKWEMIGWMIIYILAIPVYSLALPLYSFWHMDDFSWGNTRIITGEKGRK
FT                   IVISDEGKFDPASIPKKRWEEYQAELWEAQTSRDDRSEISGISYGTKYHPATQSEYGFP
FT                   GSRPMSQLELPRHMSRMSLAPSEMMSRHMDMELEDVNLPSDDAILSEIRDILRTADLMT
FT                   VTKKNIKQELERRFGVNLDAKRPYINSATEAVLSGNL"
FT   gene            560251..565619
FT                   /locus_tag="ANIA_06317"
FT                   /old_locus_tag="AN6317.4"
FT                   /product="Chitin synthase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q2L6A0]"
FT   mRNA            join(560251..560537,560585..564139,564186..565465,
FT                   565522..565619)
FT                   /locus_tag="ANIA_06317"
FT                   /old_locus_tag="AN6317.4"
FT                   /note="transcript_id=CADANIAT00006670"
FT   CDS_pept        join(560251..560537,560585..564139,564186..565465,
FT                   565522..565619)
FT                   /locus_tag="ANIA_06317"
FT                   /old_locus_tag="AN6317.4"
FT                   /product="Chitin synthase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q2L6A0]"
FT                   /note="transcript_id=CADANIAT00006670"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006670"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006670"
FT                   /db_xref="GOA:C8V173"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:C8V173"
FT                   /protein_id="CBF69715.1"
FT                   /translation="MSNRFSVYSTQSAGLPGGRPSNQLSTTTLLNALHAHYTSGLPYQL
FT                   DAGTSVVVNNWLTAAQTGADGHNGGTFDRELAARAWEHARRRAEDGCIVLSSTHQSTPS
FT                   IFEPFLTTLPLSTPSVTFTALSALKPFLRAVTAFNPSYSLYSALSANFTFTLKGDLVAL
FT                   TLALSTSGLNVQKGLLDIPTEPGYRAFDVFYYLLTTTSTQAEREFLALREPSAYALLNK
FT                   SGTYDPPSYIPTADDAAAAEDFRAALKAIGIKGASLRNLLSVLAGLLKLGNAAGFLVDE
FT                   EELEQTCEDVGDLLGVDPEILLHKCATDERELLITGIYEALVDWVISKANEAIAGELEE
FT                   LNANGSGEHWNDDDTVSISVVDIPRPAFGKAVALRNVFDDSLGINAEMKEDGIPAPPVG
FT                   QAILNEMAAAVEQFGPDLGISTDPTKEYELDKRQGVLEKVGIDLDADSFLRQILIPVES
FT                   QGIAVGKKGRFDLASTLGSSRVWHHISVHPSDDLPGALNTSAPTAAWTASAVSRQIREW
FT                   RLVEWANRRLKQFDFTADFDVDEFVNRYSRLGCADGRDGVESWLMERGWTNGDAFVGHQ
FT                   RIWMRENAWWEAETMIDLKADEPPSTHSYFSNSMLDPHSGGTPMAESASLLGGSQSNLL
FT                   HRQSAMAPSVMAKSIAPSVPPTMNMAGDYGLGSKGDDKKWDNIYYDGDAEGGDRKHLEK
FT                   DEITLGRRVWTAFVWALTFWIPSFVLRYVGRMKRPDVRIAWREKVVLVLLILLFNGIVC
FT                   FYIIAFGDLLCPGKDKVWNEKEVSWRSTSSNFYVSIHGYVYDITKFAKVTHGDTSPEAT
FT                   PSLMEPLAGKVLDAYFPPPLTRMCGNYVNDLAINLQNNDTSATEDQPLAVHKSGPRNRP
FT                   DTTTKLHNITWYEQDFLPKINEYYKGKLVWSKDTVKKQAESSSERKWVIAHNKIYDLTD
FT                   YFYTLDMMNSESSYDWLPSAITDLVKNNPGQDVSDKWPLMSSPFREAQSCLDYVFYKGD
FT                   TDFRDGPRCTVNNWILLAFTILICAVVLVKFLAALQLGSKRRPAPQDKFVICMVPAYTE
FT                   GEDSLRKGLDSLTALQYDNKRKLIFVICDGMIVGGGNDRPTPKIVLDILGVDPKIDPPA
FT                   LPVKSIGQGNEQLNYGKVYSGLYEYEGNVVPYVVVVKVGKESEQNKSKPGNRGKRDSQV
FT                   LLLNFLSRVHHRAPMSPLELEVFHQINNVIGVDPELYEYCLMVDADTSVREDSLNRLVA
FT                   ACANDARIAGICGETSLQNEERSWWTMIQVYEYFISHHLAKAFESLFGSVTCLPGCFCM
FT                   YRLRTADRGRPLIISEKLLEEYSDNNVDTLHKKNLLALGEDRYLTTLMTKHFPTMSYKF
FT                   IPDAFASTAAPETWSVLLSQRRRWINSTIHNLVELAALKDLCGFCCFSMRFVVMVDLLG
FT                   TIILPATCVYLGYLIYRVASDTGPFPMISIVMLAGIYGLQAIIFIIKRQWQHIGWMIIY
FT                   LCAYPIYSFILPLYSFWKQDDFSWGNTRVVIEEKGSKRIVAVEDEQFDPRSIPLQRWDD
FT                   YALANNLPGRRGDYAVGQEKAFYGGRYMDDTAMEMDDMHSQYSSVKPASTILTGFPGQG
FT                   RHSYMPPQSPAPFGGNVPGNRNSHFSTFSRYTDQPLQSNSHLQTRHMSMGNLSQLESSG
FT                   MTNRHSVGMMQSTDNLLRPNSRSPVGFNSRPASAFDFRAGMNGPDEGAITEAIRSCLAE
FT                   VDLDTVTKKQVRALVEQRLQTTLVGDKRTFLDRQIDNELANM"
FT   gene            complement(565896..570074)
FT                   /locus_tag="ANIA_06316"
FT                   /old_locus_tag="AN6316.4"
FT                   /product="ATP-binding protein (Eurofung)"
FT   mRNA            complement(join(565896..566589,566903..569693,
FT                   569749..569835,569891..569972,570042..570074))
FT                   /locus_tag="ANIA_06316"
FT                   /old_locus_tag="AN6316.4"
FT                   /note="transcript_id=CADANIAT00006671"
FT   CDS_pept        complement(join(565896..566589,566903..569693,
FT                   569749..569835,569891..569972,570042..570074))
FT                   /locus_tag="ANIA_06316"
FT                   /old_locus_tag="AN6316.4"
FT                   /product="ATP-binding protein (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006671"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006671"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006671"
FT                   /db_xref="GOA:Q5AZG4"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR009395"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZG4"
FT                   /protein_id="CBF69717.1"
FT                   /translation="MATIKAIEARSSGQVIVDLTSVIKELVENSLDAGATSIEVRFRNS
FT                   GLDLIEVQDNGSGIAPENYENVALKHYTSKLSSYDDLLHLQTFGFRGEALSSLCALSDF
FT                   RITTAQANQAPRATRLEFEQSGKLRKTEVVAGQKGTVASVESLFRKLPVRRRELEKNIK
FT                   REYGKVLNLLHAYACISTGVRFTIKNTQAKKTVVVFATNGNPTTKENIANVYGAKTLLA
FT                   LIPLDLELQFEPSVAETMMAGDKKSNIQVRGHISRPVFGEGRQTPDRQMLFVNSRPCAL
FT                   PQITKAINEVYKSFNLAQSPFVFADFHMDTNAYDVNVSPDKRTILLHDAGALIESLKQS
FT                   LQKLFESADQTVPQSQILGKLPLARQRSLPETTRSDRAMEQEASDRDEREGGSQPNPQD
FT                   RMKGLLGNIRTRDTPPDETLPRRTLSQQHFSPASSSPAPVQEPQDTADDRISDDDLFVS
FT                   QTPSQAGTELQDVQHDAPASHSRELIPDFETPNTIQNAFDRMRPRRLPAEMATITIGNR
FT                   TVTSMVGSGVPRKRNTSDSPTLPPRKRRIHTPSRPSIFGRMQDFAAPGSQMSTHDSDEQ
FT                   ESFEDEDEEEVEESDGVHEDLEAEAGKETESEVEDQVEEEVEEAESFVPSDDNATQSDE
FT                   HTQTEPQPAKEDMNAEEKKRREDAEVQRLIEEAGKANQANSISRANKLHKGVSYRDSTV
FT                   HLATAINASLSRIESQAKYIHDSHSRRNLSSSEDELDESRLSQVAPEERLTLTVNKDDF
FT                   ARMRIHGQFNLGFILASRTTSTSHRAESDPASGLGFKDELFIIDQHASDEKINFERLQS
FT                   TTTVQNQRLVHPKRLDLTAVEEEIVIENQVILEKNGFVVDVDDSGDKPIGQRCSLLSLP
FT                   LSKEVVFDVRDLEELIAILTETSTPNTTGPEIDIPRPSKVRKMFAMRACRSSIMIGKTL
FT                   TQRQMERVVRDMGTIDKPWNCPHGRPTMRHLFSLGRWEVWDEYADIHNASREDGDLLDP
FT                   VDDLNAWRENHPESKMSPTSPAIIADPQSAPQNPTATSTSASNSNANTGQDPVSDTLDP
FT                   RTLATSAFTASLHSLGQNYTSALVDRAQNLHSNSQALKNQEAQLARHTESLRKQNDAWE
FT                   KVADEGRNALKEIGDVQNWAEMIERDLLVVEDVVGALERELEEEERRGSLDEDEEYRME
FT                   GAEGGIGRELDHGGSMANGVANVNVKMNGKVDRKDGEEDGNDKNGKGKQTPPEKKGWFS
FT                   WLW"
FT   gene            570424..572065
FT                   /locus_tag="ANIA_06315"
FT                   /old_locus_tag="AN6315.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(570424..570706,570999..571254,571306..572065)
FT                   /locus_tag="ANIA_06315"
FT                   /old_locus_tag="AN6315.4"
FT                   /note="transcript_id=CADANIAT00006672"
FT   CDS_pept        join(570424..570706,570999..571254,571306..572065)
FT                   /locus_tag="ANIA_06315"
FT                   /old_locus_tag="AN6315.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006672"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006672"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006672"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZG5"
FT                   /protein_id="CBF69719.1"
FT                   /translation="MGFEFVNNNTAIDSAARKRIRTHAAAGKNANRTLTRPSKAVALRR
FT                   NVAVPFRTPDTIRRLQRDSKAGAEIERPVTDGLQFLIPVPARSQGLVRQVRETTQGMYH
FT                   IARTYRIVQDRLMSEEEATSDMTIAILVAMSQYERLQGQYARGYVHVRGMRRMIELRGS
FT                   IKQFDSDCRGVIQKVLRADLEYALQLGSATLFGFEGIRFLRECKDICLDHGKEEKLVAN
FT                   PEVNSFLQAGLRLSLWSAFSDMRRLADLLNDAGAGYRRKLGADEFHNTILLLGYSLLYI
FT                   SPLDVSTGPGACSMLGISPLEEVVHLGLVAFLVTFLRGLNQRIPENPLLSYRLRLAIEK
FT                   LLSSVGGGEESKIIKRVLVWALFVGAVVVFKPSDDEWLIPTTNTAMNALGLSSWKDVKE
FT                   ALAGFPWVDAIHDRTGTVLCTTQKFLSFSTQID"
FT   gene            complement(572268..573218)
FT                   /locus_tag="ANIA_06314"
FT                   /old_locus_tag="AN6314.4"
FT                   /product="short-chain dehydrogenase/reductase family
FT                   protein, putative (AFU_orthologue; AFUA_3G01250)"
FT   mRNA            complement(join(572268..572565,572629..573218))
FT                   /locus_tag="ANIA_06314"
FT                   /old_locus_tag="AN6314.4"
FT                   /note="transcript_id=CADANIAT00006673"
FT   CDS_pept        complement(join(572268..572565,572629..573218))
FT                   /locus_tag="ANIA_06314"
FT                   /old_locus_tag="AN6314.4"
FT                   /product="short-chain dehydrogenase/reductase family
FT                   protein, putative (AFU_orthologue; AFUA_3G01250)"
FT                   /note="transcript_id=CADANIAT00006673"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006673"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006673"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZG6"
FT                   /protein_id="CBF69720.1"
FT                   /translation="MSHEVSTQPRDLPILATTESTAGKTYIVTGANTGLGFEAAKHFVR
FT                   LGAKRVILAVRSIPSGEAAKQKIDEATATTDVAEVWALDLSSYASVKTFAKRAITELDR
FT                   IDAVIENAAVATAEQTRAEGHGLSLTVNVLSTFLLAVLLLPKLKESAEKYGVLPHLSIV
FT                   TSGVGWDVRETWEKIREDPLVRMDELPSEQLMVTYPLSKLMDTLAVRELAARLPVEQGK
FT                   VVINSICPGLCKTELVRNCPPAQKQAIVEQHELYGRTAEDGSRTLLAGSVLGKESHGAY
FT                   TSNCEIRECVAPNL"
FT   gene            573652..573775
FT                   /locus_tag="ANIA_11507"
FT                   /old_locus_tag="AN11507.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(573652..573681,573755..573775)
FT                   /locus_tag="ANIA_11507"
FT                   /old_locus_tag="AN11507.4"
FT                   /note="transcript_id=CADANIAT00006674"
FT   CDS_pept        join(573652..573681,573755..573775)
FT                   /locus_tag="ANIA_11507"
FT                   /old_locus_tag="AN11507.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006674"
FT                   /db_xref="GOA:C8V177"
FT                   /db_xref="UniProtKB/TrEMBL:C8V177"
FT                   /protein_id="CBF69722.1"
FT                   /translation="MMLAAWAVLEYHDVRG"
FT   gene            complement(574082..575831)
FT                   /locus_tag="ANIA_10806"
FT                   /old_locus_tag="AN10806.4"
FT                   /product="YagE family protein (AFU_orthologue;
FT                   AFUA_2G12110)"
FT   mRNA            complement(join(574082..574313,574361..575831))
FT                   /locus_tag="ANIA_10806"
FT                   /old_locus_tag="AN10806.4"
FT                   /note="transcript_id=CADANIAT00006675"
FT   CDS_pept        complement(join(574237..574313,574361..575831))
FT                   /locus_tag="ANIA_10806"
FT                   /old_locus_tag="AN10806.4"
FT                   /product="YagE family protein (AFU_orthologue;
FT                   AFUA_2G12110)"
FT                   /note="transcript_id=CADANIAT00006675"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006675"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006675"
FT                   /db_xref="GOA:C8V178"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:C8V178"
FT                   /protein_id="CBF69724.1"
FT                   /translation="MASATESSPLLPQYHHAASSNTSPRGNRPPRTVTFNPLTTVSTYH
FT                   DSASADPKFKPLASGNSSLANSRPTGLSALNSKLRRRNSHGAPGSVASSYPASKIGPQR
FT                   TTKTAQKLKLLPDPITEEELVDEETSPSDVYRQIARIKEPAARSLAAKLGKADRDRLPR
FT                   VTAYCTANSYRLDGVFKFLKSRSKTRGANPKLFDECVYSRFDYQFEAKQKAGNHSNNVD
FT                   SENTHTVDRMPRERRFSDSAVEVNEDFGNRREELIDLHDRDSHQQNATEASVLDNAPDI
FT                   DTTIHAPEVFLFDYGTVVIWGMTPAQESRFLSDISKFATSILSPEDTQVENFNFYYARE
FT                   YQARIYNDFISLRDPRNYMIKLAISHALAQSVKTSLFEDLVSETISNTAPLPAQIAQTG
FT                   SVNLSRRQINMQVGELFILRINIHLQGSVLDSPELMWAEPQLEPVYQAVRSYLEMDQRV
FT                   SLLTERLDVIADLLAVLKDQLTHRHGEYLEWIVIVLIAAEILVAAINIVVDLYAGVE"
FT   gene            complement(576141..577446)
FT                   /locus_tag="ANIA_10798"
FT                   /old_locus_tag="AN10798.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(576141..576836,576892..577446))
FT                   /locus_tag="ANIA_10798"
FT                   /old_locus_tag="AN10798.4"
FT                   /note="transcript_id=CADANIAT00006676"
FT   CDS_pept        complement(join(576299..576836,576892..577433))
FT                   /locus_tag="ANIA_10798"
FT                   /old_locus_tag="AN10798.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006676"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006676"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006676"
FT                   /db_xref="GOA:C8V179"
FT                   /db_xref="InterPro:IPR013268"
FT                   /db_xref="UniProtKB/TrEMBL:C8V179"
FT                   /protein_id="CBF69726.1"
FT                   /translation="MLSQIVTAAKGILFPEQNSYGNSTTATTEPNETLPATKSKMVTTR
FT                   RSAAFQAVSPTEDAEMNGSPELSGKRKSDNSTLARSPETQGNKRRKRSSVETTEDMVKE
FT                   TNEDIGQEAAPKKHFRFDSEEPVLPDVAESEVPVDAQQKQLDEEDSSEDEAPETVDNST
FT                   QLNKIKLEAKKRDEARKIEEQAKREKRRQLDEARKQQAKASAKRKEVHTSQVMPGAGTP
FT                   AEDMLSESSATLQGSFTQDTRRSTLPALLPDDILNAVPDVRPPTPPPEFEVFSQKKPTK
FT                   LRFLEKKEKAPKDVRMGDVAIRVLDSESSRKQPNTALAPKASKASRGAREAWLKQARST
FT                   GHVNGMRMVSSGKRSFVRK"
FT   gene            complement(577821..578608)
FT                   /locus_tag="ANIA_06312"
FT                   /old_locus_tag="AN6312.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(577821..578384,578450..578608))
FT                   /locus_tag="ANIA_06312"
FT                   /old_locus_tag="AN6312.4"
FT                   /note="transcript_id=CADANIAT00006677"
FT   CDS_pept        complement(join(577821..578384,578450..578608))
FT                   /locus_tag="ANIA_06312"
FT                   /old_locus_tag="AN6312.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006677"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006677"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006677"
FT                   /db_xref="GOA:Q5AZG8"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR024637"
FT                   /db_xref="InterPro:IPR024638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZG8"
FT                   /protein_id="CBF69728.1"
FT                   /translation="MMADPFEVRMRFTAQLQHLNASITSSQKAAHYALKYRDMDEDLHS
FT                   CILEQLERNNMNNRANILYFIEQFCEMATKEDHLPYVHMIQRDILRVVDCVAPADGSGA
FT                   ANVKHVRRVLNGLQAKEVLSAETVAEIHAGLKDRETHPAHLDLEAEEEEEPGSKSKTGT
FT                   PRGMKANGIRVDKRQIEQRIEEDRERNKRLRESMWTVRGDDSDEHRKFWDETSDIGEDD
FT                   FTTAHEELMERNEMINAV"
FT   gene            complement(578972..581908)
FT                   /locus_tag="ANIA_06311"
FT                   /old_locus_tag="AN6311.4"
FT                   /product="ClC chloride ion channel (Eurofung)"
FT   mRNA            complement(join(578972..580450,580502..580660,
FT                   580811..580878,581181..581719,581772..581908))
FT                   /locus_tag="ANIA_06311"
FT                   /old_locus_tag="AN6311.4"
FT                   /note="transcript_id=CADANIAT00006678"
FT   CDS_pept        complement(join(578972..580450,580502..580660,
FT                   580811..580878,581181..581719,581772..581908))
FT                   /locus_tag="ANIA_06311"
FT                   /old_locus_tag="AN6311.4"
FT                   /product="ClC chloride ion channel (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006678"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006678"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006678"
FT                   /db_xref="GOA:Q5AZG9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZG9"
FT                   /protein_id="CBF69730.1"
FT                   /translation="MDSGPDFEVQQPSSEPSTNNPRLPRLRDNSLSQYTREPLSDGLRE
FT                   PISFKRKHKHRSGFSLSNLSNIFTTDSDGHSGPSRTASRNGLTTDIDPQPAGESSQRNG
FT                   NYNIQKEGGLLDWYVEGPGRRVGYDDFTAIDWIFEYTKERQRKRLLSASGKGMLGYARK
FT                   VFDASNVWFVLIATGISVGIIAASIDIVSDWLGDIKAGYCKNGPGGGKFYLNRSFCCWG
FT                   HEEVLGGFIIRHFMGPWTLAIKSLGLPKQQRRFSPVHAEETERELTFIARKREVLSAAA
FT                   AAGISVAFGAPIGGVLFSLEQLSYYFPDKAMWQSFVCAMVATVTLQALDPFRTGNIALY
FT                   EVKYTRGWHRFEMIPFVILGIVGGLYGAFLIRLNMRIAKWRKTRSFSHPIIEVVVVSIL
FT                   SALVNYPNIFMRAQNSELVHSLFAECSAGTPDHFGLCKTGAASAGTVALLLVAAVLGFF
FT                   LTTITFGLDIPAGIILPSFAIGALYGRALGTAFKIWQDSYPGFFLFGNCEPDIPCVTPG
FT                   LYAIVGAASALGGATRMTVSIVVIMFELTGALTYVIPIMIAVMLSKWCGDIFGKRGIYE
FT                   SWIQLNEYPFLDHREDTAPPDVPAHAVMTKTDDLTVLTAVGHTVGSLRNLLQTTSYRGF
FT                   PVVMEASNPVLLGYVSRNELSYALKNPTSPSGEELSSATPVFFAHQPFADPMDTLDLRP
FT                   WMDQTPITLNSGTTFLIVLRMFQRLGLRYVLFVNKGFLHGLLTKKDVWSVVNDPASREG
FT                   EWTSGPLGGNDTAEEIGLLQSDDALSIAPPLTPLDRRPSF"
FT   gene            582172..596992
FT                   /locus_tag="ANIA_06310"
FT                   /old_locus_tag="AN6310.4"
FT                   /product="midasin, putative (AFU_orthologue; AFUA_2G12150)"
FT   mRNA            join(582172..590121,590189..596992)
FT                   /locus_tag="ANIA_06310"
FT                   /old_locus_tag="AN6310.4"
FT                   /note="transcript_id=CADANIAT00006679"
FT   CDS_pept        join(582172..590121,590189..596992)
FT                   /locus_tag="ANIA_06310"
FT                   /old_locus_tag="AN6310.4"
FT                   /product="midasin, putative (AFU_orthologue; AFUA_2G12150)"
FT                   /note="transcript_id=CADANIAT00006679"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006679"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006679"
FT                   /db_xref="GOA:Q5AZH0"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR012099"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR040848"
FT                   /db_xref="InterPro:IPR041190"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZH0"
FT                   /protein_id="CBF69732.1"
FT                   /translation="MGASPAYEGTPNESQLLEQLPDGIAALIRTASGTQYLNALAVGAL
FT                   KSGFTEKFFYIYEPIFVDLAARWTLPESGVDQNEVISAFARILPLAPHLRSFASQYAIS
FT                   RAGPLSALAAPNASTNLDIDDFTISTLLLAIFRLLSFDVEAFSPAISPSQLQTFFRHED
FT                   KVIRYLAVRCFCLYMRAADASTERILWSHCGDDIVEGYWEGIKIDYRCLGLWEERRWEI
FT                   LEKQLRSIRATRSYSESLSRVEQLREFLTARTAEVSGVLIPRQVDTSLTPSAIVKTPTA
FT                   VSNLRRIAGALITPQPILLIGLPNSGKTSLINDVAGTMGQLESMVTLHLNEQTDAKSLL
FT                   GMYSTSPATGSFAWQPGVLTKAAREGRWILIEDLDRAPSEVIGLILPIIEKGELTIASR
FT                   RERIKCAEGFKIIATMKSSYNIAGEEVAPSTAILGSRLWNRVQIDPLTINEVQDVIAQK
FT                   FPLLERRVVTIMNVYQKLCSSFHGSLAIKSSQGRTPGLRDLIKLCSRMNKRLQRLGVKT
FT                   GYEATPEGIDDEIFLDVVDIFLKYLPDTTLSDSLALKVAEALHISPQRARFCLHERTPA
FT                   LLDQGNSLVLGREACRKIKVPSSSASKFASATSRFATTRAALKLMEQVAASVEMAEPVL
FT                   LVGETGIGKTTVIQHLATLMRQKLTVVNLSQQSESSDLLGGFKPVNIRTMAIPMFDEFN
FT                   SLFELTFSAKKNQKFLTSIAKNVASGNWVRLVNHWHEAVRLADGVFKSGNGASQPAEGE
FT                   QPTKKRKLDSPKYQLLRQRWERFAAQLNDFEAQVAQGDAKFAFAFVQGKIVRALRNGEW
FT                   VLLDEVNLASPDTLENIASLLHHGSEGSPSVLLSEAGDVERVFGHPDFRIFGAMNPATD
FT                   AGKKDLPPGLRSRFTELYVQSPDNELDDLLSLIKKYLGDLSLSDSRAAPDLAQLYMEAK
FT                   KLSNENKLTDGAGQRPHFSIRTLVRALIYAADHAQIYGLRRAIFEGFSMSFLTVLSRES
FT                   EALLMPLLEKHIFSNVKNIRALLGQTPRPPSDGHEHVQFKHYWMRRGHLVPEEQPHYII
FT                   TPFIEKNLKNLVRASSTRRFPVLLQGPTSAGKTSMIEYLAKVSGNKFVRINNHEHTDLQ
FT                   EYLGSYVSDDDGTLRYQEGILVEALRNGYWIVLDELNLAPSDVLEALNRLLDDNRELFI
FT                   PETQEVVHPHPNFMLFATQNPAGLYGGRKVLSRAFRNRFLELHFDDIPESELEYILKER
FT                   SQIAPSFCTRIVAVYRKLSLLRQANRLFEQKNSFATLRDLFRWALRQADDKEQLAINGF
FT                   MLLAERVRNPQERAAVKGVIEEVMKVKIDEEVLYSTSELDKRAPLLRQLTPGIVWTRAM
FT                   RRLFILVSTALQNNEPILLVGETGCGKTQLCQAVADAYQKQLHIINAHVNLETGDLIGA
FT                   QRPVRNRSAIEDAMLNDLRILLQDESKPFEELKQIFGTLSAEQRLECDPQLLKKIEKNL
FT                   ARLNALFEWTDGSLITAMKTGQFFLLDEISLADDSVLERLNSVLEPHRSILLAEKGPID
FT                   SMVVADSGFQFLSTMNPGGDYGKRELSAALRNRMTEIWAPQLSEDEDILPILQMKLETQ
FT                   LEQIPRAMLQFAKWFKRTFQGSSTNSLSIRDLLAWVDFVNKCQGSDPLFAIIQGAAMVF
FT                   IDTLGANPAAMLATTLHNLEGNRKLCLDKLEELFNVDASNIYMQKSDIGVQDQALRIGP
FT                   FYLTIQGDAQPDPDFIMDAPTTIANSVRIARGLQLAKPILLEGSPGVGKTTLVTALARA
FT                   LGKPLTRINLSEQTDLTDLFGSDVPVEGGDVGQFAWRDAPFLQAMQRGDWVLLDEMNLA
FT                   SQSVLEGLNACLDHRQMVYIAELDQTFKRHPNFVLFAAQNPHHQGGGRKGLPASFVNRF
FT                   TVVYADSFTDTDLKRICARLYPGSPITQTERLVDFVSILNVAIVQERRLGVLGGPWEVN
FT                   LRDIQRWLQLADRGTLQIHTKNFLDIIISQRFRCQEDRERVRHLYERVFDGVSTAAKSY
FT                   YHNMTTECMQVGLGVMRRDMLLQETPNPHLKVLPRDLSILESLMLCIEQSWPSILVGAS
FT                   GCGKTTLIRKLAAINGANLVELALSADTDTMDLVGGFEQIDHNRETSALLEDILLFVRR
FT                   HILSSCPSETSQEETYTLIELYERLQSPDLSLELVCTLLETARQRYGDPALERLLDRSR
FT                   TLFQVSKESESFKVGFEWTEGVLTQAVQKGDWVVLDNANLCNPSVLDRLNSLTEPNGSL
FT                   ILNEQRTEDGNARVIKPHPNFRLFLTMDSRNGELSRAMRNRCVEICILPQEDVPQDHFS
FT                   TPTYTSQSSLYRLRSLWTYGSSDESGQVTDSSYEIRLDHLSISDLAYLQQSRHLISPYL
FT                   TDIEAGQFSRLLNRYVSVIHDNQYCQPFDALKKTVNLGDAVFAIQGHSQPLHPLVNEPL
FT                   ALVLEQDLPLDLLILLAHLQESKRDLHRLKQALLLAEESSHSLKPSQMTRLQRSLASKR
FT                   IPALLKDSTQPVGRFLSHCGQALYDFVQSLDLDFLRHHDPMPPLRAVIRFCTDMLRITA
FT                   SNEVDEGKFLIYLQIGKSLCASIFDSGAAFNALAHSISQALERFHENWALTTGLGMQKL
FT                   WESWRPATASTPAQLASMLDLEKVASEFMHIANRTRLDLSQLSQVRSSLVETQRLLLME
FT                   GADEGNLVQGLRQTVTGLASVVQDSELAPNPYFSNEFEILCQYHDIAALKDGSSSAAQT
FT                   AIQSVLALLAGRPAQPLNSSKLQSRVPDILHRLSLFSGYQRSSGSGTAVSGTVSLSLLN
FT                   KLAFVDRVTLGQMDALELEKLTLSKALTLTSREIALDQLKLLRQALLELTAEFVDVHKE
FT                   FFNPQSFEQLVTLLRLAGKRGLPPSLLSLNIRLAQNLPNNHYFKTIADKALPKLVTALL
FT                   TRSTGEDAAQDTASALVQLAVILLWLFVPDKPFDPSLSLVVERERHYQRVAELTAKADA
FT                   ITLFEQVFSGQSTNIRKEIVQGELSNLGSAPPPSSVTRPATSEINVLHGEFSSIIKSVL
FT                   RRNPEKLINATKKDAENERMRKLLRDNIQQLSKRLSTNYRSFDDITILVVRFLQILDLG
FT                   LSLSSTSNHEPCETALLRTVSGTTPFLGASDLPIISSENGSPSHDSKHAMDSWFHDLSF
FT                   FRVAETMEPGLLRTKTGRESLLRVVDKFYILWKAKLKEDQEEYARKNEMYHFKGSWEDS
FT                   EEVDANELYQLFPTYEDGAEQVIDLPDAADPKVVSVRLADLHAKLFEYADSQTVLLDYV
FT                   KHSAMLLGSIWSDNDYLPYSKLAPKEQISAILLLLEEDLAKRTTTSAKNYNFYTDQNPA
FT                   EAKKLLILTRSIQARFVQIQQAWPDHAVPGDVISVCKEIYQFRHTEPVAKFLTKVEKLH
FT                   SLVHEWQLVASREYSAASYYDELTNLIISWRRLELSTWAKLLDLEKDKCVQGVSSWWFI
FT                   IFEALIRAPIQIAESGTTDLSDHVQEVVGTLEQFTHSTTLGEYSERLRLIKDFRALLSL
FT                   YVQDYPSLKQLVFALDNFLQYYAQFEPAVSKFLIDKRSSLEKDIKEQIQLASWKDTNIV
FT                   ALRESAKRSHVKLFKLVRKYREVLGLPVEQILSQDMPEGNEETGVFGREQIFSSASTPE
FT                   ALIICEKGKVWSTRPPRFMNPEGTVKSMLTMYTSIPDEFDVGNDLSGFVRFFLESIKEF
FT                   RTQTPKVLTEENKPDVQHLKGQKRRFYADTLRQLLEMGVKRNAGTDLIESQATVAKVLA
FT                   TSPSLPAHPAVIQLVEACDRYFYRLLDLVPRARQASRSYSEELSNVEVSRSLGSMEHLL
FT                   FMIRKQRAAASSALSDLANLQSILAKVSNLWKSGASSIIRSNYHAVSGKQEVTTAIAWL
FT                   GPTLGVASTVVELHSKFSGIDSSEISNGLQTWKDTFYRLRQSIKHLPELPSGVTSKLHQ
FT                   HTFDDAASSLDQLKTDITKWARDRPDLTFVLDQLLRWTKVKMGPAKFVEDVDALTIEDF
FT                   DSSLTAATDKILVSLQKLKEVPSSITSAGFLSRSDEFFTRALKSAHLADITKALIEVLE
FT                   TLHRVQEHSDVGIPLAVALLASLLPIMNKYYDISQDIVGRFLNVHRETCKMSYVLAKSF
FT                   IQVSSEGFCSPHEESTEEGQSGKLESGTGLGEGEGAEDISKDVGDDEDLSELAQQEQQE
FT                   GAGEDIDKSKDAVNMDQEDLKGEEGEHEEEEDGEKDESGDEGEEDDIDEEVGSVNDLDV
FT                   SAVDEKMWDGGHDEQQKETENEEGKGASEADQQAAAPEQKEGEKGEEGDKEGEEAEEED
FT                   EEEEEEAPDDEGEAVGREDMDVTDPQAPEQETLDLPDEMQLDGDEKGMDDEDFGSDDGL
FT                   DDLPDAPNDEQMDEKPDENIEEEGPGDLPGEEEEINPDEEAPPEEENANAAEGEDEAQA
FT                   PAEEPEETQQDEFLAQRDDNETAGEEVAPSEAVNGGLGAEQDQNQEKGASGNAQQQDGS
FT                   TDPSVEPKQQTGAAKEGEENERHRDAGGGDDINPEDPQLQAFKKLGDVLEQWHRRQKEI
FT                   MNASKQEEGETDEPLPQDTEMGDADFEHLADQDDVADTQALGQASEEQAKALDQNRGVE
FT                   SDVKPTDQEMLPDASDEPQALPENELEDAMQMDHNGASTEDQAAGAFIPGASHAQQNQS
FT                   DAQAQPAEIEQLDEVDSHLAAIHLSSTLPPLTPRDEAQRLWSKYESATNDLSLSLTEQL
FT                   RLILAPTLATKLRGDYRTGKRLNIKRIIPYIASQYKRDKIWMRRSVPSKRNYQIMLAVD
FT                   DSKSMLESGSGQLAFETLALVAKSLSMLEAGDLCVLGFGSEDHVRVAHDFGKPFSSEAG
FT                   VQVFQNFSYQQTGTNVRKLIADSIALFREARFKQSPAGGSADLWQLELIISDGICEDHE
FT                   TIRRLVRQAQEERIMIVFIIVDALKGNSILDLTQASFEPDNESGTGEMKLKMKRYLEGF
FT                   PFPYYLVVRDVRELPAVLATALKQWFAEVVDVSS"
FT   gene            complement(597213..598475)
FT                   /locus_tag="ANIA_06309"
FT                   /old_locus_tag="AN6309.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(597213..598475)
FT                   /locus_tag="ANIA_06309"
FT                   /old_locus_tag="AN6309.4"
FT                   /note="transcript_id=CADANIAT00006680"
FT   CDS_pept        complement(597213..598475)
FT                   /locus_tag="ANIA_06309"
FT                   /old_locus_tag="AN6309.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006680"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006680"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006680"
FT                   /db_xref="GOA:Q5AZH1"
FT                   /db_xref="InterPro:IPR018800"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZH1"
FT                   /protein_id="CBF69734.1"
FT                   /translation="MVLVAYSDSEASDSEQENTTPAARTSATKATPTFSNTPSASAPKV
FT                   TPIVDKSNPRKIRVALPEIRPESEEGEEDGPARKKLRIGGGGAGAFAGFNSLLPAPKRP
FT                   NAKVETDKLAGSRPTRKVFSLKTGAAPGFDREADEEMRRDMAFENLGMGGDDGNQDETI
FT                   PKAASLRGNEDIEARNAVEEKPQEVVLKGNPMMFKPLSVARAGQKKKKPIIPTPLASSK
FT                   PRTSAEKTMNEPEVQPEVQTQKPAAPPAPKPKVSLFSLSAPTEETAASDAPTSAHGSTY
FT                   EPLVYTTNEDSPTAGPQVPQTESVPAASTRPPPSAQTLDYIADDLNLSRSQRRQLFGRN
FT                   ADPSSSKILHFNTDAEYAANQEMAHKELAAAQHNPVRAIAPGKHTLQQLVNAASTQKEA
FT                   LEESFASGKRNKKEAGAKYGW"
FT   gene            598883..600047
FT                   /locus_tag="ANIA_06308"
FT                   /old_locus_tag="AN6308.4"
FT                   /product="hypothetical protein"
FT   mRNA            598883..600047
FT                   /locus_tag="ANIA_06308"
FT                   /old_locus_tag="AN6308.4"
FT                   /note="transcript_id=CADANIAT00006681"
FT   CDS_pept        598956..600047
FT                   /locus_tag="ANIA_06308"
FT                   /old_locus_tag="AN6308.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006681"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006681"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006681"
FT                   /db_xref="GOA:Q5AZH2"
FT                   /db_xref="InterPro:IPR038753"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZH2"
FT                   /protein_id="CBF69736.1"
FT                   /translation="MDTEHSISHSPRDRDHNPPSESSARSAAPDTEPDDYQANSKARGK
FT                   FRFKSSKSKSSSKSSRNESHRHSHRHRRRHNEEDYRGHRRHKRHRTTTPRSPSPGTVPS
FT                   YPGAPLSPNTAFRESLFDALGDDEGAAFWESVYGQSIHSFTPPPVGDGDGRGVLEQMDE
FT                   EEYAAYIRAEMWKRTREGMLEEQERIRAEKKARVRAEKAAEEEEERRRFERAMEDSLRR
FT                   GMERKRAKEVWRVAWENYIRSWEEIEEARRKGDSTDEGKTVRNLLFWPVESGKRRDVSK
FT                   ENVEEFMRRAPRHPQSSGSRSGAGNGTAPEDTLLYTLKAERVRWHPDKIQHRYGAMGID
FT                   EPVMRSVTEVFQIIDHMWNELKK"
FT   gene            complement(600268..601655)
FT                   /locus_tag="ANIA_06307"
FT                   /old_locus_tag="AN6307.4"
FT                   /product="lectin family integral membrane protein, putative
FT                   (AFU_orthologue; AFUA_2G12180)"
FT   mRNA            complement(join(600268..600810,600867..601127,
FT                   601181..601262,601343..601413,601477..601500,
FT                   601554..601655))
FT                   /locus_tag="ANIA_06307"
FT                   /old_locus_tag="AN6307.4"
FT                   /note="transcript_id=CADANIAT00006682"
FT   CDS_pept        complement(join(600268..600810,600867..601127,
FT                   601181..601262,601343..601413,601477..601500,
FT                   601554..601655))
FT                   /locus_tag="ANIA_06307"
FT                   /old_locus_tag="AN6307.4"
FT                   /product="lectin family integral membrane protein, putative
FT                   (AFU_orthologue; AFUA_2G12180)"
FT                   /note="transcript_id=CADANIAT00006682"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006682"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006682"
FT                   /db_xref="GOA:Q5AZH3"
FT                   /db_xref="InterPro:IPR005052"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZH3"
FT                   /protein_id="CBF69738.1"
FT                   /translation="MLLPRFSTLLCLAGLTAVPAVNAYDGDENVKSIPLRTHSLSAPYL
FT                   DSDFQSRWFDFGGDTVIRADKYIRLTSDRPSQQGWIFSRVPLTATNWEIEFEFQIHGEG
FT                   NLHGDGFAMWLTKQRATQGPVFGSTDNFEGLGIFFDTYKNNRPGTSFPYVMAMMGDGKT
FT                   SYDQAHDGKANELAGCSARGLRTTSVPTKARLTYFQDKSLTLDLQYKSEGTWTNCFTLT
FT                   SPETNIAIPSVAYLGFSAETGELSDNHDIISVKAQNLYNVAGSKGTGGSGPPRSADRPY
FT                   RKPKKQSGSWSWFLFKVFFFFAAVRGGYDWMDRLPVQDKVFSVLDERVVDFCGLMRSGP
FT                   MSESEMVKIKTLSVILYLLA"
FT   gene            602205..603004
FT                   /locus_tag="ANIA_06306"
FT                   /old_locus_tag="AN6306.4"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit tim13 [Source:UniProtKB/Swiss-Prot;Acc:Q5AZH4]"
FT   mRNA            join(602205..602419,602516..603004)
FT                   /locus_tag="ANIA_06306"
FT                   /old_locus_tag="AN6306.4"
FT                   /note="transcript_id=CADANIAT00006683"
FT   CDS_pept        join(602282..602419,602516..602704)
FT                   /locus_tag="ANIA_06306"
FT                   /old_locus_tag="AN6306.4"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit tim13 [Source:UniProtKB/Swiss-Prot;Acc:Q5AZH4]"
FT                   /note="transcript_id=CADANIAT00006683"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006683"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006683"
FT                   /db_xref="GOA:Q5AZH4"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039238"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZH4"
FT                   /protein_id="CBF69740.1"
FT                   /translation="MALFGSSAPAAAAPANSAEDVQQTKANLIAQLQQEMAMANAKKLI
FT                   SKVNQNCFENCITAPGSSLSASESTCLSSCMEKYIQFWNAASKAYIARATTQTVAANAM
FT                   ATEL"
FT   gene            complement(603539..605118)
FT                   /gene="pkaA"
FT                   /locus_tag="ANIA_06305"
FT                   /old_locus_tag="AN6305.4"
FT                   /product="CAMP-dependent protein kinase PKAC catalytic
FT                   subunitPutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9P472]"
FT   mRNA            complement(join(603539..603566,603618..603992,
FT                   604045..604298,604357..605118))
FT                   /gene="pkaA"
FT                   /locus_tag="ANIA_06305"
FT                   /old_locus_tag="AN6305.4"
FT                   /note="transcript_id=CADANIAT00006684"
FT   CDS_pept        complement(join(603539..603566,603618..603992,
FT                   604045..604298,604357..605118))
FT                   /gene="pkaA"
FT                   /locus_tag="ANIA_06305"
FT                   /old_locus_tag="AN6305.4"
FT                   /product="CAMP-dependent protein kinase PKAC catalytic
FT                   subunitPutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9P472]"
FT                   /note="transcript_id=CADANIAT00006684"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006684"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006684"
FT                   /db_xref="GOA:G5EB66"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB66"
FT                   /protein_id="CBF69742.1"
FT                   /translation="MPTLGGLLKKRRTRDSQDLSKELQAGSTTTGHTTTSPIAAEDSQS
FT                   QQHHGHHGGHHFFHHNHHNHQPSNNSANSANSQNSHAAKHHQFDQSSATSNQPSDGQTA
FT                   SMQSPAQQPSSTSAHSNSGHHSNAASIHNIIHPSQQNTPQVSRAERTTKGKYTLDDFAI
FT                   QRTLGTGSFGRVHLVQSKHNHRYYAIKVLKKAQVVKMKQIEHTNDERRMLNRVRHPFLV
FT                   TLWGTWQDARNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSLNII
FT                   YRDLKPENLLLDRHGHLKITDFGFAKEVPDITWTLCGTPDYLAPEVVASKGYNKSVDWW
FT                   SLGILIFEMLCGFTPFWDQGSPVKIYQNILAGRIKFPPYLHPDAVDLLSRLITSDLTKR
FT                   LGNLHGGPDDIKNHPWFAEVTWDRLLRKEIDAPYVPPIRGGQGDASQYENYQEESEPYG
FT                   QAGEDPHGHLFPDF"
FT   gene            complement(606204..608786)
FT                   /locus_tag="ANIA_06304"
FT                   /old_locus_tag="AN6304.4"
FT                   /product="stress activated MAP kinase interacting protein,
FT                   putative (AFU_orthologue; AFUA_2G12210)"
FT   mRNA            complement(join(606204..608712,608764..608786))
FT                   /locus_tag="ANIA_06304"
FT                   /old_locus_tag="AN6304.4"
FT                   /note="transcript_id=CADANIAT00006685"
FT   CDS_pept        complement(join(606204..608712,608764..608786))
FT                   /locus_tag="ANIA_06304"
FT                   /old_locus_tag="AN6304.4"
FT                   /product="stress activated MAP kinase interacting protein,
FT                   putative (AFU_orthologue; AFUA_2G12210)"
FT                   /note="transcript_id=CADANIAT00006685"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006685"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006685"
FT                   /db_xref="GOA:Q5AZH6"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR031313"
FT                   /db_xref="InterPro:IPR031567"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZH6"
FT                   /protein_id="CBF69744.1"
FT                   /translation="MSLLHNEDFTIWQLRTSYLSTIKDGIGDRLINVNHSVLNTPGFRA
FT                   AGWPAASANHPSQLAASIKRTYSPPIPTATAVSSEYYQLGARDLNDSQRSGFGQDGEDD
FT                   EGGMVTGKSTIDGIGRRNPLRNEKRAHRKERQQREQQKARDVEEDDSSDLSDESDDDGE
FT                   PLQRASEEIKFPKVPVRIRAGSSPIRATDRQERPQVMVTHPSHTSMNSHYRTGSLGTAP
FT                   SVSERPRRDTTTTTTSSDMSSDHEIDMSAPGYRRRQIHFSGHDQVIDLGKASSDGLEQL
FT                   DEQEEDSDAGSVESALSSEFDATAGSASLLGAVGITGGLNSSSPIALMHKLPHGPSSQT
FT                   ASPRKPKPPAPELQDLPPPRPISTVQPVSLLSTALNARAKAPANPVERFAVLSGKGLTD
FT                   ALNIRLYVPFSSDPEEPLDLPLARESKLADQPAPVTVAEAIGLALWRYSEERRQPPIER
FT                   DKLNVNRWTLRMVEDGEVEYDFPPLGRASAISDFTSNNNSRAGGMRGRSRGKQYDEFAL
FT                   VEASDMEFEENERLYPMYNVSAPAEEARDPAPAAAAAPAGQPVPQTKTARPNPILGQPF
FT                   SSALNDNTLTPADRPAVPVSHATPRLGVSKTLKIRYTNLESSTQTTTLNTSTDSYIAEI
FT                   LDSVCKRWGLDKGNYLLKVMGSNTIAPLDRTVEALGNITDLDLVRRRFGPQVLTGSPVS
FT                   SSPNAPLLVDSPAVPTKKGKKSGQRMLHPLTQQQDLIGGYYRRYFVLRKQSMGFTTSLH
FT                   RVLTFDNDYMHIMPADTGKNGSDTKTRSISFNDVVGCKVSRRHPKNFRVVVLRGNDATE
FT                   QKRYDFEARNSFEAEEIVGEIKKNMAQYRTT"
FT   gene            complement(609220..612989)
FT                   /locus_tag="ANIA_06303"
FT                   /old_locus_tag="AN6303.4"
FT                   /product="Replication factor C like protein
FT                   [Source:UniProtKB/TrEMBL;Acc:P78622]"
FT   mRNA            complement(join(609220..612481,612534..612624,
FT                   612679..612703,612789..612989))
FT                   /locus_tag="ANIA_06303"
FT                   /old_locus_tag="AN6303.4"
FT                   /note="transcript_id=CADANIAT00006686"
FT   CDS_pept        complement(join(609406..612481,612534..612624,
FT                   612679..612703,612789..612875))
FT                   /locus_tag="ANIA_06303"
FT                   /old_locus_tag="AN6303.4"
FT                   /product="Replication factor C like protein
FT                   [Source:UniProtKB/TrEMBL;Acc:P78622]"
FT                   /note="transcript_id=CADANIAT00006686"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006686"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006686"
FT                   /db_xref="GOA:Q5AZH7"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012178"
FT                   /db_xref="InterPro:IPR013725"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZH7"
FT                   /protein_id="CBF69746.1"
FT                   /translation="MPADIRSFFGGKSSQGSASSPTKPPAKKEKQTPARNKRGRKVVND
FT                   SEDDDDVVVTDAPVSRAKPSSKSKPAVPEGEPTTASDYFASSKKKGRTKSSNADTNNKP
FT                   SKSSATKTESPEATVGTAEQKDATRAGSRRDTNKATVRLDDEKLGDDDIFATEYGKAGK
FT                   GNDDYKEEEDDDDSDDFDPLAKPVNGARGRPVSKKRSALGEDDEDVIMEDAPRRPASAA
FT                   KPATSQTQRKRKSEAVDKDDDDIQATSKSVGTGARSKKPKALTAKQDQSDSKEIQDIFD
FT                   SIPTIKAPSPPPPQGSDEKKKFVFGGGKSRDPVSGGAELPVGAENCLAGLTFVFTGVLD
FT                   TLGREEGQALVKRYGGKVTTAPSGKTSFVVLGSDAGPSKLATISKHKLKTISEEGLFEL
FT                   IRRLPANGGDGKAAEKYEAKKKEEDEKIRKMAAEIDAEEKRNEAERRKEVKSGQTTQDV
FT                   KDKKENNADDQLWTSKYAPTSLNMICGNKGAVEKLQAWLRNWRKSAKANFTKPGKDGSG
FT                   LYRSVMIHGPPGIGKTTAAHLVAKLEGYDVVESNASDTRSKKLVESGLLGVLDTTSLQG
FT                   YFSTSNKKVESGKKNLVLIMDEVDGMSAGDRGGVGAMAAIAKKTQIPLILICNERRLPK
FT                   MKPFDHVTFEIPFRRPTVEQVRARLLTICFREKMKIPPQVLDSLIEGTHADIRQVINML
FT                   SAVRLDRSEQGDQTGQDYSLDYDQGKQMSKAWEKHIILKPWDIVGKILNPQMFSQSSTA
FT                   TLNDKSELYFNDHEFSYLMLQENYLRTKPTRANNYEGKERKLKLLELADNAASSISDGD
FT                   LVDRMIHGSQQQWSLMPTHAIFSFVRPASFMFGNMMERPAFTSWLGQNSKQGLIIVFGV
FT                   IAREADVVHAGKLSRYVKEIQGRMRLRASGDRHEVRQQYIPLLWDRLVKRLMVDGKDSV
FT                   EDVVDFMDSYFLTRDDWDALVELGLGPMDESKVKLETQTKAAFTRVYNQRSHPLPYMKA
FT                   SNVLAPKKAPKEKPDIEDAIDESDEDDVLVDDTKDDEDSDEIDLKKDKLIRVPKKSTAK
FT                   KSSKSSTSAKGKGKSKKTSADDFIDDEDDDAPKPKKARGKKAKS"
FT   gene            613204..614012
FT                   /locus_tag="ANIA_06302"
FT                   /old_locus_tag="AN6302.4"
FT                   /product="Mitochondrial ribosomal protein L16
FT                   [Source:UniProtKB/TrEMBL;Acc:Q6RJU7]"
FT   mRNA            join(613204..613780,613840..614012)
FT                   /locus_tag="ANIA_06302"
FT                   /old_locus_tag="AN6302.4"
FT                   /note="transcript_id=CADANIAT00006687"
FT   CDS_pept        join(613204..613780,613840..614012)
FT                   /locus_tag="ANIA_06302"
FT                   /old_locus_tag="AN6302.4"
FT                   /product="Mitochondrial ribosomal protein L16
FT                   [Source:UniProtKB/TrEMBL;Acc:Q6RJU7]"
FT                   /note="transcript_id=CADANIAT00006687"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006687"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006687"
FT                   /db_xref="GOA:C8V190"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:C8V190"
FT                   /protein_id="CBF69748.1"
FT                   /translation="MGSHLKYLARPQFACLQPTCMDHPKNSAAKLMHLPALGLRTSVPF
FT                   LPLSRCFSTTSPALDWLTPKMAETSKSPKGRPHVPTGGSSRGTTVVWGDYGLRMKDHDR
FT                   RLPAASLKIAEETIKRRLRGMNYTLYKRVSANIGVYTKGNEQRMGKGKGKFDYWTAKVA
FT                   VSRIVFELKGDIHEKVAREAFRLAGHKLPGLWEFVNKGDPPVVGLTKLGNGVTLESLKR
FT                   ARRNPPLGTDKLSKPPKSTSSSPSASQ"
FT   gene            complement(613772..614596)
FT                   /locus_tag="ANIA_06301"
FT                   /old_locus_tag="AN6301.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(613772..614132,614230..614381,
FT                   614435..614493,614547..614596))
FT                   /locus_tag="ANIA_06301"
FT                   /old_locus_tag="AN6301.4"
FT                   /note="transcript_id=CADANIAT00006688"
FT   CDS_pept        complement(join(614058..614132,614230..614381,
FT                   614435..614493,614547..614596))
FT                   /locus_tag="ANIA_06301"
FT                   /old_locus_tag="AN6301.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006688"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006688"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006688"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZH9"
FT                   /protein_id="CBF69750.1"
FT                   /translation="MTDTKLMDIEAGGEQTQYEGVRQFSKTPEKQTGQLGYNLPHTKSQ
FT                   TRTTLAGDHSEAKAKREDSKLAHKLELGERTSGITGYTNESSDETEHDAAKSRREQGYG
FT                   PGSGIGA"
FT   gene            complement(615719..617029)
FT                   /locus_tag="ANIA_06300"
FT                   /old_locus_tag="AN6300.4"
FT                   /product="DNA replication factor C subunit Rfc5, putative
FT                   (AFU_orthologue; AFUA_2G12250)"
FT   mRNA            complement(join(615719..615743,615794..615849,
FT                   615899..615997,616046..616214,616266..616888,
FT                   616943..617029))
FT                   /locus_tag="ANIA_06300"
FT                   /old_locus_tag="AN6300.4"
FT                   /note="transcript_id=CADANIAT00006689"
FT   CDS_pept        complement(join(615719..615743,615794..615849,
FT                   615899..615997,616046..616214,616266..616888,
FT                   616943..617029))
FT                   /locus_tag="ANIA_06300"
FT                   /old_locus_tag="AN6300.4"
FT                   /product="DNA replication factor C subunit Rfc5, putative
FT                   (AFU_orthologue; AFUA_2G12250)"
FT                   /note="transcript_id=CADANIAT00006689"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006689"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006689"
FT                   /db_xref="GOA:Q5AZI0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZI0"
FT                   /protein_id="CBF69752.1"
FT                   /translation="MALLVDKHRPRSLDTLSYHHELSARLRSLAQSGDFPHLLMYGPSG
FT                   AGKKTRTIATLKELYGPGVEKIKIDNRVFQTTSNRKLEFNIVSSVYHLEITPSDVGTYD
FT                   RVVVQELLKEIAQTQQVDLSAKQRFKVVVINEADHLTRDAQAALRRTMEKYSPNMRLIL
FT                   LANSTSNIIAPIRSRTLLVRVAAPSEEDICTILSTSAKREGWNEAPELNKRIAKESGRN
FT                   LRRALLMFEAIYAQSEKVSDDTPIPPPDWEALISVIAEEILAERSPARLLQVRARLYDL
FT                   LTHCIPATTILKTLTFKLIAKIDDTLKPEVIKWSAFYEHRITQGSKVIFHLEAFVAKFM
FT                   RIYESYLMGMDF"
FT   gene            618309..620434
FT                   /locus_tag="ANIA_06299"
FT                   /old_locus_tag="AN6299.4"
FT                   /product="DUF803 domain membrane protein (AFU_orthologue;
FT                   AFUA_2G07880)"
FT   mRNA            join(618309..619046,619097..620434)
FT                   /locus_tag="ANIA_06299"
FT                   /old_locus_tag="AN6299.4"
FT                   /note="transcript_id=CADANIAT00006690"
FT   CDS_pept        join(618309..619046,619097..620434)
FT                   /locus_tag="ANIA_06299"
FT                   /old_locus_tag="AN6299.4"
FT                   /product="DUF803 domain membrane protein (AFU_orthologue;
FT                   AFUA_2G07880)"
FT                   /note="transcript_id=CADANIAT00006690"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006690"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006690"
FT                   /db_xref="GOA:Q5AZI1"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZI1"
FT                   /protein_id="CBF69754.1"
FT                   /translation="MDLSPRSGISSGGDRPPAYKAIGISLAVASGVFIGVSFVLKKVGL
FT                   LRANVKYNEEAGEGYGYLKNLWWWSGMTLMIIGEICNFVAYAFVDAILVTPLGALSVVI
FT                   TTILSAIFLKERLSFVGKVGCFSCILGSVVIALNAPEQSSVADIQDMKKYVIAPGFLSY
FT                   AGVIIVACAITAIWAGPRYGKRSMFVYISICSLIGGLSVVATQGLGAALLAQINGEAQF
FT                   KEWFMYVLLVFVVATLLTEIIYLNKALNIFNAALVTPTYYVFFTSSTIISSAILFRGFK
FT                   GTGTQIASVILGFLQICAGVVLLQLSKSAKDVPDAAVFKGDLDQVREVATQEEPEFEPK
FT                   ADAIRGTAAIIRRLSTPRRNVEAEEARRYLRERQEDQLRPPADNEIVEWDGLRRRKTVL
FT                   SEKSQRRTPTPLPPLGMSRFPDDLSEDSHNTSPSVHTFMNEVRSRTSSIMSSPWRPIPG
FT                   DQQTHGPVLEPDPKVVDTSYPGQHPPRAVSWVDEEQDQSHLAAPAPPPHRHFSFQKIFS
FT                   RAKSPVDPSSADSRSHTRSRSPRGILRRGHMRNMTSEEEHLGLVQGDKVSGYTNEDEKH
FT                   ERTRTNIQSNHDEDDYETYNYDTYDYYDDGKLDDLPSGRRLDSHSSLYPPRLRLNPLSP
FT                   LPDNESALDVSHIRNDQQQYQPQPEQQQPLESSKGSLLTIPRRQSGWRRQDSASSG"
FT   gene            complement(620805..621689)
FT                   /locus_tag="ANIA_06298"
FT                   /old_locus_tag="AN6298.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(620805..621255,621310..621689))
FT                   /locus_tag="ANIA_06298"
FT                   /old_locus_tag="AN6298.4"
FT                   /note="transcript_id=CADANIAT00006691"
FT   CDS_pept        complement(join(620805..621255,621310..621689))
FT                   /locus_tag="ANIA_06298"
FT                   /old_locus_tag="AN6298.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006691"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006691"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006691"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZI2"
FT                   /protein_id="CBF69756.1"
FT                   /translation="MPPPTKTAAQSNHRLFDPWNSASSGHQHSEVNPGTAWRRTREAKL
FT                   AQQFRSGDCTISSFVYDGVNRVYEKGEWEWDWGGDARGGRGGDRRGGKSTGRGRTAVSP
FT                   DSKQRDIRSMLGIGKGGSSSGSGQPSTQLPTQSHEPIPDPMDLAPGAFSGTTTSNVATA
FT                   PLQKHPQSQCQSNAATSTPPESTIFRGATIYINGRTAPLISDHKLKSLLVAHGATLALS
FT                   ISRRVTHIIIGKPNAGPGRGGAGGGLAAGKIQEELARGGWRGIRIVGVEWYVTA"
FT   gene            complement(622406..623603)
FT                   /locus_tag="ANIA_06297"
FT                   /old_locus_tag="AN6297.4"
FT                   /product="cytochrome c oxidase assembly protein Cox11,
FT                   putative (AFU_orthologue; AFUA_2G12260)"
FT   mRNA            complement(join(622406..622717,622775..623216,
FT                   623296..623365,623412..623603))
FT                   /locus_tag="ANIA_06297"
FT                   /old_locus_tag="AN6297.4"
FT                   /note="transcript_id=CADANIAT00006692"
FT   CDS_pept        complement(join(622668..622717,622775..623216,
FT                   623296..623365,623412..623602))
FT                   /locus_tag="ANIA_06297"
FT                   /old_locus_tag="AN6297.4"
FT                   /product="cytochrome c oxidase assembly protein Cox11,
FT                   putative (AFU_orthologue; AFUA_2G12260)"
FT                   /note="transcript_id=CADANIAT00006692"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006692"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006692"
FT                   /db_xref="GOA:C8V195"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:C8V195"
FT                   /protein_id="CBF69758.1"
FT                   /translation="MFSRLTPPWGWSLSPGAGAARSVLSQAKGLAPGRRYFSRNSWLNQ
FT                   SPSAPFNTPQSQKRNASTMYYTISIILGTVSLAYGSVPLYKMICQQTGWNGQPVLTHRA
FT                   GDGDTSSRVTPVTDSRRLRITFNGSVSDVLPWKFTPQQREVRVLPGETALAFYTATNKG
FT                   PTDIIGVATYSVTPGQVAPYFSKIQCFCFEEQKLNAGESVDMPVFFFIDPDFVTDPAMK
FT                   GIDTITLSYTFFKARYDDNGVLKPIAGN"
FT   gene            complement(623898..625772)
FT                   /locus_tag="ANIA_06296"
FT                   /old_locus_tag="AN6296.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_2G12300)"
FT   mRNA            complement(join(623898..624020,624175..624376,
FT                   624467..625356,625491..625605,625717..625772))
FT                   /locus_tag="ANIA_06296"
FT                   /old_locus_tag="AN6296.4"
FT                   /note="transcript_id=CADANIAT00006693"
FT   CDS_pept        complement(join(623898..624020,624175..624376,
FT                   624467..625356,625491..625605,625717..625772))
FT                   /locus_tag="ANIA_06296"
FT                   /old_locus_tag="AN6296.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_2G12300)"
FT                   /note="transcript_id=CADANIAT00006693"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006693"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006693"
FT                   /db_xref="InterPro:IPR026749"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZI4"
FT                   /protein_id="CBF69759.1"
FT                   /translation="MDSAALIRRRHRTTQLLQPVLRAYALGYLSSATPKIISCLRRLWI
FT                   NNDLSYRQRFYELLRVLAGPLRLESFPTFCAALVGGSTLLPILALRVLQTACRRLGSDF
FT                   KSLNFKSVSQLIQFAAAFVSAWFSFQILNRRPVTLQTVSGKPQDGIGQETTALQPTPQL
FT                   YPHRQTQFGGRTMDLTLFTFTRALDSMACIVWSWVQHKRRGGHGWSKAIPVIPGLADSA
FT                   VFASSAAVVMWAWFYSPERLPRSYGKWIGEVAKVDERLIEALRRARRGIFVYGKDTGQA
FT                   PLLESMCKDFGWPTAWGDPARTIPIPCEMVHMGCGPSCEKHAVSRFLRTFKFACATYIP
FT                   LQTAFRIRSMKSADRTRLGPRLFSRETVTPQMWDSGLCVGAGCVMCGWSILVEHAKKRQ
FT                   EIALFVAPRAAATVLPRFYDQKYLYRERTMFAISAAVLLTCLKESPDMVRGVFGKIGRS
FT                   VVN"
FT   gene            627101..628772
FT                   /locus_tag="ANIA_06295"
FT                   /old_locus_tag="AN6295.4"
FT                   /product="putative bHLH transcription factor (Eurofung)"
FT   mRNA            join(627101..627170,627265..628772)
FT                   /locus_tag="ANIA_06295"
FT                   /old_locus_tag="AN6295.4"
FT                   /note="transcript_id=CADANIAT00006694"
FT   CDS_pept        join(627101..627170,627265..628505)
FT                   /locus_tag="ANIA_06295"
FT                   /old_locus_tag="AN6295.4"
FT                   /product="putative bHLH transcription factor (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006694"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006694"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006694"
FT                   /db_xref="GOA:Q5AZI5"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZI5"
FT                   /protein_id="CBF69761.1"
FT                   /translation="MSINPPNGTQGRHARNNSALPFGSSPVGPPLLDDTETNMLDNFLT
FT                   TINSNPFANDYWFSDSQNDANNSLGLPGFDWSTELPPTFQGSTSSLPPFHPPSSSHRSV
FT                   EKSLGIAPEHANSEVMAAASMLYQNGMNGPEISTAFGNQPLAFSNVDYSQLKGSGKERK
FT                   QDGRMPEKGTGISRTHLPAGYHTTKMFFDVPEPISTEQQLITKAQPLHWGSDSSFMDRG
FT                   YLAPPDQPDEEQRTKEMMEKLECLERQSSATNTRAPTPDRHVNQQPVPLFEPDAINHLN
FT                   GLRKDYGDSIEDLSYPKKKQRLLIKEEDDENSDGNTSRQRCKRSKGPGRRPSTDGVRKS
FT                   KPSQGSKPRENLTEEQKRSNHIHSEQKRRNLIKQGFDDLCTLVPGLRGGGFSKSAVLTQ
FT                   AADWLEDIIKGNQALRLQLAQLPDLSTMDNSMMRPRT"
FT   gene            629107..630361
FT                   /locus_tag="ANIA_06294"
FT                   /old_locus_tag="AN6294.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(629107..629369,629431..629515,629570..629734,
FT                   629786..629893,629947..630361)
FT                   /locus_tag="ANIA_06294"
FT                   /old_locus_tag="AN6294.4"
FT                   /note="transcript_id=CADANIAT00006695"
FT   CDS_pept        join(629107..629369,629431..629515,629570..629734,
FT                   629786..629893,629947..630099)
FT                   /locus_tag="ANIA_06294"
FT                   /old_locus_tag="AN6294.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006695"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006695"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006695"
FT                   /db_xref="GOA:Q5AZI6"
FT                   /db_xref="InterPro:IPR025212"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZI6"
FT                   /protein_id="CBF69763.1"
FT                   /translation="MPAKRKHSGNALDQDNDSRRKRSYAYLKPQVRHISERTIKSKWST
FT                   LPEPMQDKIRDMLQALERPVIVRQQNERKRYEAQAAVQAVVKNLGKRLPRMPFPPMTKD
FT                   SVFEYEAALKEHSALEASLSTMNDSIVLLNNEIAKEEAFLAKETKQLQEMEKNAKRAEA
FT                   ERRRLMKNEHPALRQLRDVREQQIEAPSGFNLSHAKGSQLDFSELEADPEASSLLKQLN
FT                   NHLKSMQSNIAPLTGLKDAIDRSQTALSLATLPDD"
FT   gene            630767..633178
FT                   /locus_tag="ANIA_06293"
FT                   /old_locus_tag="AN6293.4"
FT                   /product="acuM, Zn(II)2Cys6 transcription factor involved
FT                   in transcription control of gluconeogenisis (Eurofung)"
FT   mRNA            join(630767..631258,631362..631384,631572..631589,
FT                   631701..632007,632068..632816,632873..633069,
FT                   633127..633178)
FT                   /locus_tag="ANIA_06293"
FT                   /old_locus_tag="AN6293.4"
FT                   /note="transcript_id=CADANIAT00010534"
FT   CDS_pept        join(631036..631258,631362..631384,631572..631589,
FT                   631701..632007,632068..632816,632873..633069,
FT                   633127..633178)
FT                   /locus_tag="ANIA_06293"
FT                   /old_locus_tag="AN6293.4"
FT                   /product="acuM, Zn(II)2Cys6 transcription factor involved
FT                   in transcription control of gluconeogenisis (Eurofung)"
FT                   /note="transcript_id=CADANIAT00010534"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00010534"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00010534"
FT                   /db_xref="GOA:C8V199"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8V199"
FT                   /protein_id="CBF69765.1"
FT                   /translation="MTEKNTTQPGSAPDQYAGNGTAENTGPSKTLDGNKVGRVDSNAKE
FT                   NAQKSPASKTESTPAGTRTSPKKRRKVNHACVYCRRSHMTCDSERPCTRCIKRNIGHLC
FT                   HDEPREPSKRSRSEHEQSAADEEGSSNNEYSKVHAMPRKVDIQDAAGQQILADGSLGLT
FT                   PSSMNAVQPGPMSSSTSQNMSVTSQQQLLGYNDWVGGQNQFQDMHTFHPSYMFNAPEVT
FT                   NEYNLLGDFLSNSLLDDGSIFQNEDMQRMYSDPTLINSMAVLGGPSTSLLQQSQTLQPQ
FT                   QSQQNQGDTASGATIGNDKARETYYMTAADPAGSDPPEERMNKLLKAKYDAGLLRPFNY
FT                   VKGYARLSAYMEKNLQVSSRQKIARQLDKFRPKFRDRMQKLTDIELILVEMWFERSLME
FT                   YDRVFASMAIPACCWRRTGEIFRGNKEMAELIGVPIELLRDGKLAIHEIIVEDQLVSYW
FT                   EKFGAIAFDNTQKAMLTSCTLKNPNATSPTEGIPCCFSFTIRRDNHNIPSLIVGNFLPT
FT                   QRDTK"
FT   gene            634242..635146
FT                   /locus_tag="ANIA_06292"
FT                   /old_locus_tag="AN6292.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(634242..634303,634404..634485,634714..635008,
FT                   635103..635146)
FT                   /locus_tag="ANIA_06292"
FT                   /old_locus_tag="AN6292.4"
FT                   /note="transcript_id=CADANIAT00006696"
FT   CDS_pept        join(634242..634303,634404..634485,634714..635008,
FT                   635103..635146)
FT                   /locus_tag="ANIA_06292"
FT                   /old_locus_tag="AN6292.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006696"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006696"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006696"
FT                   /db_xref="GOA:Q5AZI8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZI8"
FT                   /protein_id="CBF69767.1"
FT                   /translation="MAPLGNSGFGRLQIPQVLVEVFYSGQVDSIDRNHPWAKGAVLVQR
FT                   TTQKAHPPPPQMPPPPELILDQAFLLARSEQFGFTFQYSSCMSRRRSSVACNDCVSQAV
FT                   KFFLVSADEDCRQRAKKAIAVADLAGQKRRELSRLLRTNITENNGTSLLDFGFGKS"
FT   gene            complement(636065..639392)
FT                   /locus_tag="ANIA_06291"
FT                   /old_locus_tag="AN6291.4"
FT                   /product="WD repeat protein (AFU_orthologue; AFUA_2G12360)"
FT   mRNA            complement(join(636065..637607,637658..638482,
FT                   638536..638807,638856..639392))
FT                   /locus_tag="ANIA_06291"
FT                   /old_locus_tag="AN6291.4"
FT                   /note="transcript_id=CADANIAT00006697"
FT   CDS_pept        complement(join(636065..637607,637658..638482,
FT                   638536..638807,638856..639392))
FT                   /locus_tag="ANIA_06291"
FT                   /old_locus_tag="AN6291.4"
FT                   /product="WD repeat protein (AFU_orthologue; AFUA_2G12360)"
FT                   /note="transcript_id=CADANIAT00006697"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006697"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006697"
FT                   /db_xref="GOA:Q5AZI9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZI9"
FT                   /protein_id="CBF69769.1"
FT                   /translation="MANNALSVKSKTAGSNHSLRGAPSNSPTIRPPTRSAKPSPYQSAL
FT                   SLQTVIGTTTTTPNGFSFHDQSNSFAFCAGSAGVLAELDEDNNANQRFFRARPTASSIN
FT                   PVISFYNQCTPPATPDARTRSLPGIKATPHNGSYNGSPSMEIVDSSPRAWSSRERVKAV
FT                   TCVAISPNGRFLALGETGYNPRVLVFSTAKDAPSDIPLTILTDHSFGVRALAWSPNSQY
FT                   LATLGDVNDGFLFVWSVSLKNGSAKLHSTNKCTTVVRDMTWLGQALITVGVRHVKVWRL
FT                   PDIRPVSPSKSRTNTGDAPNIATPKALSGRNCVLHTLADSTFTSVVGISDSEAIVGTDM
FT                   GALCLIDDNDGTAKLTLIQYVGFSITSLTADSDRACIWIGGRGRRMRRLPFESLRPSSN
FT                   LPSPRTLNRLSAEIKSRGPAITCIGSLSSHLVTVDGTRAINIYPIEKLKGEDEQCNLGD
FT                   TMPAHRDSVLGVGPLKTPNYLEADFFTWSCRGVVKFWNIQGKCRDSRTILAEPLAGSED
FT                   DAVNELKILRATTDMGLFFSGDKVGVLRVFQGPMWECVGEVRAHGGEVTDIAILETSDS
FT                   CVVASSGRDRMVQLFERRNDNLQLIQTMDDHVGAVNQLLFVNGGERLLSSSADRTILVR
FT                   ERVTRDDEGVTAIAYLVSKAITLRSSPVSLSLSPDDPDTLVFSTVDRCVHHYDLNSGHY
FT                   INSFRAADSESNDTVIMGSLTVTSAVSGQNPRLLIGASGTDKSIRVYDMEKGALLTGEF
FT                   GHTEGVSDVLMLERYSDASKDSPERILVSSGIDGVVMIWNISVQLQQSQEVTHAGSNDE
FT                   EDISSKEPNLSKPPLRKVLSRQDLAGYQRPEGSVLTPTPAREGPEQSPLFLRRLSKVSI
FT                   VPTMKNAHLVPATPPSAPPRHSPTSSVRPERLRNSPSPPSPRSTGAKKTLESRNHNNIR
FT                   CSSLDFRARSRATGKSEFGSLNMSTEQVCRTLKAYRKKLNGSTEHLHSQKELERELGLT
FT                   LRILSSRAKKAEAHKAEMETDSSGKENERIPPPIPSKTGRIPRRVPSTPNLGQEKSPRY
FT                   SRRRSLDGGG"
FT   gene            641545..642474
FT                   /locus_tag="ANIA_06290"
FT                   /old_locus_tag="AN6290.4"
FT                   /product="mitochondrion organization and biogenesis
FT                   protein, putative (AFU_orthologue; AFUA_2G12370)"
FT   mRNA            641545..642474
FT                   /locus_tag="ANIA_06290"
FT                   /old_locus_tag="AN6290.4"
FT                   /note="transcript_id=CADANIAT00006698"
FT   CDS_pept        641545..642360
FT                   /locus_tag="ANIA_06290"
FT                   /old_locus_tag="AN6290.4"
FT                   /product="mitochondrion organization and biogenesis
FT                   protein, putative (AFU_orthologue; AFUA_2G12370)"
FT                   /note="transcript_id=CADANIAT00006698"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006698"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006698"
FT                   /db_xref="GOA:Q5AZJ0"
FT                   /db_xref="InterPro:IPR010487"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZJ0"
FT                   /protein_id="CBF69771.1"
FT                   /translation="MPSICPKSAMISLPTVLQSIFAFEVAPQIRNSSVRSLNRSSLRHR
FT                   LRSTRTITTVSIDSIPVPSAQKPDDRVTSPSEPSLTADKSTASDTSSSNPASKATSADN
FT                   SGSARRTKTNTKTSNEKQASDHENKKNIKKSAKETTASNAPKPPKEKEPWQIQKEALKR
FT                   KFPTGWAPPKKLSPDAMEGIRHLHHIAPDQFTTPVLAEEFKVSPEAIRRILKSKWRPSG
FT                   EELEERRKRWEKRHDRIWSHLSELGLRPKVPDYGSDADAVLYKRKSKGV"
FT   gene            642949..645505
FT                   /locus_tag="ANIA_06289"
FT                   /old_locus_tag="AN6289.4"
FT                   /product="intracellular protein transport protein (Sat1),
FT                   putative (AFU_orthologue; AFUA_2G12380)"
FT   mRNA            join(642949..643489,643550..644572,644622..645505)
FT                   /locus_tag="ANIA_06289"
FT                   /old_locus_tag="AN6289.4"
FT                   /note="transcript_id=CADANIAT00006699"
FT   CDS_pept        join(642949..643489,643550..644572,644622..645505)
FT                   /locus_tag="ANIA_06289"
FT                   /old_locus_tag="AN6289.4"
FT                   /product="intracellular protein transport protein (Sat1),
FT                   putative (AFU_orthologue; AFUA_2G12380)"
FT                   /note="transcript_id=CADANIAT00006699"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006699"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006699"
FT                   /db_xref="GOA:Q5AZJ1"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR014848"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZJ1"
FT                   /protein_id="CBF69773.1"
FT                   /translation="MSSDIQVFVKWKDQSIFAGEDVECTITFKNVAERSEDLNNAQSPH
FT                   LRKQSRAAVTPRSESFSLRLPSNPFRNPNRRSYPVSPGKSPSHRISSSVSSPLIGSHSF
FT                   PPPSTPRTGPSAGHKHKRSVSILSIDSEGGNSSIVGDKAPRTPSQLTHSRPVRGHGRSA
FT                   SLQVVPKRYEGYEDNAKGLRSPIRGFLSSEYPMQPSPGGTRVDMDVMKPSGSSGAPSPV
FT                   RPTPQIRTPGRRPQLPPIDFKFPPAPENDTSTGPSPGTPLTTTRDSSSLAAPGQMSQSK
FT                   VLSASSLSGSHRSSTEFYSLSNNSTETLQSEYTNYSNPMLRAGYSRHNRHMSSMESALP
FT                   VPNGQALLMGYAQISASFTVDGSLINQSAFDEVKRQGMVGGARNGGAANSRPASSSGKN
FT                   RKGGGFWGALNWNSIEESISGLLSNNDLDGLRDMRGVSSSRSIPLLSTPQSLLFVDLRL
FT                   APGEEQSFSFAFTLPSGLPASHKGKAIKISYNLVIGTQRPSGSHEPQKVNRISIPFRVF
FT                   SGVNAQGEIIGHDLMRPYVILRDEARVQKIGSAPPMTAKAESISRPAWTSAPEFLSYVD
FT                   EILEQRSRSSSLKLPSTLAERRASYDLTGGPLSCKDAIDLAILRSNQTINSSQSPNRFE
FT                   IARGGRRIAVVVLNRPAHRLGETLIATVNLADAALPCYALRATLESSEKVAPHLAVRSG
FT                   ASIRRATRRVHASFFEITLYSTRVVFSPAIPISATPTTLTSGVNVEWELRFEFVTTNTR
FT                   GQLGAGPSGVRLLETVSEDERGATMSALEHVGCESFEVAIPITIYGETVRERLPEENEG
FT                   YPI"
FT   gene            646098..647188
FT                   /locus_tag="ANIA_06288"
FT                   /old_locus_tag="AN6288.4"
FT                   /product="protein kinase regulator (Mob1), putative
FT                   (AFU_orthologue; AFUA_2G12390)"
FT   mRNA            join(646098..646120,646328..646491,646547..646640,
FT                   646693..646826,646882..647188)
FT                   /locus_tag="ANIA_06288"
FT                   /old_locus_tag="AN6288.4"
FT                   /note="transcript_id=CADANIAT00006700"
FT   CDS_pept        join(646098..646120,646328..646491,646547..646640,
FT                   646693..646826,646882..647123)
FT                   /locus_tag="ANIA_06288"
FT                   /old_locus_tag="AN6288.4"
FT                   /product="protein kinase regulator (Mob1), putative
FT                   (AFU_orthologue; AFUA_2G12390)"
FT                   /note="transcript_id=CADANIAT00006700"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006700"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006700"
FT                   /db_xref="GOA:Q5AZJ2"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="InterPro:IPR036703"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZJ2"
FT                   /protein_id="CBF69775.1"
FT                   /translation="MASFITTINARTRAPFKPRSAAKGTTSYQLRQFAEATLGSGSLRK
FT                   AVKLPEGEDLNEWLAVNVVDFYNQINLLYGAITEFCSPQTCPEMKATDEFEYLWQDSEN
FT                   YKRPTKMSAPEYIEHLMSWVQGNIDNEQMFPSRLGVPFPKAFSSLVRQIFKRMYRVYAH
FT                   IYCHHYPVIVHLGLEPHLNTSFKHYVLFIDEHRLASGKDFWGPLGDLVDSMLRSD"
FT   gene            647420..648680
FT                   /locus_tag="ANIA_06287"
FT                   /old_locus_tag="AN6287.4"
FT                   /product="ATP synthase oligomycin sensitivity conferral
FT                   protein, putative (AFU_orthologue; AFUA_2G12400)"
FT   mRNA            join(647420..647679,647852..648166,648266..648355,
FT                   648414..648680)
FT                   /locus_tag="ANIA_06287"
FT                   /old_locus_tag="AN6287.4"
FT                   /note="transcript_id=CADANIAT00006701"
FT   CDS_pept        join(647515..647679,647852..648166,648266..648355,
FT                   648414..648527)
FT                   /locus_tag="ANIA_06287"
FT                   /old_locus_tag="AN6287.4"
FT                   /product="ATP synthase oligomycin sensitivity conferral
FT                   protein, putative (AFU_orthologue; AFUA_2G12400)"
FT                   /note="transcript_id=CADANIAT00006701"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006701"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006701"
FT                   /db_xref="GOA:Q5AZJ3"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZJ3"
FT                   /protein_id="CBF69777.1"
FT                   /translation="MLSARLARAGLRASAQVSVPRTAAVNGLRTYATAAQEVKPPVSLF
FT                   GVDGTYATALYTASAKSSSLDATSKALNNLGAALKADPKLTSIISTPTLSAADKQAIVT
FT                   ELQKVAGADKGDILKNFLATLAENNRLGLLNDVVDKFAALMSAHRGEIELSITSAQELD
FT                   AKTLNRLEKAVSKSEFSQGKKLKVVSKVNPDIVGGLIVEIGDRTIDLSVSSKIAKLNKA
FT                   LTDAL"
FT   gene            complement(649038..652798)
FT                   /locus_tag="ANIA_06286"
FT                   /old_locus_tag="AN6286.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(649038..649549,649621..650406,
FT                   650443..650497,650604..652047,652100..652199,
FT                   652269..652386,652434..652456,652555..652570,
FT                   652675..652798))
FT                   /locus_tag="ANIA_06286"
FT                   /old_locus_tag="AN6286.4"
FT                   /note="transcript_id=CADANIAT00006702"
FT   CDS_pept        complement(join(649105..649549,649621..650406,
FT                   650443..650497,650604..652047,652100..652199,
FT                   652269..652386,652434..652456,652555..652570,
FT                   652675..652798))
FT                   /locus_tag="ANIA_06286"
FT                   /old_locus_tag="AN6286.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006702"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006702"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006702"
FT                   /db_xref="GOA:Q5AZJ4"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR031335"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZJ4"
FT                   /protein_id="CBF69778.1"
FT                   /translation="MVLIDKQSYTSREEQRLKEDRDRIRYWKKWGPYVAERQWATVRED
FT                   YSANGDAWSYFTHDHARSRTYRWGEDGIAGVCDTHNLQNIAFAFWNGKDGFLKERLFGL
FT                   SNPQGNHGESIKEAHFHLDNTPTHSYMKYLYKYPQNEFPYQDLVEENARRGKQDREYQI
FT                   LDTGAFDNNQYWDIFIETAKEDDDEDEIVFRVIAYNRGPEPAPLHIIPHVWFRNTWSWG
FT                   YEGREKPSIEQAAPLAVRTSHEKLGQRYVCFAPSPATGDSQEDVVPQMLFTENETNNEL
FT                   LWGTQNNQPYVKDAFHRYIVNDEKGAVNPANKGTKFAAWYAFNEGEGVPPGECAVVRFR
FT                   LSRKMEPFVNEEELDDVVEQRKTEADDFYYHISPLPMSDDLRNIQRQAFAGMMWTKQYY
FT                   HFVWDQWANGDPGMIAPPPERKHVRNQQWKHLYMDDILSMPDSWEYPFFAAWDTAFHCI
FT                   PLAMIDPDFAKRQLDVLTREWYMHPNGQLAAYEWNFGDVNPPVHAWATFRVFKIERKMY
FT                   GRQDLDFLERVFQKLLLNFTWWVNRKDFDGKNVFEGGFLGLDNIGLFNRSEPLPTGGVL
FT                   EQADSTGWMAFYCLSMLNIALELAKHRRIYEDNLEEKRVLYGTKKTGMPQEFYYDAISY
FT                   GEPWTQQLPVRSLVGLIPLYAVSTLEPELINKFPSFKRRLEWFVENRQDVAERNLASMK
FT                   SRGKGDRLLLSLVSKDRLEKILKRMLDETEFLSDHGIRSMSKYHEKHPYSMDVNGQTFR
FT                   VSYVPGDSDSGLFGGNSNWRGPVWLCVNFLLIESLLRFYMFYGDSFKVECPTGSGDYMH
FT                   LGQVAEEIQHRLQHLFARNDEGRRAVHAGSDLLNFDEHWKDYMWFHEFFDGDTGRGLGA
FT                   SHQCGWTGLIAKIIHDTGVNCRLPQTPRSPFAAATHYFDDIFTRSVRNSSRRSSSHRPF
FT                   VRRSSTSRSIGNRSDFESAFATPAPQTPVEPALDEEGKDRHGSNGTPGQEFDEHVSNYV
FT                   RSQLQRVRSQVSMGAYEDEFETQVDAANGNGNGQPHGNGNGNATNGR"
FT   gene            complement(653322..654770)
FT                   /locus_tag="ANIA_06285"
FT                   /old_locus_tag="AN6285.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(653322..653783,653845..653999,
FT                   654092..654181,654238..654770))
FT                   /locus_tag="ANIA_06285"
FT                   /old_locus_tag="AN6285.4"
FT                   /note="transcript_id=CADANIAT00006703"
FT   CDS_pept        complement(join(653677..653783,653845..653999,
FT                   654092..654181,654238..654284))
FT                   /locus_tag="ANIA_06285"
FT                   /old_locus_tag="AN6285.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006703"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006703"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006703"
FT                   /db_xref="GOA:Q5AZJ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZJ5"
FT                   /protein_id="CBF69780.1"
FT                   /translation="MTDADQDFKPKARPQSTMAQAFSSALDTAFALDTDVDYLSQTIDQ
FT                   KKYQMMIQNRELEELQAKIREAEERLKARKSMIMTGNSQSMGVHKDGGYQSTESASATT
FT                   SPTDTAGQYSSGDEQRQQPDDRQQGRNS"
FT   gene            656050..658830
FT                   /locus_tag="ANIA_06284"
FT                   /old_locus_tag="AN6284.4"
FT                   /product="hypothetical protein"
FT   mRNA            656050..658830
FT                   /locus_tag="ANIA_06284"
FT                   /old_locus_tag="AN6284.4"
FT                   /note="transcript_id=CADANIAT00006704"
FT   CDS_pept        656050..658830
FT                   /locus_tag="ANIA_06284"
FT                   /old_locus_tag="AN6284.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006704"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006704"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006704"
FT                   /db_xref="GOA:Q5AZJ6"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZJ6"
FT                   /protein_id="CBF69782.1"
FT                   /translation="MPSLPDYTPLESLLFFQTLAAQDSRPTDFASISNVLRNNKFVREN
FT                   GAFDARRLTPEALEGLYSRLMRDGSDSSASTQEPNGHNSESSPSNPKKRKIATPRSDGF
FT                   SDAKNPGFVPYLVTHLYAKYKELVTKEIRLEEKRYRDIKDEIARLEKEVHEAPREKPAE
FT                   PAPAPTHTKHEPAPEPMDLDTTETPVSQPKPDKDVNCAPILPSTGAEAQQLLAASPHKD
FT                   QPPAHVTPQSPLPETKSPAQPLGQQPAAQKNLQTQAQPQPQSQPQAPPQVTPPPQPTSH
FT                   AILHPTPPQQPHHTPQPQAPPIHPQQVQSSAQNVQRQPQPPHEKGASPPQQSLVTAPSV
FT                   PALGEPANVPPTQPVEPSSIPTAVTPTPAHDPAITPLPPSRQPQPPHPPQTNNVPVASP
FT                   TPQKTPSTVEAAGKKVVPVPPPRGPPQGSLQQWSLNQPQTPQQPSQHSPSSIPQPAGQL
FT                   KPSQPPHFQQTQKVAPQPQPVAAPSTPLPSRAIFPTPAPPVPPSGFATPIGRAQGYPST
FT                   VPRPSKPQLSIATPGSLTPWKQTPYSTLPNSPRSPDRPGPEDVSPISESAPSPFGSRAA
FT                   TPDQPEPPRRKGPGRGRKKATDANHTGPRRRTEKNTATAGKKRDRSTASSRSRGRSILS
FT                   RDEESGAEAGKIKREVPSTPSGVDTVGPERSSTSQKAPGSESRPGRGRPKRKRSELPET
FT                   ESQPQSELSQATHVDLDQSAPFVLCTRNFPRTGAPIMNDVLTHKHASIFTKPLTERDAP
FT                   GYRDLIYRPQDLKSIKSSISQGSKAVAAATEAANTPVADGESPAPNAGTPSKNTVLMLP
FT                   KTEDVIPPKAIVNSAQLEKELIRMFTNAIMYNPIPQRGFGPAFPLAPDGGSGRRQYALE
FT                   PDDGGIIKDTLEMFEDVEQAVTTWRSAEIASKTVLSLRRESTSDPNMDSADDVKG"
FT   gene            complement(659273..659883)
FT                   /locus_tag="ANIA_06283"
FT                   /old_locus_tag="AN6283.4"
FT                   /product="Diphthamide biosynthesis protein 1
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZJ7]"
FT   mRNA            complement(join(659273..659301,659331..659883))
FT                   /locus_tag="ANIA_06283"
FT                   /old_locus_tag="AN6283.4"
FT                   /note="transcript_id=CADANIAT00006705"
FT   CDS_pept        complement(join(659273..659301,659331..659883))
FT                   /locus_tag="ANIA_06283"
FT                   /old_locus_tag="AN6283.4"
FT                   /product="Diphthamide biosynthesis protein 1
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZJ7]"
FT                   /note="transcript_id=CADANIAT00006705"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006705"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006705"
FT                   /db_xref="GOA:Q5AZJ7"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="InterPro:IPR035435"
FT                   /db_xref="InterPro:IPR042263"
FT                   /db_xref="InterPro:IPR042264"
FT                   /db_xref="InterPro:IPR042265"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZJ7"
FT                   /protein_id="CBF69784.1"
FT                   /translation="MGDVTYGACCIDDYTARALGCDLLVHYAHSCLIPVDVTKIKTLYI
FT                   FVDISIDTSHLIATLERNFQPGKTIATVGTIQFNATLHGLKPVLERAGFNVVIPQITPL
FT                   SKGEILGCTSPSLSAQQIDYLLYLGDGRFHLESAMIHNPSIPAYRYDPYSRTLSRESYD
FT                   HTEMHTLRRDAIAAARTAKKWGKPTYDGHD"
FT   gene            660531..661767
FT                   /locus_tag="ANIA_10797"
FT                   /old_locus_tag="AN10797.4"
FT                   /product="hydroxymethylglutaryl-CoA lyase (AFU_orthologue;
FT                   AFUA_2G12450)"
FT   mRNA            join(660531..660828,660910..661767)
FT                   /locus_tag="ANIA_10797"
FT                   /old_locus_tag="AN10797.4"
FT                   /note="transcript_id=CADANIAT00006706"
FT   CDS_pept        join(660577..660828,660910..661719)
FT                   /locus_tag="ANIA_10797"
FT                   /old_locus_tag="AN10797.4"
FT                   /product="hydroxymethylglutaryl-CoA lyase (AFU_orthologue;
FT                   AFUA_2G12450)"
FT                   /note="transcript_id=CADANIAT00006706"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006706"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006706"
FT                   /db_xref="GOA:C8V1B0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1B0"
FT                   /protein_id="CBF69786.1"
FT                   /translation="MIKSRPGWRFLSSLRAPPTRRFATEARLTSDHVRIVEVGPRDGLQ
FT                   NEKKSISLETKLELISKLAKTGVTTIEAGSFVPAKWVPQMASTAEICEHLLQTPPQSLN
FT                   AIAYNYLVPNVKGLEGLIKVMDATGASASTPGTKTTPPTTTEISLFAAATEAFSKANTN
FT                   CTIQESLDRIRPIVALAKTKDIRVRGYVSVALGCPYEGPDVPPSKVADITATLLEMGAD
FT                   EVSVADTTGMGTAPRTMELLQALKAAGIANTDLALHFHDTYGQALVNTIVGLEHGVRIF
FT                   DSSVGGLGGCPYSKGATGNVSTEDLVHTIHGLGMHTGIDLEEMSRIGQWISDELGRPNE
FT                   SRAGKATIARLQS"
FT   gene            662053..663502
FT                   /locus_tag="ANIA_10804"
FT                   /old_locus_tag="AN10804.4"
FT                   /product="Golgi integral membrane protein (Cln3), putative
FT                   (AFU_orthologue; AFUA_2G12480)"
FT   mRNA            join(662053..662182,662238..662946,662995..663502)
FT                   /locus_tag="ANIA_10804"
FT                   /old_locus_tag="AN10804.4"
FT                   /note="transcript_id=CADANIAT00006707"
FT   CDS_pept        join(662053..662182,662238..662946,662995..663502)
FT                   /locus_tag="ANIA_10804"
FT                   /old_locus_tag="AN10804.4"
FT                   /product="Golgi integral membrane protein (Cln3), putative
FT                   (AFU_orthologue; AFUA_2G12480)"
FT                   /note="transcript_id=CADANIAT00006707"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006707"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006707"
FT                   /db_xref="GOA:C8V1B1"
FT                   /db_xref="InterPro:IPR003492"
FT                   /db_xref="InterPro:IPR018460"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1B1"
FT                   /protein_id="CBF69788.1"
FT                   /translation="MPGEQQMLPLPGSPSTSWARFRAQLGALFHGADPNVCVAFWLFGL
FT                   INNVLYVIILSAALDLVGPNVPKGVVLLADVLPSFGTKLVAPYFIHTVPYSMRIVICVV
FT                   LSALGMLVVALSPAYVDGGSISSKLAGIILASLSSGIGELSFVGLTHFYGPFSLAAWGS
FT                   GTGAAGLVGAGAYALATTSLGLRVKTTLMTSAFLPFVLAVSFFFVLPRARIQLHSVYGD
FT                   VEEHADDSVLSNNDDGEREGLLSSSAHSAVSLKSTYRVRGWHRLRANLRRARGLFFPFM
FT                   LPLLLVYIAEYTINQGVSPTLLFPLKETPFTHFRAFYPAYNAIYQVGVFISRSSTPFFR
FT                   IHDLYLPSILQIINLIVLTLHSLFNFIPNVYLIFIVIFWEGLLGGLVYVNTFAEIGDRV
FT                   PREDREFSLSATTVSDSGGICIAGFLGMVFEVWLCDWQVSHGRDFCRRT"
FT   gene            664226..666666
FT                   /locus_tag="ANIA_10805"
FT                   /old_locus_tag="AN10805.4"
FT                   /product="lipase, putative (AFU_orthologue; AFUA_2G12490)"
FT   mRNA            join(664226..664368,664428..666666)
FT                   /locus_tag="ANIA_10805"
FT                   /old_locus_tag="AN10805.4"
FT                   /note="transcript_id=CADANIAT00006708"
FT   CDS_pept        join(664226..664368,664428..666666)
FT                   /locus_tag="ANIA_10805"
FT                   /old_locus_tag="AN10805.4"
FT                   /product="lipase, putative (AFU_orthologue; AFUA_2G12490)"
FT                   /note="transcript_id=CADANIAT00006708"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006708"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006708"
FT                   /db_xref="GOA:C8V1B2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1B2"
FT                   /protein_id="CBF69790.1"
FT                   /translation="MIGMLNRPGMPDVTLRIGLDHVLGRPSTRFRKVQVIAVFLFWSYY
FT                   LLRGNKHGPPVVRGISARLSRRLTVWQTTVVVVLWLYFCRNFAKIVGLESPEPLANLYS
FT                   RSFFRATWITTALDAGFWTAMRVRPKWLRDILSLIGTVYYLFAAEQADDKVRRVRATLT
FT                   VEHLRVSWNKGTTPYLWALASLVRPRLTRYPPRAIRIPRPRQSIYTEPTNAWLYFDGPM
FT                   SALREQTCIVLDIPGGGFVSMTPRHSEDRLLAWAGKTKLPILSLNYKKAPEYPYPYALN
FT                   ECYDVYHSIFTTRGRCLGLAGDVPPRIILTGDSAGANLAVGTALMVLQSSDRRPSLAQG
FT                   QSSLPAPDGLVLSYPALNMKIESWMSEEHVALIQDKSTNRSVVQRKDMDYKRLTPFATP
FT                   GASSDDLQKNSYLSEPDLETGALVEEAKGSKIDEDEEALDMQTAYLANNQPKKIQTRLA
FT                   VSSMISYVNDRILSPEMMRAMVILYIGPHNRPDFNTDYLLSPVLAPEALLAQFPKTYII
FT                   TGERDPLVDDTVVFAGRLRQAKLRRFQERQELGLEKSQRRFNEKDYVEVSLLPGISHGF
FT                   MQMAGFFPDSWKHIYRCAAWIQTLVDMANIKKSSPSTSSRNLSNSHTSKSDFNQATRPS
FT                   HKRTLTGESSADEDKPLEMSIGKMGPLTPMVCNSTEGDSDGHVPTPMVEAETETEVETE
FT                   QSPRTSDITTSSSKADDQKSTGGRRPRGRHARSTGLGRRRTFAPSNINIAPEWASDPVS
FT                   PMRPRESSLCSLPSEEDLLRRRMSGLAGGLMGIGEGARTP"
FT   gene            667476..668420
FT                   /locus_tag="ANIA_06281"
FT                   /old_locus_tag="AN6281.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(667476..667630,667757..668420)
FT                   /locus_tag="ANIA_06281"
FT                   /old_locus_tag="AN6281.4"
FT                   /note="transcript_id=CADANIAT00006709"
FT   CDS_pept        join(667476..667630,667757..668420)
FT                   /locus_tag="ANIA_06281"
FT                   /old_locus_tag="AN6281.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006709"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006709"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006709"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZJ9"
FT                   /protein_id="CBF69791.1"
FT                   /translation="MAPSSSDVEAQVLLETKEYDSYAWVLLDDHPLRAYPADTDCHPEV
FT                   TAFARKCLIVQSLVQLPHIMSYFLEQVYTQDLPGFIQTPETIGRSPGLGLELDQSAICK
FT                   YDAPLQTDGVTGDAVEYILASGCTGVKVDLWQRDRELLVGSSLLNLNDDHTLQSVYLQS
FT                   LQTNLDARNPAYINSTKKHGAKAEIVPVGLFDEDSTQTFILLLDVQTTLQRAWPLLFGQ
FT                   LEALNKSGYLSFRNAEQDLILRPVTVVVSGRGCRRLSLIDDVSRAIKGSS"
FT   gene            669997..673340
FT                   /locus_tag="ANIA_06280"
FT                   /old_locus_tag="AN6280.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(669997..670148,670340..672032,672081..673340)
FT                   /locus_tag="ANIA_06280"
FT                   /old_locus_tag="AN6280.4"
FT                   /note="transcript_id=CADANIAT00006710"
FT   CDS_pept        join(670076..670148,670340..672032,672081..673104)
FT                   /locus_tag="ANIA_06280"
FT                   /old_locus_tag="AN6280.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006710"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006710"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006710"
FT                   /db_xref="GOA:C8V1G2"
FT                   /db_xref="InterPro:IPR013951"
FT                   /db_xref="InterPro:IPR036609"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1G2"
FT                   /protein_id="CBF69793.1"
FT                   /translation="MNPPQSHDHSRRRSWGSSGSSAFPGQSDQSSAPSSGARRMPPPSP
FT                   PQHYPSRGQSGNSSSLSTPFLSREPPSTAAHHRPGSSMSISAMLGSDADRPPRDIGSSI
FT                   FSRLPASSGPFGSAPPPPAAPSAMSPPTAPARPAQHDYPLFRRSQTPEKPYSRNNQPSR
FT                   PYRSSSGGGPPTTAAEQPKYGGLSRLPSAPQYSGKPSSAHPSPQVSPAEPSYNGNETRR
FT                   LSFSGPPRPNSQPQHLEPPPRPPGYSPLSRHAAAPGEGSFGASHQRASSYLGHDSQHGR
FT                   YAGLYGDRQAEEQGRRDKERGMSQPENKVGAAPSRYGSLYADRDATAGRQSSSSAWEIG
FT                   RSQPASPESKRLSTAEQNSYSFGFGAIQNYTKTLGSQPGGARQPLPVQTQQGPKTSSPR
FT                   DQPAYLNKRHSGSHLYGGTSSGPSSTFAHSVADDQPRKGSDELLHHRNLLGVGLNAKQG
FT                   RASPLPQAVQGAQAQILGPAGESGIKSELGRVFAGIGSGVGGVTATSTGSGPSTPMTAS
FT                   PFKRDSLTARPTNTEQTDESKIARPSSATGKRPRKSEEENHADGEDVVDVRLGGSTRGG
FT                   RRSRAAHHHHHHHHHHHHHKPEEEHSPFGSSHRPLGMNMFHRSNDGLGSETAHPHHHHH
FT                   HHHHHHVPRTAASTAMTSMREPRTVVTIEPVLSRVAHLPRQHLGSTLYAPRIGVPTAKA
FT                   TLESAKFGYTTTPLPLPRFDGKENCTFTIRVPRFRIDNSHREEICARRALWGTGIYTDD
FT                   SDPVAAAIHSGFIRGAWGEDVDPDMLDLEIKDSFQHAPKTAKDMGLDGDQRPKIPPPPP
FT                   SGKDLHITLLILPKLERYESSVLFGLKSRVWEQNHDGMSFKVLRIEWVDEGVGRAEERS
FT                   GEARRKRLRNAIQSGRICTGPGVVKLDQLRSGIVQVPRRETKAIEGQDQPASAMPIVS"
FT   gene            674080..676466
FT                   /locus_tag="ANIA_06279"
FT                   /old_locus_tag="AN6279.4"
FT                   /product="hypothetical protein similar to carnitine acetyl
FT                   transferase (Eurofung)"
FT   mRNA            join(674080..674218,674279..674324,674411..676073,
FT                   676124..676466)
FT                   /locus_tag="ANIA_06279"
FT                   /old_locus_tag="AN6279.4"
FT                   /note="transcript_id=CADANIAT00006711"
FT   CDS_pept        join(674126..674218,674279..674324,674411..676073,
FT                   676124..676256)
FT                   /locus_tag="ANIA_06279"
FT                   /old_locus_tag="AN6279.4"
FT                   /product="hypothetical protein similar to carnitine acetyl
FT                   transferase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006711"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006711"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006711"
FT                   /db_xref="GOA:C8V1G3"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="InterPro:IPR039551"
FT                   /db_xref="InterPro:IPR042231"
FT                   /db_xref="InterPro:IPR042232"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1G3"
FT                   /protein_id="CBF69795.1"
FT                   /translation="MFTAAARSRFSSTLARPRLAPTNSLLARSSVASTMAPRRKASSVP
FT                   EGYKEDLSKGNMLRFEDSLPRLPVPSLEETGRRYLKSVHAVVSEAEYENTKKAVEEFIR
FT                   PGGAGQTLQERLLARAADPKHKNWLTEWWNNAAYLGYRDPVIPYVSYFYSYRDDRARRD
FT                   PVKRAAAITTAALEFKSQVDNGSIEPEYLRKIPQAMSSYQYMFNCCRIPAEPADYPQKY
FT                   PAEENQHIVVVRKNQFFKVPVVIDGRPLNVSELEQQFERIYKIAKKAPPVGVLTVANRD
FT                   HWTAARKKLLEAHPNNANALRDIESSGFVVCLDDASPVTLEERAEQYWHGDGHNRWFDK
FT                   PLQFIVNENGTAGFMGEHSMMDGSPTHRLNDHLNALIFNNKIDLSAKPVRSNLPDPRPI
FT                   DFHLNEEVQEAIDVAAKEHRQQIAAHELRVQAYQGYGKGLIKKFKCSPDAYVQMIIQLA
FT                   YFKMYGKNRPTYESASTRKFAEGRTETIRTVSDESVAFCKAITNSSVPREEAVRLFRTA
FT                   LAAHSKYTAEASDGKGVDRHLFGLKKLVREGEPLPAIFSDPAYSYSSSWYLSTSQLSSE
FT                   YFNGYGWSQVIDDGFGIAYMINENSLNFNIVCKRIGAERMSYYLNEAAGDIRDMLMPDL
FT                   AAEAEKAKL"
FT   gene            complement(676755..678519)
FT                   /locus_tag="ANIA_06278"
FT                   /old_locus_tag="AN6278.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(676755..676786,676974..677051,
FT                   677462..677563,677649..678519))
FT                   /locus_tag="ANIA_06278"
FT                   /old_locus_tag="AN6278.4"
FT                   /note="transcript_id=CADANIAT00006712"
FT   CDS_pept        complement(join(676755..676786,676974..677051,
FT                   677462..677563,677649..678519))
FT                   /locus_tag="ANIA_06278"
FT                   /old_locus_tag="AN6278.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006712"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006712"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006712"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZK2"
FT                   /protein_id="CBF69797.1"
FT                   /translation="MSPDINSLPPSRSASASPRQRRTLSSLLDAVPSTGASSTSTSHNN
FT                   NHFNSSTMASELPHRHHPISVSERRRSGNVNVNSSGNRLSESIGDNPSASPSDGPRSNI
FT                   LNFAASPVSGFGDPHHHRAPSLGELHQELEQEQEAQVVRQTASFSASLMVDNAQNRLLQ
FT                   IIRNQELRIQQLEQQQHPQQSAILGDATNSTEHSVSFPHTNSLSNFAGSRTSTQLPSSL
FT                   SSRRPSQAHSPSLRPTDLSRDASEWVAVPGDGLGRRGSLSREESSFFQAEAASLARENQ
FT                   MLRQRIRELERQLSGQSANIMTSSRMSGNASVRESQAASAESDDIPVEDKMMTRYTPHR
FT                   SLFHSPSFLRKPEIKRPLYA"
FT   gene            680507..683014
FT                   /locus_tag="ANIA_06277"
FT                   /old_locus_tag="AN6277.4"
FT                   /product="MFS multidrug transporter, putative
FT                   (AFU_orthologue; AFUA_2G12550)"
FT   mRNA            join(680507..680752,680896..682388,682439..682483,
FT                   682548..683014)
FT                   /locus_tag="ANIA_06277"
FT                   /old_locus_tag="AN6277.4"
FT                   /note="transcript_id=CADANIAT00006713"
FT   CDS_pept        join(680912..682388,682439..682483,682548..682849)
FT                   /locus_tag="ANIA_06277"
FT                   /old_locus_tag="AN6277.4"
FT                   /product="MFS multidrug transporter, putative
FT                   (AFU_orthologue; AFUA_2G12550)"
FT                   /note="transcript_id=CADANIAT00006713"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006713"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006713"
FT                   /db_xref="GOA:C8V1G5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1G5"
FT                   /protein_id="CBF69799.1"
FT                   /translation="MASPLSEKEIETSQRLREPEASSTSQDDAIIETEKNKDTADLDSK
FT                   SQLPRDPTAGTTLHQLENKPGEKIELTEDDCYDQLGYAWPSWKKWMVISVIFLVQTSMN
FT                   FNTSLYSNALVGISEEFGVSMQAARCGAMIFLVLYAFGCELWAPWSEELGRKPILQASL
FT                   FLVNVWQLPVALAPNFASIMVGRALGGLSSAGGSVTLGMIADLWEADEQQYAVACVVFS
FT                   SVAGSVIGPVVGGFVEAYLPWRWNIWIQLIFGGFVQIAHLLFVPETRTTILMDRIAKKM
FT                   RKSGENPNIYGPNELVPYSERFSMQEILVTWIRPFKMFLTEPIVLTLSLLSGFSDALIF
FT                   MFIQSFGLVYDQWGFGTVALGLSFIPILVGYLIAWFSFIPAIKRNIRERREKPDDEQAQ
FT                   YESRLWWLLWTAPCLPIGLIGFAWTSLGPPIHWIGTMVFSAIVGIANYSIYMATIDYMI
FT                   CAYGPYSASATGGNGWARDFLAGVLTIPATPFFQNIGGKYHLEYASTILFCISFLLVIA
FT                   VYAIYWYGPTLRKRSPFAQQLSDAKAELQSHGAIHTGRLSRVPTGSRANSFARSQQNLR
FT                   IRQTLGSRQNSFAASRPTSRSASARQSFSEV"
FT   gene            683714..684213
FT                   /locus_tag="ANIA_06276"
FT                   /old_locus_tag="AN6276.4"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase family
FT                   protein (AFU_orthologue; AFUA_2G12560)"
FT   mRNA            join(683714..683863,683933..683995,684061..684213)
FT                   /locus_tag="ANIA_06276"
FT                   /old_locus_tag="AN6276.4"
FT                   /note="transcript_id=CADANIAT00006714"
FT   CDS_pept        join(683714..683863,683933..683995,684061..684213)
FT                   /locus_tag="ANIA_06276"
FT                   /old_locus_tag="AN6276.4"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase family
FT                   protein (AFU_orthologue; AFUA_2G12560)"
FT                   /note="transcript_id=CADANIAT00006714"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006714"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006714"
FT                   /db_xref="GOA:Q5AZK4"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZK4"
FT                   /protein_id="CBF69801.1"
FT                   /translation="MSSEPQFAEGFDPEQLRPQLNGLQDQGWRLDEDKIGIKKTFYFRS
FT                   YFKAVSFLNVIASQSATKKHHATMTVRIGSVDVHWTTHHPRGLTDKDISMAQFCEQAAE
FT                   LMGAVQEGQGQKCGPAT"
FT   gene            685728..688124
FT                   /locus_tag="ANIA_06275"
FT                   /old_locus_tag="AN6275.4"
FT                   /product="peptidase family M20/M25/M40 protein
FT                   (AFU_orthologue; AFUA_2G12570)"
FT   mRNA            685728..688124
FT                   /locus_tag="ANIA_06275"
FT                   /old_locus_tag="AN6275.4"
FT                   /note="transcript_id=CADANIAT00006715"
FT   CDS_pept        685728..688124
FT                   /locus_tag="ANIA_06275"
FT                   /old_locus_tag="AN6275.4"
FT                   /product="peptidase family M20/M25/M40 protein
FT                   (AFU_orthologue; AFUA_2G12570)"
FT                   /note="transcript_id=CADANIAT00006715"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006715"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006715"
FT                   /db_xref="GOA:Q5AZK5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZK5"
FT                   /protein_id="CBF69803.1"
FT                   /translation="MSLNTKSSQPSVSERRGHQVAPLHVQTNFSRPNSQIVNVASPLKQ
FT                   RPRPSDFENNKTERVPLQAPHVKRQSSRSSLRHIFSREKPARKSDVRLSGIEEAQDLVN
FT                   ESRAEEAVPSSPKAEDCETPRAAVASVAPTPATPTAPTNTPRSKLQPKHRTKTDEEDQL
FT                   PAEDVAWKPPPLFKAYPQSLKHATLPAPVLSSDSIMRLHATFRAREANLRDNDQQASQP
FT                   ANEEPVEEPTTRKKKLDKEKQKYLRALSENVEKGEWTQKTFIIATSGYILQYAGEGKHD
FT                   RLPEKMLLLGPKSVAFASDAIPGKHWVLQVSQGSEEDSSTTSAESSRPILSRFGFHRSH
FT                   ARRLARNMLLVFNDPEEMSSWLLAVRAQIETRGGKKYVSEKVYDEGMESQLRTTPSMRQ
FT                   MVKKDPNRFSAVYLQPRQSMNFEDKDSSVGDQSRRSSYISLHRRSMVMHPKPESRAGSV
FT                   STAQTEEEPARFYAAVGSPPLPDSSIIAEPTLSVAGPASPTFSTPRKRQSMFLPQATSS
FT                   EAAEIPRAQSAVPEAHFRSASPPAPNFSVPLFSKRFAARQDRHQGPRLPSVQGDHPDDT
FT                   SIDTVSMFSSPPQSPSRDGFAIPLDNREQRQLAERRDQNNKSLRTSNSEDTLANVPRER
FT                   DRSRLRYSHLPEHVAMLPCQSTSPRRVSVKPVVPSASHQPMPIAQVVNTSNHSDQPSKT
FT                   DQPSRPSSIVMARRKSMTGLTAGPPSAPPPNIPLPKIPSAFVDRSPQVALSEKSPPSSP
FT                   VKDVQQALGDVAPISSARSHLPRTVRSVTTRPMNTPAKYSGANYI"
FT   gene            689249..690688
FT                   /locus_tag="ANIA_06274"
FT                   /old_locus_tag="AN6274.4"
FT                   /product="short chain dehydrogenase/reductase family
FT                   (AFU_orthologue; AFUA_7G04540)"
FT   mRNA            join(689249..690237,690425..690447,690537..690688)
FT                   /locus_tag="ANIA_06274"
FT                   /old_locus_tag="AN6274.4"
FT                   /note="transcript_id=CADANIAT00006716"
FT   CDS_pept        join(689375..690237,690425..690447,690537..690688)
FT                   /locus_tag="ANIA_06274"
FT                   /old_locus_tag="AN6274.4"
FT                   /product="short chain dehydrogenase/reductase family
FT                   (AFU_orthologue; AFUA_7G04540)"
FT                   /note="transcript_id=CADANIAT00006716"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006716"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006716"
FT                   /db_xref="GOA:Q5AZK6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZK6"
FT                   /protein_id="CBF69805.1"
FT                   /translation="MSAQTSNDHFKLENLFSVKGKVALVTGGGSGIGLMATQALAKNGA
FT                   KVYITGRTSEKLNRVAELYSKNIDGQIIPLTADVTDKSSIEKLVEEISSNEKALDILIN
FT                   NAGVSSATQDTDKQTPEDLRKALFEDASSSMEEWDKTYRTNVVQCFYTTTAFLPLLQKA
FT                   TDAQRGWSSTVINISSISGIVKASQHHFAYNASKAATIHLTKMLAHEVASSGLKIRINN
FT                   IAPGVFPSEMTASESDEKQKSALPKEKYEGKVPAGRPGKDEDMAATVLFAATNQYLNGQ
FT                   TIVVDGGPVLGGLQYLGETSGKAYHQFDLEHPSAEYVSLTNGYCLALPAIGNISFNRIS
FT                   LLLLI"
FT   gene            complement(690843..691462)
FT                   /locus_tag="ANIA_06273"
FT                   /old_locus_tag="AN6273.4"
FT                   /product="allergenic cerato-platanin Asp F13
FT                   (AFU_orthologue; AFUA_2G12630)"
FT   mRNA            complement(690843..691462)
FT                   /locus_tag="ANIA_06273"
FT                   /old_locus_tag="AN6273.4"
FT                   /note="transcript_id=CADANIAT00006717"
FT   CDS_pept        complement(690986..691462)
FT                   /locus_tag="ANIA_06273"
FT                   /old_locus_tag="AN6273.4"
FT                   /product="allergenic cerato-platanin Asp F13
FT                   (AFU_orthologue; AFUA_2G12630)"
FT                   /note="transcript_id=CADANIAT00006717"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006717"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006717"
FT                   /db_xref="GOA:Q5AZK7"
FT                   /db_xref="InterPro:IPR010829"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZK7"
FT                   /protein_id="CBF69807.1"
FT                   /translation="MKLATLLPAFAAAALAAPSNPLVARQTSGTSTLSYDTKYDVADTS
FT                   LTTVACSDGDYGLITEGYTTFGSLPTFARIGGAPTIPGWNSPNCGSCYQITYTSATGQT
FT                   NSIIMTAIDTAPGGFNVGQQAMDLLTGGRAAELGRVDITWTQVGREQCGLTPRP"
FT   gene            complement(693214..694688)
FT                   /locus_tag="ANIA_06272"
FT                   /old_locus_tag="AN6272.4"
FT                   /product="NADPH-adrenodoxin reductase Arh1, putative
FT                   (AFU_orthologue; AFUA_2G12610)"
FT   mRNA            complement(join(693214..694083,694129..694563,
FT                   694617..694688))
FT                   /locus_tag="ANIA_06272"
FT                   /old_locus_tag="AN6272.4"
FT                   /note="transcript_id=CADANIAT00006718"
FT   CDS_pept        complement(join(693214..694083,694129..694563,
FT                   694617..694688))
FT                   /locus_tag="ANIA_06272"
FT                   /old_locus_tag="AN6272.4"
FT                   /product="NADPH-adrenodoxin reductase Arh1, putative
FT                   (AFU_orthologue; AFUA_2G12610)"
FT                   /note="transcript_id=CADANIAT00006718"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006718"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006718"
FT                   /db_xref="GOA:Q5AZK8"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZK8"
FT                   /protein_id="CBF69809.1"
FT                   /translation="MYEKLPVPFGLARYGVAPDHPEVKNCEEKFTEVAASPRFNFIGNV
FT                   ELGETLPLRVLKPHYDAILFAYGAPKDKKLGIQGEDALRSVYSAREFVGWYNGLPEHRD
FT                   LNPDLAAGEDAVIIGQGNVALDVARILLSGVDRLRQTDIADYALETLSSSKIKRVRVVG
FT                   RRGPLQASFTIKEVRELLQLPSVSFDPIPRDLLPPEDVISALPRAQKRLIQLLSKGSTN
FT                   DPTTTTKSWSLDFLLSPECLNWSPVFPYRLSHVRFARNELDPADPFSASAKVRPKHLSD
FT                   GKPAKVNIPANTFFRSVGYKGLPLPGLEDLGVPFDESRGVIPNDGFGRVTVPLASEAGT
FT                   HDTLPNGSLISHLPGLYCAGWVKRGPTGVIATTMTDAFSTADAIAADVAQHGNTLLNPS
FT                   NERTGLGWEGVRAEAEQRGVRATTWEDWERIDRAERERGSLKSKPREKFGRVEEMLAAL
FT                   "
FT   gene            695556..698016
FT                   /locus_tag="ANIA_06271"
FT                   /old_locus_tag="AN6271.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(695556..695726,695775..695966,696016..698016)
FT                   /locus_tag="ANIA_06271"
FT                   /old_locus_tag="AN6271.4"
FT                   /note="transcript_id=CADANIAT00006719"
FT   CDS_pept        join(695556..695726,695775..695966,696016..697758)
FT                   /locus_tag="ANIA_06271"
FT                   /old_locus_tag="AN6271.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006719"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006719"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006719"
FT                   /db_xref="GOA:Q5AZK9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZK9"
FT                   /protein_id="CBF69811.1"
FT                   /translation="MGKSPPFLYGPPDAFSFRGPTDPPFNPKAVTQASWTRPPPKKKQK
FT                   GPLINFNRHPDSYCNLPDGRSRWTPMSPRTKSKVFYGRKIQLGLRILSLIGALGSLFCA
FT                   IVIKNVAASIIWIIRVGPAVAILHTLYAVYHLCRSPVTRPPGSQASYMLFATTLDLGLV
FT                   PFYTFAAYLGYKEYTTGTYNWQTLLSTDTGVITTIAKATFYLSVVNGGLHLISLGISAF
FT                   LFNIFRQIAQLPPDLNPLEDNLTSRSHKRTKSEIAEKHASSSTLDSTNSVAQPLIGVPR
FT                   TIPFTHTRVKSSEGNSLRPPVDMVKQRGNSQSSIPEMPFRYRANTLEEPYEIPLHDTDF
FT                   EARPTSSIPSSTPLRQPSPEIPTRSQCVSPASDNTTSDNWVAFPSRSVSMNEDVDNGGA
FT                   APREPSSVYSRTGTPGSLNGVVDWMGLAQKYGWDIGETISEDLRGEYESLAMHEYYGND
FT                   DDSHNVPKNGLYDHDEMDEHDIGNHRIDIYQDHEDSDGEHGNTLRVNPLGLNPPTPQPM
FT                   PDITETKPASGRMVLGDIPNLSPTPPKHKVPPLERPEKERFYNGADIHTVTDDDSKSAK
FT                   KTKLYKRKSHKLNTYGPLQQQSEDTAEKDHEPRPATDLAITDRDRKGRVVSNSGADFGL
FT                   RVGQGPNLSYGNYIAGLGVGRRRDVSGKMAEEGRGGIDSPNSKSTSGNGNANSTPRAAG
FT                   WARFAGL"
FT   gene            complement(698158..700000)
FT                   /locus_tag="ANIA_06270"
FT                   /old_locus_tag="AN6270.4"
FT                   /product="Lectin C-type domain protein (AFU_orthologue;
FT                   AFUA_2G12590)"
FT   mRNA            complement(join(698158..699882,699938..700000))
FT                   /locus_tag="ANIA_06270"
FT                   /old_locus_tag="AN6270.4"
FT                   /note="transcript_id=CADANIAT00006720"
FT   CDS_pept        complement(join(698158..699882,699938..700000))
FT                   /locus_tag="ANIA_06270"
FT                   /old_locus_tag="AN6270.4"
FT                   /product="Lectin C-type domain protein (AFU_orthologue;
FT                   AFUA_2G12590)"
FT                   /note="transcript_id=CADANIAT00006720"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006720"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006720"
FT                   /db_xref="GOA:Q5AZL0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZL0"
FT                   /protein_id="CBF69813.1"
FT                   /translation="MSLKFNPDDSLLNATWATVLLSERDVAGQVPINFVTTSAISLRAA
FT                   CFGDNKFARNAAERCISNLLAIGYRRFNIDLYWSTELRRWILCPVSIPKGLHVVTVSPD
FT                   ATSTATASVAQGTVTAELDSSDTLLYDLGSYKCSDNLDLQDLIDIFSDYFQYTNTNLVI
FT                   YTRYLSLNLHVAADPTSAEESPSTVTGEQLPAVSERVGYILNDKLGSYIYGPSRLLEDR
FT                   RNLNVSWYAVDESNKPITQYFTIEEGPEGIQTTPDGWPSANFIQLAADRRLLIEYGSVG
FT                   SQLSDHDLSAENDVIFPPNYLTSSISVDAGDNGSLDSGCLYNPGTTDISKVNSSWAMSS
FT                   HIPVPSKSSEESLRSISDLVVNLTACGMAFTLNDTLFGNTADEDPVPYRNLSLSSSWAW
FT                   ALGEPAAPSHDLDSAESDDTRCAVMDLSLAGQWRTANCSELYRAACRVDNEPFRWSLSS
FT                   DPLTYRDAYDSACPSSTKFSVPRTGLENTYLLRHLLSLSHDLIDPSASDTLKTAVWIDF
FT                   NSIDTETCWVTGGPIATCPYTADPDQLERRTVLVAAVAGIVICIIAALTLFVKCNANRR
FT                   NSRRNRRVIQGWEYEGVPS"
FT   gene            700257..701767
FT                   /locus_tag="ANIA_06269"
FT                   /old_locus_tag="AN6269.4"
FT                   /product="translocation protein sec62 (Eurofung)"
FT   mRNA            join(700257..700729,700787..701337,701391..701767)
FT                   /locus_tag="ANIA_06269"
FT                   /old_locus_tag="AN6269.4"
FT                   /note="transcript_id=CADANIAT00006721"
FT   CDS_pept        join(700294..700729,700787..701337,701391..701588)
FT                   /locus_tag="ANIA_06269"
FT                   /old_locus_tag="AN6269.4"
FT                   /product="translocation protein sec62 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006721"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006721"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006721"
FT                   /db_xref="GOA:Q5AZL1"
FT                   /db_xref="InterPro:IPR004728"
FT                   /db_xref="InterPro:IPR011553"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZL1"
FT                   /protein_id="CBF69815.1"
FT                   /translation="MATPGQPTPQQLAAMQQQFAAEAAKRGLTPEEFAKQQREQLNAEA
FT                   AKHGMTTEQYVTQLRMRAMAAQQKAAEVQRQLQANGQSQGPPRPGQPGQPGQPQTHTQQ
FT                   VPVNPNSPKDPKAIAVAQFLRSQNLKPRTCIMDGQRKDMFKVKRAIRALESPAYEKARK
FT                   KNPLLPPVTDRASAENVFKLLPLSVLALRVSKVDPHAGHGHGKTKRVKGLWTVKIEQHQ
FT                   EADPMMHYVWLYEGPQWKQKAMAAAVVAGIFAVVLFPLWPIMLRQAVWYLSVGMMGLLG
FT                   LFFAMAIFRLILFCITVFAVPPGLWLFPNLFEDVGFFDSFKPLWGWQETGKKKKKSKKA
FT                   ASSAAQTSNPQATESAPAATAETAPAATTTATESADAAGPVKRDLAPRVEEVEE"
FT   gene            complement(701942..704853)
FT                   /locus_tag="ANIA_06268"
FT                   /old_locus_tag="AN6268.4"
FT                   /product="DUF726 domain protein (AFU_orthologue;
FT                   AFUA_2G12860)"
FT   mRNA            complement(join(701942..704020,704311..704853))
FT                   /locus_tag="ANIA_06268"
FT                   /old_locus_tag="AN6268.4"
FT                   /note="transcript_id=CADANIAT00006722"
FT   CDS_pept        complement(join(701942..704020,704311..704853))
FT                   /locus_tag="ANIA_06268"
FT                   /old_locus_tag="AN6268.4"
FT                   /product="DUF726 domain protein (AFU_orthologue;
FT                   AFUA_2G12860)"
FT                   /note="transcript_id=CADANIAT00006722"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006722"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006722"
FT                   /db_xref="GOA:Q5AZL2"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR007941"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZL2"
FT                   /protein_id="CBF69817.1"
FT                   /translation="MFHRATPRSLSLIPGLRIVRTRPRCYSSNSNDTDIPSILAKPTWS
FT                   VRSLLPDHAAKPSPSVTPAELKHLLRLSALPQPSSPEEEEQILETLESQIHFVKEIQKV
FT                   DTTGVEPLQAIRDESPEAMRENTIGLEQLREAMSKERVIGRNKRIQRIESARNERPDGD
FT                   VWDGNALGYASKTKGNFFDFGSDAKGQLRDKADSKNDQDLTTILSRPQRADLTVLIAEI
FT                   TQHMRKSLDKTFKAPDAQQFATKHLIDLNDENDASTPDTQKPKDLNDKARIEYVPTAED
FT                   TKAEANILTQFDDWADSVLLRVGEVVNRASEEQNENEEAGFDLQYERPRSSYDDEDDNT
FT                   WSRLSEVYHPIETALIHLPKPKRLLILHSLLLLMLSLEHYNANSRVLMLYAASSLGLGI
FT                   KTLNQDEVKVSRGLLDAALQLPANSDAQAQGRESDPSRKWKVGIASVAGAVLIGVTGGL
FT                   AAPFIAAGLGTVMGGLGLGATAAAGYLGAVAGSGVIVGGIFGAYGGRMTGRMMDKYARE
FT                   VDDFAFLPIHGSRKHFNDEKEAAREDHRLRVTIGITGWLTEEDNFVVPWRVIGKDSEVF
FT                   GLRWETKPLLDLGHAIDRLVTSAAWSAGRHVLTKTIFAGLISALTLPVGLMKVAGIADN
FT                   PFSVAKSRADKAGEVLADALISKVQGERPVTLIGYSLGSRVIFSCLQTLSKRHAYGLIE
FT                   SAIFMGAPTPSDTPDWRRMRRVVSGRLVNVYSGNDSVLAFLYRTSSLQLGVAGLQAIEN
FT                   VPGVENLDVSDIINGHLRYQYLLGRILRTVGLECISAREVAREEAALKAKDYKQEQQRI
FT                   QNERRAGIEGDTEEARRKLESGEIAAEEEAIPQPHPEARHAIPRRPLPVRSAQENKEKD
FT                   QA"
FT   gene            705087..706556
FT                   /locus_tag="ANIA_06267"
FT                   /old_locus_tag="AN6267.4"
FT                   /product="vesicular-fusion protein sec17 (AFU_orthologue;
FT                   AFUA_2G12870)"
FT   mRNA            join(705087..705177,705239..705362,705449..705755,
FT                   705819..705993,706047..706556)
FT                   /locus_tag="ANIA_06267"
FT                   /old_locus_tag="AN6267.4"
FT                   /note="transcript_id=CADANIAT00006723"
FT   CDS_pept        join(705145..705177,705239..705362,705449..705755,
FT                   705819..705993,706047..706289)
FT                   /locus_tag="ANIA_06267"
FT                   /old_locus_tag="AN6267.4"
FT                   /product="vesicular-fusion protein sec17 (AFU_orthologue;
FT                   AFUA_2G12870)"
FT                   /note="transcript_id=CADANIAT00006723"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006723"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006723"
FT                   /db_xref="GOA:Q5AZL3"
FT                   /db_xref="InterPro:IPR000744"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZL3"
FT                   /protein_id="CBF69819.1"
FT                   /translation="MTADPRALLQKADKALQSASGGFSFFGGRTEKYENAADLYTQAAN
FT                   AFRIQKLNKEAGQAFEKAAAIQTQNLNEPGDAANTLQEAFKVYRKSDPEDAVRVLSTAI
FT                   QHYVLNGNLRRAASQQQYLAEVYEQELGDIKNALEAYEKAAEWFDADNAEALANKHYLK
FT                   AADLAALESDYYKAIEHYERIGRSSINNGLMKWSVKDYLLKAGLCHLATQDMVSANRAL
FT                   ESYRDIDPTFASTREHQLLVDLIQTIEAHDQEAFADKLFQFDQLSKLDKWKTTILLRVK
FT                   NGIEGPEEDDFA"
FT   gene            complement(706568..709234)
FT                   /locus_tag="ANIA_06266"
FT                   /old_locus_tag="AN6266.4"
FT                   /product="pre-rRNA processing protein Tsr1, putative
FT                   (AFU_orthologue; AFUA_2G12880)"
FT   mRNA            complement(join(706568..709063,709123..709234))
FT                   /locus_tag="ANIA_06266"
FT                   /old_locus_tag="AN6266.4"
FT                   /note="transcript_id=CADANIAT00006724"
FT   CDS_pept        complement(join(706743..709063,709123..709234))
FT                   /locus_tag="ANIA_06266"
FT                   /old_locus_tag="AN6266.4"
FT                   /product="pre-rRNA processing protein Tsr1, putative
FT                   (AFU_orthologue; AFUA_2G12880)"
FT                   /note="transcript_id=CADANIAT00006724"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006724"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006724"
FT                   /db_xref="GOA:Q5AZL4"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="InterPro:IPR030387"
FT                   /db_xref="InterPro:IPR039761"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZL4"
FT                   /protein_id="CBF69821.1"
FT                   /translation="MAPTSTVQHHHRSTTKTTHKPYKSGHASKRALKDQAKGKVERAER
FT                   GTRKTPHQQLMSKLDRRNQARQKQQNKQQERAQAISIFSGQNGAPRHVAIVPLSIDIDT
FT                   TAIIKALNESVDVTSDVFPDTISRVRIDRFRQNLQYIPAKYDLMSALDACRMADFVVLA
FT                   ISAHLEVEEQGELLLRSIEGQGVSNVIAVVQGLDKINPPKKRPQVAGSLKSFLNHFYPS
FT                   IDKVLSIDSRQECSNAIRSLCTATPKGIRWRDDRSWMLIEDVKWPESASPEVDDVVLTG
FT                   VVRGKGLKADRLVHVPGWGDFQIDSITAAPLPTARSKRDDAMNVDESEAPQLLDSPSAD
FT                   RDDLATVAPEEIEMEDDIESMPDTDRKGVLLDDHHYFSDDDDHIPAKPKRLPKGTSEYQ
FT                   SHWFLDDVSDSGSDVMDDDDEEDMQMDVSGAPEDGVFPDNHDAMTEGGPSEYPQSEMFL
FT                   DPSPEDEAQQLEEYRASRRNEAKDDLEFPDEIELHPNVLARERLARYRGMKSLKTSPWN
FT                   TAEDRPHEPEDWRRLLQFGDYKGSKNRILREALVGGVNPGTRVDVHLRAVPALLRNRPQ
FT                   PLSLFSLLRHEHKHTVVNINMHLNAAVEEPIKSKQELIVQYGPRRLIVNPVFSSADNTP
FT                   NNVHKFDRFLHPGRSAVATWIGPLTWGSVPVLVFKSRKTSADPEILDSADAPESTTAVG
FT                   FSTSTLELIGTGTVVAPDPTRVVAKRAIITGHPYKIHKRVVTVRYMFFNAEDVNWFKAL
FT                   QLWTRRGRSGFIKESLGTHGYFKCTFDGKINPQDSVGISLYKRVFPRKARALEEVAN"
FT   gene            709486..711507
FT                   /locus_tag="ANIA_06265"
FT                   /old_locus_tag="AN6265.4"
FT                   /product="small nucleolar ribonucleoprotein complex
FT                   subunit, putative (AFU_orthologue; AFUA_2G12890)"
FT   mRNA            join(709486..710229,710280..711507)
FT                   /locus_tag="ANIA_06265"
FT                   /old_locus_tag="AN6265.4"
FT                   /note="transcript_id=CADANIAT00006725"
FT   CDS_pept        join(709597..710229,710280..711254)
FT                   /locus_tag="ANIA_06265"
FT                   /old_locus_tag="AN6265.4"
FT                   /product="small nucleolar ribonucleoprotein complex
FT                   subunit, putative (AFU_orthologue; AFUA_2G12890)"
FT                   /note="transcript_id=CADANIAT00006725"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006725"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006725"
FT                   /db_xref="GOA:Q5AZL5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012952"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040315"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZL5"
FT                   /protein_id="CBF69823.1"
FT                   /translation="MADSAPTKAIVPTKQRKENKRLIEAQKKYGRGKAVHTHSVRDKKL
FT                   RSNLQAVEEKYKNAALRAKDAEILLEHEAGFLEPEGEMERTYRVRQDEIAASVGIETAK
FT                   KKFELKLEDFGPYRADYTRNGRELLLAGRKGHIATMDWRNGKLGCELHLRETVRDARWL
FT                   HNNQYFAVAQKKSVYIYDSQGVELHNLDRIVEPCFLEFLPYHFLLASAQMSGHLKYTDT
FT                   STGQLVAEIPTKVGAPTSLAQNPWNAIMHVGHQNGTVTLWSPNTQTPLVKALVHRGPVR
FT                   SMAIDRQGRYMVSTGQDLKMQVWDIRMYREVHSYSCHQPGAAVSISDRGLTAVGWGTQV
FT                   SVWRGLFDAATADVGKVQSPYMSWGGDGQRIENLRWAPYEDILGVAHDKGFASIIVPGA
FT                   GEPNFDALEVNPYENPKQRQEAEVRALLNKLQPGMISLDPNFVGKVDTVSDKRSREEKD
FT                   LDRRPEDTIEKLKNRGRGRNSALRKYLRKKGRRNVIDEKLLKAQALHKERSARAKERYR
FT                   AEREELGPALARFAKKDI"
FT   gene            complement(712319..713717)
FT                   /locus_tag="ANIA_06264"
FT                   /old_locus_tag="AN6264.4"
FT                   /product="hypothetical protein similar to PTAB (Eurofung)"
FT   mRNA            complement(join(712319..712732,712906..713166,
FT                   713229..713516,713583..713717))
FT                   /locus_tag="ANIA_06264"
FT                   /old_locus_tag="AN6264.4"
FT                   /note="transcript_id=CADANIAT00006726"
FT   CDS_pept        complement(join(712319..712732,712906..713166,
FT                   713229..713516,713583..713717))
FT                   /locus_tag="ANIA_06264"
FT                   /old_locus_tag="AN6264.4"
FT                   /product="hypothetical protein similar to PTAB (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006726"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006726"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006726"
FT                   /db_xref="GOA:C8V1H8"
FT                   /db_xref="InterPro:IPR029005"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1H8"
FT                   /protein_id="CBF69825.1"
FT                   /translation="MAAEALKAQQQHQQNAAMLMQQRMAMRGQSVLVLGNFAEQLSSFT
FT                   SRGEAADLAYWSSFVDRFYSPTGVLRQGVFNNQAGAKQFEIATPALARYYLTQFASGIR
FT                   QIQMLIEGPREKDLPNGGHLVECPKAFFIYWFTNDAQLFTTGTLKAQFDFQNKIEVLDI
FT                   VVMSHTEYLPRSQLQALELDQKQSPKLTKNGKRASQKQPQQPAFTLPESMVTSNGVPYP
FT                   VLQFLENANPVFMQGNMNPAMQPGPNARAPSMGGPNQFASPGMAHLNLPVGAQGSPHLP
FT                   GSAHPSPGQSNLSGPPAIGPQGQMPQQVGSASASPNVSNKRRRASTVKMEGEEAGGEVN
FT                   GAASGGAKVKASPRVGGKRQKGTAA"
FT   gene            716961..720028
FT                   /locus_tag="ANIA_06263"
FT                   /old_locus_tag="AN6263.4"
FT                   /product="mitochondrial AAA ATPase, putative
FT                   (AFU_orthologue; AFUA_2G12920)"
FT   mRNA            716961..720028
FT                   /locus_tag="ANIA_06263"
FT                   /old_locus_tag="AN6263.4"
FT                   /note="transcript_id=CADANIAT00006727"
FT   CDS_pept        716961..719831
FT                   /locus_tag="ANIA_06263"
FT                   /old_locus_tag="AN6263.4"
FT                   /product="mitochondrial AAA ATPase, putative
FT                   (AFU_orthologue; AFUA_2G12920)"
FT                   /note="transcript_id=CADANIAT00006727"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006727"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006727"
FT                   /db_xref="GOA:Q5AZL7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZL7"
FT                   /protein_id="CBF69827.1"
FT                   /translation="MYSSMQQGRLLWSLARPCRFVAHRRFPAAVTSPLRRFHLSQTWRS
FT                   STPSDPNNPRDSVPENAHSETPTLNGTFNPTHADASIDPVDRPSAKDPGPYGSPIRRAL
FT                   RSRKRSKEPVAQTVTIPDWFRERNTVLSQSWAAETQQPVNIRAVVQDDKSSADGLSSGG
FT                   NGEEPPAATGQPPLKHRYALTDALWEELCASARAGLRLPPAKYATEPSARKSHLVLHYP
FT                   GPDGILFLDAVIKRLAGELSADLVTLNAQDIAQLCVEQDLTDTGRTSPIRLLGYEVFRP
FT                   SVSNSWRESGDGMNEEDEGETDAMVPRNLRPGGMGSPKFITIESAREPGDIPLPNLFGL
FT                   KSLVAAISPSDGSVGTASSQPSYDRVEERRLQLLHKLISPGEPSGQALTPTATDQDEPS
FT                   DFVEPKQEQRGDIIVQVQDYAEIQSSREGSRFLNLLQQVIQDRRKDGHRVLFIGTAAQD
FT                   VPPDSDSSRLLQNAFDDQFSQVVVVTPAMSTDIREKTFAEDRKKRTLEVNIRHIQSMLR
FT                   TRLEEQPSAVKDEVFQSSSWPLDPSSIKDSGLDERYWSYNQVHWAATLALGSLRATEAF
FT                   GFEHIQSGLEMLRRTERVRDEWLQERTPKARSSETENNRERLISSLRKTCNSHEKKLLN
FT                   GVVDAKSIRTTFADVHVPPETIDALKTLTSLSLIRPEAFTYGVLATDKIPGLLLYGPPG
FT                   TGKTLLAKAVARESGATVLEVSGSEVYDMYVGEGEKNVKAIFTLAKKLNPCVVFIDEAD
FT                   AIFCSRTGASSRTSHRELINQFLREWDGMNDLSTFIMVATNRPFDLDDAVLRRLPRRLL
FT                   VDLPTEQDRLAILKIHLKDEALDASVDLAELARRTPLYSGSDLKNLCVAAALACVREEN
FT                   ALAQQHTGESPYQYPARRTLTWAHFTRGMEEISASISEDMSSLSAIRKFDEQFGDRKGR
FT                   RKKSPGWGFTTHVSDQAIPDAARVRT"
FT   gene            720402..722060
FT                   /locus_tag="ANIA_06262"
FT                   /old_locus_tag="AN6262.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            720402..722060
FT                   /locus_tag="ANIA_06262"
FT                   /old_locus_tag="AN6262.4"
FT                   /note="transcript_id=CADANIAT00006728"
FT   CDS_pept        720402..721757
FT                   /locus_tag="ANIA_06262"
FT                   /old_locus_tag="AN6262.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006728"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006728"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006728"
FT                   /db_xref="GOA:Q5AZL8"
FT                   /db_xref="InterPro:IPR025124"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZL8"
FT                   /protein_id="CBF69829.1"
FT                   /translation="MSSESRDEAIREAKRYVRDVVQNDWSFEFSAKPGAPPPKYPANPE
FT                   PTEVLEWRLREYDSSGSELEPQFSPIGSPERVDVGDAFDASSPQSAGSQQRRRKRRRQM
FT                   EEEMSWNEGLRTWLERRDAWSGALSREQVRMWEQKHRSMSTKDAESGDKGGNAATALDT
FT                   DAQSIPASTTSRPFAIPATGPATGESPNLASRTEALNIADNQTTPLQAQQAQDQSSDIQ
FT                   PPIPNDNAGKLEITTDAIPEIPVLPQSLTSATAVPTAEPPSTTTTTSSTPSTQDHFYDP
FT                   LIPVVPSMIATSNPIRASITPAMYPSIYSKVVIQGLTPTVPINLADMTKAMVQGWKADG
FT                   QWPPKPQNLVLANDAIVRPSNASATKHPDTPAIPASASGDKNRPSSPESKRKSGIASTV
FT                   RKVLHFSGFQHHPFHRRGSSSQNISHQEDPAEAGVGAAEGSSVGANVEQGDK"
FT   gene            complement(722626..729594)
FT                   /locus_tag="ANIA_06261"
FT                   /old_locus_tag="AN6261.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(722626..729594)
FT                   /locus_tag="ANIA_06261"
FT                   /old_locus_tag="AN6261.4"
FT                   /note="transcript_id=CADANIAT00006729"
FT   CDS_pept        complement(722626..729594)
FT                   /locus_tag="ANIA_06261"
FT                   /old_locus_tag="AN6261.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006729"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006729"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006729"
FT                   /db_xref="GOA:Q5AZL9"
FT                   /db_xref="InterPro:IPR019021"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZL9"
FT                   /protein_id="CBF69831.1"
FT                   /translation="MESWRERGFVPDSDEEDGLDSQEMGLMLDATTKSANNVSVVVSAL
FT                   RSEEVAELAGDDHHNGSDGVNSQQRDNADTCGGNTGAGKEGHDGADIVEETVAPVDEDM
FT                   DLPLLLPDRRLRTPDDDNGEAEPDLGISAAEEARSKERKKSVSSQSSNGSSTVGGSGSS
FT                   TPRPKQQHDFWDIPSSSPDLLQRDYHPWRKQTSHAIAVTPTPKAKVPSQPHSQNENAQR
FT                   ALESSPLSSPLSSPRSSILGEMEEQQQQRREALDQTFEDLLPPLDIPEDILRQLDQPER
FT                   RSLRQRNPIQLHPYLLEDAKYKSLMKARGLKPVRFPQQILQPARAADDESQEKDFGDDA
FT                   GSTSDSQTTGLQYILSSPLDSRPLSEPRPIEDTVKRGDRRFDRQPKYSARSTGQRSPKR
FT                   RRVVGPGDERQRQRYLSAPRPAPPQVVVDNVSSSEPDASSIFDIVSPLCSDSVSPSLMQ
FT                   KDTGAQFPRRFSPPVATPRTGTRESAHDNFEPVLLDDDENGLDQQSDIAGTIRSVTPSS
FT                   SSGSDLNDEDEDEDAQEAIFRRFQKKIKGVLPASWLRLDQQKQKGGSGATQRNNDRMGR
FT                   LDTEAAKGVARKITKKAHSSAPSSAREHILSLRQLAEEDNDQSSDISDDDDPQQNIARW
FT                   VGFEDSSLDQKLWPDGDIPEDNQIDYMFPTAPRNPALSGSRKRAKKRRGQEGDEVRTGG
FT                   QSKKPRLERQARLTDSVYRVQRKKRLSQKPPRLGILDAPDVASVPRNKQPQFLRIAARK
FT                   ARYREDRGRRSPSRKVIRLSSRMDTEDANASLREWRSGRVQQTTLPLVPSQTHRRQPLR
FT                   GLSTNARQIFNGLSAKRAKESDRGETRQATLMRHGIAAKEISPTVNAPPNGVQHAAPTE
FT                   YDNVTEENLLTVNAPLDITPSTRGTAMKPAQQRRGNAWIIQRNLAVTSLSRSSPRPVVP
FT                   EFDSHDSTVRQPSSLQRSLALLARDDRLPLNRFLSTGERQQGHDILQSVPPTNIEIDKP
FT                   VHAPKSAGALRPRQLRKRPPKRIDLTTNIQDFYSPNLKATEIPTGSTAQLSQGRGAGQL
FT                   RHFRTAYSVDFDVNPLHTGIFFHESTFIGSGEFSRSLNITRRDLDKNTSSSHFQLGDCS
FT                   MRWDAWDDSVSSQLGSVFDKILESAETAKAGGPGDISWNMPDSAYATYRAVIRYASEAL
FT                   SFIDPIDRAGFVTRANSLIAKLLEILSDIMAATGCSAEQFMKVASYNVVFANQVCQVAS
FT                   HSLVNQTIKHETINLAKTASRQVITLISSQAGQECLRKFLAASKQRKLQEEGIKDDHPI
FT                   VEAYVIVRHVLCSADRFRGCLEDFVAEACPEVDAKSTEKDIGILESGWQQVLTTLPLQE
FT                   IDVHGISRIGSRFQGGHDNWTVVKRLLRPVLESDEADLESRPISYYSYCRVLFQRCFIL
FT                   INGWGWRDCKPILDTLYDFFAKRTLYDLKSEESYKSPAFLDELDGNPSFQILPGDSCFH
FT                   ILLKILASGLRFLTKAYDKKTIRNYTWRLLPNHGRDYPKEQPIHQADLNALRNHHDLLC
FT                   VLYSSVPDGCRPRLGTIKDLVHPATSHRETCKISLRTWTRLARFKLSTKEDISGLEPFA
FT                   EWHGYFVTEFLKQHNLARKEIEAQIDGGNNFSQQLIDRTVAQNQRQIESLLKTALQGLQ
FT                   SAIKSAPSLEHAQKIVSQTPIKLILDLFDSRTTRLNATVLEGLQVIVMYLQKCGSLTGS
FT                   STTNSANTLISADEDSQDYGDWTDIEAVYGYESPPITSGVEHVEQVFHPAVSRLVSNCF
FT                   GDDRCPDDAVLLGVVDCWSSMAHTLVKHKLRRWDSYLSPYEADSWLALRWTTQTRKFTP
FT                   QFLAKCIEKDSEILSECKAQILGMWLSSLVERVSMLKFQHRFTEAILNWNTEDPVLRNL
FT                   PFSQNPKEERYSITLSDLSQRRLSLISCVLSNMRVHVQNLDDVKSRDLSTTRQDYREVI
FT                   QKMMSSMKSNYQELGNGEAEVKGAYVEFVQRIVGFLQQHTRDICPIDPFFTDTATFPLP
FT                   SKDPLYIVARLRSYQPKLSSAKVAKTLVIFIQSVSERAALDAEQTYFVDQLCESMKNTY
FT                   ETGNLEQPTLRATLLQGVFPAYLATAFTNGAAWILSRPIIETITRVFQELLFSIDTTDS
FT                   ACVSSVMGIFCAIFESAYRALHHIITDANMLTQPEVLITTTAFLEMITSALPVVDYLDR
FT                   LVADSSAMSHLLAQIRAFQNLSIFINACLQPRSQQSSEPHISLTPTLEVLHPSTSDLAV
FT                   SATRELQTYINESWSRHQGKYYFTRRGAHAPQEVIIDASISAKLDSLPEKGVSDAATAL
FT                   LCALDSLDLFGESKDVGDHLQTNLSWEWKEEVLVV"
FT   gene            729924..730505
FT                   /locus_tag="ANIA_10802"
FT                   /old_locus_tag="AN10802.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(729924..729980,730048..730120,730174..730505)
FT                   /locus_tag="ANIA_10802"
FT                   /old_locus_tag="AN10802.4"
FT                   /note="transcript_id=CADANIAT00006730"
FT   CDS_pept        join(729926..729980,730048..730120,730174..730279)
FT                   /locus_tag="ANIA_10802"
FT                   /old_locus_tag="AN10802.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006730"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006730"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006730"
FT                   /db_xref="GOA:C8V1I2"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1I2"
FT                   /protein_id="CBF69832.1"
FT                   /translation="MSRNFIPVVLAVVMGVGTGYYTFQPALRELQSNKGIIARSPSGSQ
FT                   SFPAAQQPEHQSQQTVSTLTSTPTPTESNTGK"
FT   gene            complement(730620..732309)
FT                   /locus_tag="ANIA_06260"
FT                   /old_locus_tag="AN6260.4"
FT                   /product="PAPA-1-like conserved region protein
FT                   (AFU_orthologue; AFUA_2G12960)"
FT   mRNA            complement(join(730620..731045,731102..731208,
FT                   731259..732309))
FT                   /locus_tag="ANIA_06260"
FT                   /old_locus_tag="AN6260.4"
FT                   /note="transcript_id=CADANIAT00006731"
FT   CDS_pept        complement(join(730794..731045,731102..731208,
FT                   731259..732057))
FT                   /locus_tag="ANIA_06260"
FT                   /old_locus_tag="AN6260.4"
FT                   /product="PAPA-1-like conserved region protein
FT                   (AFU_orthologue; AFUA_2G12960)"
FT                   /note="transcript_id=CADANIAT00006731"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006731"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006731"
FT                   /db_xref="GOA:Q5AZM0"
FT                   /db_xref="InterPro:IPR006880"
FT                   /db_xref="InterPro:IPR029523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZM0"
FT                   /protein_id="CBF69834.1"
FT                   /translation="MSLGRSLRARIVRDDPSAIETNTSTRSTRQSRSTQLLPSVTVVRA
FT                   PSESPEGSRKSIYLTVRMPSSKLREATSGSLRSAAARRSHNVFTDNPIVTGPRTSRSKK
FT                   RLVEINTSDEEEEQDLDDQEEDEVDDEDAPGEDDEDEDADADGDVDMDDAPPQPPASRR
FT                   HAKAAVTSAPRGKPVKSVEEKEMELDEEDDEEDEEELSEPDSNADGEADDQEEGVTLNM
FT                   DETGEQDEDEEDEELDSDGEMPDMSKLTKRQRGSLGNDFLQLPMEPQIKKHLTAEERAM
FT                   RRAEMARRRKNLSEKRNEEEKMDTINRLLRKQAPKRRGRIPAAEAAENAAADQEAAAET
FT                   DFVDPTMVRWISGREGSRVAVPEEWIGTPPGRIFGGTPRKLVEEI"
FT   gene            complement(734060..734774)
FT                   /locus_tag="ANIA_06259"
FT                   /old_locus_tag="AN6259.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(734060..734150,734230..734504,
FT                   734577..734774))
FT                   /locus_tag="ANIA_06259"
FT                   /old_locus_tag="AN6259.4"
FT                   /note="transcript_id=CADANIAT00006732"
FT   CDS_pept        complement(join(734060..734150,734230..734504,
FT                   734577..734774))
FT                   /locus_tag="ANIA_06259"
FT                   /old_locus_tag="AN6259.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006732"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006732"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006732"
FT                   /db_xref="GOA:Q5AZM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZM1"
FT                   /protein_id="CBF69836.1"
FT                   /translation="MPPSNATQNSQPGKLASPVKHYHERRSSFAVGIWILSILVLGLAA
FT                   AVVAKAPASPLRSSASYNVAVASLQFFLFFLAGSKPVSTTDARPPKAGTITLVISTLIW
FT                   AAAFPIMFIFASEDDRYAVVDFDKRVLALDIGTGVVSGLENITLACGAFGASIFLCIIF
FT                   QWYYTAQLYRGHFTRDHIEAAYND"
FT   gene            736236..737459
FT                   /locus_tag="ANIA_06258"
FT                   /old_locus_tag="AN6258.4"
FT                   /product="putative microbody (peroxisome) biogenesis
FT                   protein peroxin 14/17 (Eurofung)"
FT   mRNA            736236..737459
FT                   /locus_tag="ANIA_06258"
FT                   /old_locus_tag="AN6258.4"
FT                   /note="transcript_id=CADANIAT00006733"
FT   CDS_pept        736236..737459
FT                   /locus_tag="ANIA_06258"
FT                   /old_locus_tag="AN6258.4"
FT                   /product="putative microbody (peroxisome) biogenesis
FT                   protein peroxin 14/17 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006733"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006733"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006733"
FT                   /db_xref="GOA:Q5AZM2"
FT                   /db_xref="InterPro:IPR006785"
FT                   /db_xref="InterPro:IPR025655"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZM2"
FT                   /protein_id="CBF69838.1"
FT                   /translation="MSDPTSKPSIPKWQQQDSGSSPSTSDEKNADYGDRSTLLEQASSF
FT                   LQDDSIRDAPTDRKIAFLESKGLTDTEIDGLLGVSRNAEASSGSGSGGDNSVEERKSTS
FT                   APSTETFNPAVSKPTPPTPSSNSRPVNLTPRDVPPIITYPEFLLHQSKPPPLVTLRSVL
FT                   YTLYTAAGLGATLYGAGEYLVKPMLAALTDARHDLAQTTEENLKKLNEKLELNVSQLPP
FT                   SLITKSTASVGDATEEDIESITSDPTELFHRDIGTQTSQDLIQTSSATSTSATIESTSN
FT                   DPTTVVTTHQKRLETIGSHLRELEDAQSQSSTLHDTTRSRINDLQHYLDRLMYSKNSYS
FT                   YSSTMGYGSYSTPGLDSGGGAALGVGKAEEDAISNFRAEIRGVKGALLSARNFPSGRSV
FT                   GLRSSFVR"
FT   gene            complement(737913..742588)
FT                   /locus_tag="ANIA_06257"
FT                   /old_locus_tag="AN6257.4"
FT                   /product="Protein transport protein sec31
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZM3]"
FT   mRNA            complement(join(737913..738229,738285..738583,
FT                   738637..741388,741440..741526,741580..741813,
FT                   741868..741973,742024..742140,742202..742588))
FT                   /locus_tag="ANIA_06257"
FT                   /old_locus_tag="AN6257.4"
FT                   /note="transcript_id=CADANIAT00006734"
FT   CDS_pept        complement(join(738185..738229,738285..738583,
FT                   738637..741388,741440..741526,741580..741813,
FT                   741868..741973,742024..742140,742202..742410))
FT                   /locus_tag="ANIA_06257"
FT                   /old_locus_tag="AN6257.4"
FT                   /product="Protein transport protein sec31
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZM3]"
FT                   /note="transcript_id=CADANIAT00006734"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006734"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006734"
FT                   /db_xref="GOA:Q5AZM3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR009917"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040251"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZM3"
FT                   /protein_id="CBF69840.1"
FT                   /translation="MVRLREIPRTATFAWSPGAASPLIATGTRAGAVDADFSNETCLEL
FT                   WDLALGNEDAGAELQPVAKIDTDSGFNDLAWTDSEDNSRGIIAGGLESGSLGLWDADKL
FT                   LSGASDAVLSKSSKHSGAIKALQFNPRHSSLLATGGAKGELYISDLNDLENPYRLGSST
FT                   ARADDIECLDWNKKVAHILVTGSSAGFVTVWDVKTRKESLTLNNMGRKAVSAVAWDPTK
FT                   PTKLVTATPHESDPIINLWDLRNSHAPERTLRGHEAGVLSLSWCNQDPDLLLSSGKDNR
FT                   TICWNPQTGISYGEFPVVTNWTFQTRWNPRNPNFFATASFDGRISIQTIQNTSTETAKA
FT                   VADQNQALDGEDFFAKAQSQPQVSSFSLPKAPKWLERPCSSTFGFGGRVVSVNLLEKGG
FT                   RASKIKITPFEVDEAVGKSTETFESALKEGDLKSICENRITSAATEEEKSDWRVIDALL
FT                   SDSPRKGLVEYLGFNDQAEDVSEGLAKLGLSKEDEVNGEAAPKESRRPGARKHKRLQSM
FT                   FDASPDDNFLSDLAASKGAKTNNPFQIFNGEESEADKNITRALLLGDFEKALDHALKED
FT                   RMSDAFMIAIVGGQKCIEKAQEHYFSKQTESPNYVRLLASVVGKNLWDVVYNADLSNWK
FT                   EIMVALCTFADEKDFADLCDALGDRLEEQIRNTGDKAIRKDASLCYLAGSKLEKVVSIW
FT                   IEEQRENEQAAIETAAEDSSFSIHVRALQSLIEKVTIFRQVTKFEDSERTKDCDWKLSV
FT                   LYDKYIEYADVVATHGRLQVAQKYLDLVPEKHPEAEIARNRIKLAMRQPTTRAQPATST
FT                   ARVVSNKPLPQPAAYQPPTTFSAGARAATPTSYAPPAPAANPYAPPAAASNPYAPPVAA
FT                   SNPYAPTAAAANPYAPSAAAPSQSTNPYAPAGGSYAPAAGYQPRQQSFGAPPPSVGGVP
FT                   PPPRASSQSPATVTTYTTAKNLPAWNDLPEGFAKQPVSRRGTPASSAPISSPFPNQSPA
FT                   VSQGPPPAGAGPQRTPSVPPPPKGVPPPPRMTSPPSAGQAPPNPLSAVPPPPANPYAAV
FT                   PQSPSVGSMAPPASIPRGSSPYNAPPTIPPPSNRYAPSPAAQAASPQLQARAPVPPPPQ
FT                   AAASPYAPPPPAQPLAANPYAPSTPPPMQPPLQQVPPPQSAGSRPSTASSVKKASPAPP
FT                   KYPPGDRSHIPAEARPIFEILSEDMQRVKSRAPSSFKAQVDDAERRLNFLFDHLNNEDL
FT                   LKPNTVQDMVQLARAIQARDYETARTIHIDIMTNRTDECGNWMVGVKRLISMSKVTP"
FT   gene            742780..743318
FT                   /locus_tag="ANIA_06256"
FT                   /old_locus_tag="AN6256.4"
FT                   /product="peptidyl prolyl cis-trans isomerase Cyclophilin,
FT                   putative (AFU_orthologue; AFUA_2G12990)"
FT   mRNA            join(742780..743121,743178..743318)
FT                   /locus_tag="ANIA_06256"
FT                   /old_locus_tag="AN6256.4"
FT                   /note="transcript_id=CADANIAT00006735"
FT   CDS_pept        join(742801..743121,743178..743318)
FT                   /locus_tag="ANIA_06256"
FT                   /old_locus_tag="AN6256.4"
FT                   /product="peptidyl prolyl cis-trans isomerase Cyclophilin,
FT                   putative (AFU_orthologue; AFUA_2G12990)"
FT                   /note="transcript_id=CADANIAT00006735"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006735"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006735"
FT                   /db_xref="GOA:Q5AZM4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034168"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZM4"
FT                   /protein_id="CBF69842.1"
FT                   /translation="MSEKTRLKCTVYVGGLDQAVSVQTLAEAFVPFGEVVDITLPKPDL
FT                   PNSNDNHRGFGYVEFDSPEDAKEAIDNMDGSELYGRTIKVAPAKPQKDANEGLGSKTAI
FT                   WEQEGYLSKYAVSEEDKLAAEESKMEDSGPSEDPIRRLEELDVAGPKPE"
FT   gene            complement(743380..744211)
FT                   /locus_tag="ANIA_10803"
FT                   /old_locus_tag="AN10803.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(743380..743674,743779..743791,
FT                   743852..743914,743993..744008,744083..744211))
FT                   /locus_tag="ANIA_10803"
FT                   /old_locus_tag="AN10803.4"
FT                   /note="transcript_id=CADANIAT00006736"
FT   CDS_pept        complement(join(743575..743674,743779..743791,
FT                   743852..743914,743993..744008,744083..744139))
FT                   /locus_tag="ANIA_10803"
FT                   /old_locus_tag="AN10803.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006736"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006736"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006736"
FT                   /db_xref="GOA:C8V1I8"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1I8"
FT                   /protein_id="CBF69844.1"
FT                   /translation="MYPSPILRMQPTRPSFALPKEGQSAHTISQRLRTLKKIPPELLPL
FT                   GLVLGVAVGAAIYSSTKKLMTDKTLRLTPNRPEDREH"
FT   gene            744376..745304
FT                   /locus_tag="ANIA_06255"
FT                   /old_locus_tag="AN6255.4"
FT                   /product="cytochrome c oxidase polypeptide vib
FT                   (AFU_orthologue; AFUA_2G13010)"
FT   mRNA            join(744376..744552,744727..744757,744810..744891,
FT                   744949..745012,745070..745304)
FT                   /locus_tag="ANIA_06255"
FT                   /old_locus_tag="AN6255.4"
FT                   /note="transcript_id=CADANIAT00006737"
FT   CDS_pept        join(744510..744552,744727..744757,744810..744891,
FT                   744949..745012,745070..745104)
FT                   /locus_tag="ANIA_06255"
FT                   /old_locus_tag="AN6255.4"
FT                   /product="cytochrome c oxidase polypeptide vib
FT                   (AFU_orthologue; AFUA_2G13010)"
FT                   /note="transcript_id=CADANIAT00006737"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006737"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006737"
FT                   /db_xref="GOA:C8V1I9"
FT                   /db_xref="InterPro:IPR003213"
FT                   /db_xref="InterPro:IPR036549"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1I9"
FT                   /protein_id="CBF69846.1"
FT                   /translation="MSLLRPSPSSSLLVSYDARFPQQNQTKHCWQNYVDYHKCVNAKGE
FT                   DFRPCRQFYLAFRSLCPKPWTDRWDEQREAGNFPARLDR"
FT   gene            complement(746054..747189)
FT                   /locus_tag="ANIA_06254"
FT                   /old_locus_tag="AN6254.4"
FT                   /product="hypothetical protein similar to mitochondrial
FT                   dicarboxylate transporter (Eurofung)"
FT   mRNA            complement(join(746054..746737,746807..746905,
FT                   746968..746972,747051..747189))
FT                   /locus_tag="ANIA_06254"
FT                   /old_locus_tag="AN6254.4"
FT                   /note="transcript_id=CADANIAT00006738"
FT   CDS_pept        complement(join(746054..746737,746807..746905,
FT                   746968..746972,747051..747189))
FT                   /locus_tag="ANIA_06254"
FT                   /old_locus_tag="AN6254.4"
FT                   /product="hypothetical protein similar to mitochondrial
FT                   dicarboxylate transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006738"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006738"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006738"
FT                   /db_xref="GOA:Q5AZM6"
FT                   /db_xref="InterPro:IPR002030"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZM6"
FT                   /protein_id="CBF69848.1"
FT                   /translation="MASTAKLEISHPQQQVVKPVKKVHYPFWFGGSASCFAAAVTHPLD
FT                   LVKVRLQTRGPGAPSTMLGTFGHILRNNGFFGLYNGLSAALLRQLTYSTTRFGIYEELK
FT                   SRFTSPSQSPSFFTLLGMACTSGILGGIAGNPADVLNVRMQSDAALPPAQRRNYRHAFH
FT                   GLVQMTRTEGFSSLFRGVWPNSTRAVLMTSSQLVSYDVFKRLCLEKFGMKDNVVTHFSA
FT                   SFAAGFVATTVCSPVDVIKTRVMSASPSETRGHNIVGLLREISRKEGLAWAFRGWVPSF
FT                   IRLGPHTIATFIFLEEHKKLYRYLKGI"
FT   gene            complement(747639..749189)
FT                   /locus_tag="ANIA_06253"
FT                   /old_locus_tag="AN6253.4"
FT                   /product="Phenylalanyl-tRNA synthetase alpha subunit-like
FT                   protein Fragment [Source:UniProtKB/TrEMBL;Acc:Q9P465]"
FT   mRNA            complement(747639..749189)
FT                   /locus_tag="ANIA_06253"
FT                   /old_locus_tag="AN6253.4"
FT                   /note="transcript_id=CADANIAT00006739"
FT   CDS_pept        complement(747639..749189)
FT                   /locus_tag="ANIA_06253"
FT                   /old_locus_tag="AN6253.4"
FT                   /product="Phenylalanyl-tRNA synthetase alpha subunit-like
FT                   protein Fragment [Source:UniProtKB/TrEMBL;Acc:Q9P465]"
FT                   /note="transcript_id=CADANIAT00006739"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006739"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006739"
FT                   /db_xref="GOA:C8V1J1"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004530"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1J1"
FT                   /protein_id="CBF69850.1"
FT                   /translation="MRLFATSRALRLGSGRWSITSARSSIRLPLSQLLRAGSVGHREWS
FT                   STVIRRTQHTINKSESTATTPSASPKSLTVGGKAYPIDDWTNTPDTILAHIDRRLYLDD
FT                   SHPLAITRKLIESQFPRPVYGNYSEKDPIVTTAQNFDVLGFPADHPGRSRTDTYYLNEK
FT                   TVLRTHTSAHQQAYFQQISRNEETRPEEVGYTVVADVYRRDAIDRSHYPVFHQMEGAML
FT                   WKRPADKPLEHAKQTAAAIMKDVYSIPSHSVPVEDPNPTIHPQRNPLQADYHSEEEVEA
FT                   IAAHLKRSLERMVIKVFSEAQKASAASEGAEAETLRVRWVEAYFPFTSPSWELEVFWQG
FT                   DWLEILGCGVVKQELLNNSDVPNRVGWAFGLGLERIAMLLFNIPDIRLFWSKDERFLSQ
FT                   FKAGQITRFEPFSKYPACYKDVAFWLPSAATSGGSAAGGAVPVHENDIMEIVRGVGGNL
FT                   VEDVKLIDEFIHPKTNRKSLCYRINYRSLERTLTNEETNDLHDKVRQKLVSQLCVELR"
FT   gene            complement(749460..751027)
FT                   /locus_tag="ANIA_06252"
FT                   /old_locus_tag="AN6252.4"
FT                   /product="RNA polymerase II subunit 3 (AFU_orthologue;
FT                   AFUA_2G13090)"
FT   mRNA            complement(join(749460..750118,750203..750771,
FT                   750875..751027))
FT                   /locus_tag="ANIA_06252"
FT                   /old_locus_tag="AN6252.4"
FT                   /note="transcript_id=CADANIAT00006740"
FT   CDS_pept        complement(join(749740..750118,750203..750771,
FT                   750875..750928))
FT                   /locus_tag="ANIA_06252"
FT                   /old_locus_tag="AN6252.4"
FT                   /product="RNA polymerase II subunit 3 (AFU_orthologue;
FT                   AFUA_2G13090)"
FT                   /note="transcript_id=CADANIAT00006740"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006740"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006740"
FT                   /db_xref="GOA:Q5AZM8"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZM8"
FT                   /protein_id="CBF69852.1"
FT                   /translation="MDYEMDIEPTGPQVTVREAEPYRVDFKLSSVDLAFANSLRRVMLA
FT                   EIPTMAIDIVEVEKNSSVLPDEMLAHRLGLIPLDSKNCDQDVEYTRDCECEDHCARCSV
FT                   TLSLHARCTSDEIMRVYARDLVITGERANEWVGNPVITDPDGNGPLICKLRRGQELKMT
FT                   CIAKKGIAKEHSKWAPTAAIGFEYDPHNNLRHVDYWYEEDPVKEWPVSHNAAWEPAAPA
FT                   DQPFDYDAQPNNFYIDVESIGNLEPDMIIQQGITVLQRKLAAAIKSLSGEDGTNGVVDE
FT                   DMMGVQSPDPYEPRDDGGYTAYANGGSASAWGGANAATPYGATPYGGGNFGF"
FT   gene            complement(751292..752617)
FT                   /locus_tag="ANIA_06251"
FT                   /old_locus_tag="AN6251.4"
FT                   /product="Nudix/MutT family protein (AFU_orthologue;
FT                   AFUA_2G13080)"
FT   mRNA            complement(join(751292..752349,752457..752617))
FT                   /locus_tag="ANIA_06251"
FT                   /old_locus_tag="AN6251.4"
FT                   /note="transcript_id=CADANIAT00006741"
FT   CDS_pept        complement(join(751922..752349,752457..752508))
FT                   /locus_tag="ANIA_06251"
FT                   /old_locus_tag="AN6251.4"
FT                   /product="Nudix/MutT family protein (AFU_orthologue;
FT                   AFUA_2G13080)"
FT                   /note="transcript_id=CADANIAT00006741"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006741"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006741"
FT                   /db_xref="GOA:Q5AZM9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZM9"
FT                   /protein_id="CBF69854.1"
FT                   /translation="MVDQVRSMESRVGRKNQRYGSKGERLVAGVVPLSKDKSLVMMIQS
FT                   AGRGGWVLPKGGWETDEASAQQAACREAWEEAGVICTVLRDLGTISDMRPSTMLTSNSP
FT                   RASYQFFEVTVDREEDRWPEMHKRRRQWVTYTQAAAALASRPELLEALNRSSMKR"
FT   gene            755240..757759
FT                   /locus_tag="ANIA_06250"
FT                   /old_locus_tag="AN6250.4"
FT                   /product="arginine-tRNA-protein transferase 1
FT                   (AFU_orthologue; AFUA_2G13070)"
FT   mRNA            join(755240..755621,755960..756004,756067..756142,
FT                   756192..756254,756307..756429,756485..756646,
FT                   756695..756928,756975..757078,757133..757198,
FT                   757281..757528,757634..757759)
FT                   /locus_tag="ANIA_06250"
FT                   /old_locus_tag="AN6250.4"
FT                   /note="transcript_id=CADANIAT00006742"
FT   CDS_pept        join(755567..755621,755960..756004,756067..756142,
FT                   756192..756254,756307..756429,756485..756646,
FT                   756695..756928,756975..757078,757133..757198,
FT                   757281..757528,757634..757759)
FT                   /locus_tag="ANIA_06250"
FT                   /old_locus_tag="AN6250.4"
FT                   /product="arginine-tRNA-protein transferase 1
FT                   (AFU_orthologue; AFUA_2G13070)"
FT                   /note="transcript_id=CADANIAT00006742"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006742"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006742"
FT                   /db_xref="GOA:C8V1J4"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1J4"
FT                   /protein_id="CBF69856.1"
FT                   /translation="MEPIDAERARQLSLFRPLGYQRNSCGYCKSDNGSASYYASSVSVR
FT                   PVHYEELVNRGWRRSGTLYYKQNLQRSCCPHYTMRLEASAYKPRRDQRKAINRWNKFVL
FT                   GPEYIRRAAYLCPKTREEKKHRKCNFDLHDAVHAVEYSNVKRPTDPKTKRSLEPAHRFE
FT                   VNLEGDTVSQAKFDLFRKYQTKVHKEDVSKWQTKDFKRFLCSGLKRSEPNGRDVQRRIG
FT                   SWHQCYRLDGKLIAVAVLDLMPNGVSSVYIFRSYDPDYEQWEIGKLSAMREIAFAVEQG
FT                   YQYYYMGYYIHSCQKMRYKGNFRPQYILDGELTAKLNTRPYVSLSRDRATTATSGTEAN
FT                   AADNAEAEAEINDEEVSLFALHMPGVLTVDEVKKLDLGSWPLLIHGSFVHMSDLVGWEK
FT                   MPIDEPQSIKGIVAELAATLGPTVMKDSAVVLFD"
FT   gene            complement(757852..759266)
FT                   /locus_tag="ANIA_06249"
FT                   /old_locus_tag="AN6249.4"
FT                   /product="calcineurin binding protein, putative
FT                   (AFU_orthologue; AFUA_2G13060)"
FT   mRNA            complement(757852..759266)
FT                   /locus_tag="ANIA_06249"
FT                   /old_locus_tag="AN6249.4"
FT                   /note="transcript_id=CADANIAT00006743"
FT   CDS_pept        complement(758118..759023)
FT                   /locus_tag="ANIA_06249"
FT                   /old_locus_tag="AN6249.4"
FT                   /product="calcineurin binding protein, putative
FT                   (AFU_orthologue; AFUA_2G13060)"
FT                   /note="transcript_id=CADANIAT00006743"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006743"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006743"
FT                   /db_xref="GOA:C8V1J5"
FT                   /db_xref="InterPro:IPR006931"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1J5"
FT                   /protein_id="CBF69857.1"
FT                   /translation="MHQRNEMTGTLSPQSAPSSPSISTRRSSRSSQKPSLSIDLSSLPP
FT                   LSQPSPPTNTLLITELNDLYLFQPSSLSQIRQLIESIAPLNSFSPLPSFRRIVASFRNE
FT                   DDATRVRKLLDRESLLNRSVRTRIYFGEPTPLLETDDAGGIKHKLLEAPQVDKLFFISP
FT                   PPSPPHGWVMRQEDPPNKEVHASDLAQALAKLKTQTEGSTYATSTVPASQQQTDPDTPM
FT                   SLSSDKRTGSWPLLQQRSRSSTLIYNPEEHGGSPNLPAVMVEDTSADPDDMDVEMSPID
FT                   MPVKQTPPFKTARPPVELMV"
FT   gene            complement(760874..761124)
FT                   /locus_tag="ANIA_11506"
FT                   /old_locus_tag="AN11506.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(760874..761006,761114..761124))
FT                   /locus_tag="ANIA_11506"
FT                   /old_locus_tag="AN11506.4"
FT                   /note="transcript_id=CADANIAT00006744"
FT   CDS_pept        complement(join(760874..761006,761114..761124))
FT                   /locus_tag="ANIA_11506"
FT                   /old_locus_tag="AN11506.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006744"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006744"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006744"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1J6"
FT                   /protein_id="CBF69859.1"
FT                   /translation="MALTRIQIIPAQDDRSLCSRLPEKLQSRIQTLLATITASRSTLGY
FT                   RY"
FT   gene            complement(761602..762522)
FT                   /locus_tag="ANIA_06248"
FT                   /old_locus_tag="AN6248.4"
FT                   /product="mitochondrial co-chaperone GrpE, putative
FT                   (AFU_orthologue; AFUA_2G13040)"
FT   mRNA            complement(join(761602..761634,761688..762116,
FT                   762188..762522))
FT                   /locus_tag="ANIA_06248"
FT                   /old_locus_tag="AN6248.4"
FT                   /note="transcript_id=CADANIAT00006745"
FT   CDS_pept        complement(join(761602..761634,761688..762116,
FT                   762188..762484))
FT                   /locus_tag="ANIA_06248"
FT                   /old_locus_tag="AN6248.4"
FT                   /product="mitochondrial co-chaperone GrpE, putative
FT                   (AFU_orthologue; AFUA_2G13040)"
FT                   /note="transcript_id=CADANIAT00006745"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006745"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006745"
FT                   /db_xref="GOA:Q5AZN2"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZN2"
FT                   /protein_id="CBF69861.1"
FT                   /translation="MFKRTLLRQAQASRALFSVRSASTAPLAIRQPSQFQPQLLRPFAR
FT                   IPSARCYSTENKTETQTENGEKEQKDNGNESTGTADEQCQKELEEKKKEVIELKDKYVR
FT                   SVADFLNLQERTKRDMENARNFAIQRFAVDLLESIDNFDRALLAVPKEKLNAPKTEENK
FT                   DLLDLVDGLKMTQNILLNTLQKHGLERFDPGEPGEDGKPQKFDPKIHEATFMTKVEGKE
FT                   NGEIMYTQSKGFTLNGRVLRAAKVGVVKND"
FT   gene            complement(764696..766960)
FT                   /locus_tag="ANIA_06247"
FT                   /old_locus_tag="AN6247.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(764696..766014,766089..766960))
FT                   /locus_tag="ANIA_06247"
FT                   /old_locus_tag="AN6247.4"
FT                   /note="transcript_id=CADANIAT00006746"
FT   CDS_pept        complement(join(764696..766014,766089..766635))
FT                   /locus_tag="ANIA_06247"
FT                   /old_locus_tag="AN6247.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006746"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006746"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006746"
FT                   /db_xref="GOA:C8V1J8"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1J8"
FT                   /protein_id="CBF69863.1"
FT                   /translation="MLDELDNVFDDHPSMDASLEDIENTSNRHRSPVFGLPSQHSGFRS
FT                   EESDCEDEDTTPVDERWSPPGFGRRYDFVPYSGWYRHQPYTRKIDHERFGLKPTVGVSP
FT                   TQSREASPQYEDAPEAPAVGRRAVSTETGDVIVAANVPLPPEADSPLKGRSPSPVRMPL
FT                   RPIPDAETVDFKPENNISNYIRFAVRAEVQHREPFVAFFTYLRSKFDRITSSKSNTTLS
FT                   VLIALLSIAFLRTLFMPSIPSAIPDLVKLSGFARSFEPLIYYSENGVQQIGTLQETGVA
FT                   VWDLSESVRGTNMTSAPIIVRQLDELSESLKSLSLELTRFFANVDSDVDSILLVMDWAK
FT                   RELETLSSQPPSSLPSIVLDNVQDLLSRLGTLERVAGSSGDGTTELTTTPTTFGTIVTA
FT                   LFGQTSAQRTRATLTRTFTEFLSVLEESINSELTHSTALFALFESIDRQFLNLQRTVVR
FT                   ESDAQERAEGEMLSSLWTRVLGPDAAVVRKYEKNKRLLANVRSRTVFNKHLLMDHRGRL
FT                   LTLKVNLETLRRKLVSPLVRRNDSVSFAGAVDPGSSGGRTLGPVEAVIEGQIKGLEGTY
FT                   DYLRSVREKQKAKLMEMVYGAGRKLPSSTSLLADGSEEGDMIDGA"
FT   gene            complement(768045..768552)
FT                   /locus_tag="ANIA_06246"
FT                   /old_locus_tag="AN6246.4"
FT                   /product="cytochrome c (Eurofung)"
FT   mRNA            complement(join(768045..768127,768181..768275,
FT                   768337..768552))
FT                   /locus_tag="ANIA_06246"
FT                   /old_locus_tag="AN6246.4"
FT                   /note="transcript_id=CADANIAT00006747"
FT   CDS_pept        complement(join(768045..768127,768181..768275,
FT                   768337..768551))
FT                   /locus_tag="ANIA_06246"
FT                   /old_locus_tag="AN6246.4"
FT                   /product="cytochrome c (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006747"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006747"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006747"
FT                   /db_xref="GOA:P38091"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38091"
FT                   /protein_id="CBF69865.1"
FT                   /translation="MLINCFFQATLPRVLSSSRPVASSATLSRTAAATRSAPTSTVSSA
FT                   VRLVRLRATPTPMPTSRPTSPGTRTLCSSTSRTPRSSSPVPRWLSVVSRRPRRGTISSP
FT                   TSRRALLKSFAIRRDKPPPGDRRASG"
FT   gene            769759..770625
FT                   /locus_tag="ANIA_06245"
FT                   /old_locus_tag="AN6245.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(769759..770151,770221..770625)
FT                   /locus_tag="ANIA_06245"
FT                   /old_locus_tag="AN6245.4"
FT                   /note="transcript_id=CADANIAT00006748"
FT   CDS_pept        join(769774..770151,770221..770625)
FT                   /locus_tag="ANIA_06245"
FT                   /old_locus_tag="AN6245.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006748"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006748"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006748"
FT                   /db_xref="GOA:C8V1K0"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1K0"
FT                   /protein_id="CBF69867.1"
FT                   /translation="MPPSAIPPFLLPRGVPSARAILFLSRSSRIGRLPPTHRCASTNSS
FT                   SDNSQNPRVLAQPDKFRPPSHPARRVVPTRNGKVVNYPGPKFSEKEEAERAKKKYPNMF
FT                   PPEGTVMFRFLTSRWIHVWIAFGVLTSLATFTFTTNFKATSPFAHLLPPWSALLSHPID
FT                   TISQALSVFRMHVQHTSVETREKRMRAVEDAEKRRQFRIAHGLEEPSEQDLAKEETRAE
FT                   QVDDQSPIAPEARDGAGAGEYVDWEGKRRPIKKWLGIW"
FT   gene            complement(771012..772246)
FT                   /locus_tag="ANIA_06244"
FT                   /old_locus_tag="AN6244.4"
FT                   /product="3' exoribonuclease family protein (Rrp42),
FT                   putative (AFU_orthologue; AFUA_2G13130)"
FT   mRNA            complement(join(771012..771635,771695..772246))
FT                   /locus_tag="ANIA_06244"
FT                   /old_locus_tag="AN6244.4"
FT                   /note="transcript_id=CADANIAT00006749"
FT   CDS_pept        complement(join(771012..771635,771695..772246))
FT                   /locus_tag="ANIA_06244"
FT                   /old_locus_tag="AN6244.4"
FT                   /product="3' exoribonuclease family protein (Rrp42),
FT                   putative (AFU_orthologue; AFUA_2G13130)"
FT                   /note="transcript_id=CADANIAT00006749"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006749"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006749"
FT                   /db_xref="GOA:Q5AZN6"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZN6"
FT                   /protein_id="CBF69869.1"
FT                   /translation="MAAQRQASSASQTPHFSPAELSYLYTSLSLPGTPIRPDGRSPTQF
FT                   RPLTAETDILPGTNGSARVGFADGTQAIVGVKAEVEKTILGVQAQQLEDAEGFGEAGSD
FT                   GEGGAGRGSSSGHGSWVQMAIEIPGFRDDDALPVFLSEMMREPLVESVSGGEKGGAEEM
FT                   VGGLKGRLVINRRWHWRLYIDVLLLSQPLSYPLPLLSLTTYLALLATKLPKLKSKGEED
FT                   PFFDDDWNAAEYLYPRVKPARTTIPSSISVHKVRPPVTLLVISVAENIIFDPSREEIAV
FT                   ADAVLAISVAHDTDSGPLKLLSIRTIDPPSRLTQPGIPNSENIATVGSTAAAEESLIIN
FT                   PSTGEEEVPGVWRPRRGGVKRATIAKMVKMVLEKGGVGEEVLEGLEGVEVG"
FT   gene            772610..772863
FT                   /locus_tag="ANIA_11505"
FT                   /old_locus_tag="AN11505.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(772610..772657,772741..772863)
FT                   /locus_tag="ANIA_11505"
FT                   /old_locus_tag="AN11505.4"
FT                   /note="transcript_id=CADANIAT00006750"
FT   CDS_pept        join(772610..772657,772741..772863)
FT                   /locus_tag="ANIA_11505"
FT                   /old_locus_tag="AN11505.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006750"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006750"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006750"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1K2"
FT                   /protein_id="CBF69871.1"
FT                   /translation="MLILSMQWMYKTVLSARRKEFGVRYIISRKQMVTRSDAGVAGVGR
FT                   TEKEMVERSDK"
FT   gene            complement(773317..775765)
FT                   /gene="imeB"
FT                   /locus_tag="ANIA_06243"
FT                   /old_locus_tag="AN6243.4"
FT                   /product="Serine/threonine protein kinase ime2 homologue
FT                   imeB (Eurofung)"
FT   mRNA            complement(join(773317..774750,774802..775545,
FT                   775598..775765))
FT                   /gene="imeB"
FT                   /locus_tag="ANIA_06243"
FT                   /old_locus_tag="AN6243.4"
FT                   /note="transcript_id=CADANIAT00006751"
FT   CDS_pept        complement(join(773317..774750,774802..775545,
FT                   775598..775765))
FT                   /gene="imeB"
FT                   /locus_tag="ANIA_06243"
FT                   /old_locus_tag="AN6243.4"
FT                   /product="Serine/threonine protein kinase ime2 homologue
FT                   imeB (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006751"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006751"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006751"
FT                   /db_xref="GOA:Q5AZN7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZN7"
FT                   /protein_id="CBF69873.1"
FT                   /translation="MTVCYEHPSRGLTPTSMATLSDRFELMKEVGDGSFGSVAVARVRT
FT                   AGSNIARRGTLVAIKTMKKTFDSLAPCLELREVIFLRTLPPHPHLVPALDIFLDPLTRK
FT                   LHIAMEYMDGNLYQLMKARDHKYLDGKHVKSILYQILCGLDHIHAHHFFHRDIKPENIL
FT                   VSTSAPNDSTFSRYSNLVTPPSTPTTYTVKIADFGLARETHSKLPYTTYVSTRWYRAPE
FT                   VLLRAGEYSAPVDMWAVGAMAVEIATLKPLFPGGNEVDQVWRVCEIMGSPGNWYSKSGA
FT                   KLGGGEWKDGSRLAQKLGFTFPKMAPHSMESILPAPQWPAALSNFVTWCLMWDPKNRPT
FT                   SSQAMQHEYFADAVDPLSVRPRSSTARLLGRKQSEKSVKSPTKDTYESPTLSSKPSWFR
FT                   RSLIGRSESPALVEPEQPSKPTLPALDSNVDPQLLKPKHSTSKRATWAHGAPMPILPSI
FT                   RPVSPLSNAVTAQANPPAQESNTNAAKSSKKIGRQLSVNSHGNHYGDVHRQEAERALNG
FT                   LGNNSTSTISQKESFFSHLRKRARRLSGRNQNAMNDDIEANAGCMPWSNRSSLALDSVN
FT                   VSEAKQNSDFSELDKAVQNVRYSMDSAALGNVPVSITTPVEASKRQSMPQGSIRSMGDS
FT                   PASMNGNGGPISSRTRRAMQMTNHPVHRYETPEEEDELLDEVLHSASSAAMRLAQAQMS
FT                   DTSSNYSRPLCNEQSHNLPSPYPTPSPSAKCDGVSFGNEDAAPNRRLPLSDEKSATSAT
FT                   RQWPTPPYDDGDWMNPASTKFLTGSTYR"
FT   gene            782188..783374
FT                   /locus_tag="ANIA_06242"
FT                   /old_locus_tag="AN6242.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(782188..782351,782701..782805,783070..783172,
FT                   783222..783374)
FT                   /locus_tag="ANIA_06242"
FT                   /old_locus_tag="AN6242.4"
FT                   /note="transcript_id=CADANIAT00006752"
FT   CDS_pept        join(782188..782351,782701..782805,783070..783172,
FT                   783222..783374)
FT                   /locus_tag="ANIA_06242"
FT                   /old_locus_tag="AN6242.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006752"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006752"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006752"
FT                   /db_xref="GOA:Q5AZN8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZN8"
FT                   /protein_id="CBF69875.1"
FT                   /translation="MANYRLRGDVPSAYAKRYSESVKRQWVSESLIPSHTTEPTVSTLP
FT                   RLGTVPLTDNVVWFAFRDINAEPVIDENKLLAEGDLLSTTQVQSRTSVHSGWASFGVQR
FT                   SEAAASVLPDGRGGKLAKVKAWRPEEVSHNTPIRAREVAKKADYFYEDDDDDEEEEEEE
FT                   EEEEEDIEGFL"
FT   gene            783748..786115
FT                   /locus_tag="ANIA_06241"
FT                   /old_locus_tag="AN6241.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(783748..784830,784880..784982,785031..786115)
FT                   /locus_tag="ANIA_06241"
FT                   /old_locus_tag="AN6241.4"
FT                   /note="transcript_id=CADANIAT00006753"
FT   CDS_pept        join(784039..784830,784880..784982,785031..786115)
FT                   /locus_tag="ANIA_06241"
FT                   /old_locus_tag="AN6241.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006753"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006753"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006753"
FT                   /db_xref="GOA:Q5AZN9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZN9"
FT                   /protein_id="CBF69877.1"
FT                   /translation="MAYDGFQPGLHPYGQPDNPNPMNTSEHRPSFEPPYPYQQNSDYLS
FT                   MPQPQVPPQQAPPPQTAAQGYYPEPPREQNSWPPPPPPQTGRINDAVTSAVGNSAPSSY
FT                   VSPELIAQITANVIQQLGAAGINSPVNHPPPPQWAAPQAYQAPQSYQAPSAPHTPTISH
FT                   GTPPPSTFQPPPPPPPPQSEQPDAPSQQSRLSETPPQEKSRRESPASQMSDSGQKADSR
FT                   PKPPMRTDTFPTTLEKIWGKLFDDGKPTERLGQFLRGIAMYLIEHFPPGDTLVVVPEKL
FT                   QKFYADTSIASDPYPWEDIFDDRTSSISRLFRDFQIEHHLVQVRLDERPDVPALTPKGF
FT                   ELFVTLMIQAHPDKEYERMQKAVLNMPISNPDNKKERFPKEIPRRLFPEIPDLVLREKL
FT                   DESIKKHCGVELPPITEDDVKKVAALRAKSSTSTTVAVEESNPSTTQREKKPYQPPTSA
FT                   VVDDEDEEQSPPAIERKRKPYTAQPGGGKVYEGPGSPVHRHANSFSTNSSNKESRPSAT
FT                   RVPDSPPYRSRGTSRTRTGASTRSRSRSRFRSGHEYRHSESDLLNGSRKPGATSSGDYY
FT                   YDLPSSSSIPSDLLDQYRELDRSAEDHRLYEQIREREKEREKSKYHDSLPSRSSWSNDD
FT                   DYYRGLLGGQGGGPASGYDYKGYR"
FT   gene            complement(786349..787454)
FT                   /locus_tag="ANIA_06240"
FT                   /old_locus_tag="AN6240.4"
FT                   /product="OB-fold nucleic acid binding domain
FT                   (AFU_orthologue; AFUA_2G13170)"
FT   mRNA            complement(join(786349..787052,787158..787454))
FT                   /locus_tag="ANIA_06240"
FT                   /old_locus_tag="AN6240.4"
FT                   /note="transcript_id=CADANIAT00006754"
FT   CDS_pept        complement(join(786349..787052,787158..787356))
FT                   /locus_tag="ANIA_06240"
FT                   /old_locus_tag="AN6240.4"
FT                   /product="OB-fold nucleic acid binding domain
FT                   (AFU_orthologue; AFUA_2G13170)"
FT                   /note="transcript_id=CADANIAT00006754"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006754"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006754"
FT                   /db_xref="GOA:Q5AZP0"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018856"
FT                   /db_xref="InterPro:IPR040260"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZP0"
FT                   /protein_id="CBF69879.1"
FT                   /translation="MATSDTTSNWSYKNKDRSNNNNNASKQKPKLPFYPAFCFRASPTH
FT                   FAWIKMGAADVHRLTRRLEYGERGLFFYQNHPIRFVNLVGIIVARADVPRRTILTLDDS
FT                   TGATVDIVVLKRDPCPIPVAATVESKPKNNTDVHGEDGAQKEMHLTSTTQTPIDITPLQ
FT                   PGKLFQIKGTLSTFRSTNQVQLERFFPVPDTKTEMRFVEARMRFLAEVLTVPWALDEGD
FT                   IENLRMQADEEGSRIDDEQARHRRRARKRAEREERERRRILKLWEQEEVVREREGKIAR
FT                   EAGRDYMLELERRNRLLSS"
FT   gene            788410..789587
FT                   /locus_tag="ANIA_06239"
FT                   /old_locus_tag="AN6239.4"
FT                   /product="siderophore biosynthesis lipase/esterase,
FT                   putative (AFU_orthologue; AFUA_3G03390)"
FT   mRNA            join(788410..788463,788517..789587)
FT                   /locus_tag="ANIA_06239"
FT                   /old_locus_tag="AN6239.4"
FT                   /note="transcript_id=CADANIAT00006755"
FT   CDS_pept        join(788410..788463,788517..789587)
FT                   /locus_tag="ANIA_06239"
FT                   /old_locus_tag="AN6239.4"
FT                   /product="siderophore biosynthesis lipase/esterase,
FT                   putative (AFU_orthologue; AFUA_3G03390)"
FT                   /note="transcript_id=CADANIAT00006755"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006755"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006755"
FT                   /db_xref="InterPro:IPR013744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZP1"
FT                   /protein_id="CBF69881.1"
FT                   /translation="MYSKFWPAGGLPGILHHFTETLVTFEFTTSATPKPHSLLFVGGLG
FT                   DGLATTSYMADLAKALHSTDWSLFTLNLTSSYSAWGLGHLDRDTDEIAQCLNYIRDYKS
FT                   GKFASTNNSGFKGHSNSKVVLMGHSTGSQCVIHYLSKPNPHTSTKAFDSDLQHILRTRL
FT                   DGAIMQAPVSDREAIQYVLSTGWMGRTSSQVTAIYKELEKLAQDEVARNPDPQFDALLP
FT                   LHMTGVIGYPGNVPLSARRFLSLVSPGTPNGSPGEDDLFSSDLSDESLKKTFGMIRERG
FT                   LLASKLMVLISGADQAMPGWIDKEALLRRWRGFIDGERKDGEEEIWHEDSGLIPGASHA
FT                   LSNDDQAEPRRNLVERVMRYLKGGWRLEAYRLRN"
FT   gene            complement(789751..791662)
FT                   /locus_tag="ANIA_06238"
FT                   /old_locus_tag="AN6238.4"
FT                   /product="MFS siderophore iron transporter, putative
FT                   (AFU_orthologue; AFUA_3G03440)"
FT   mRNA            complement(join(789751..790682,790736..791078,
FT                   791126..791396,791475..791662))
FT                   /locus_tag="ANIA_06238"
FT                   /old_locus_tag="AN6238.4"
FT                   /note="transcript_id=CADANIAT00006756"
FT   CDS_pept        complement(join(789751..790682,790736..791078,
FT                   791126..791396,791475..791662))
FT                   /locus_tag="ANIA_06238"
FT                   /old_locus_tag="AN6238.4"
FT                   /product="MFS siderophore iron transporter, putative
FT                   (AFU_orthologue; AFUA_3G03440)"
FT                   /note="transcript_id=CADANIAT00006756"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006756"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006756"
FT                   /db_xref="GOA:Q5AZP2"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZP2"
FT                   /protein_id="CBF69883.1"
FT                   /translation="MLALQRSRSSSTEATPLLGDSPSPRIEHNVSTEDPEAAQDGVKQA
FT                   EAITMVWSKKSLVAAYILMFLLYFVNAFQSSITSNLSAFVTSGFESHSLIPVIYIVSSV
FT                   MSSATYMPLAKILNVWDRSIGFLIMVAFATLGLVLSATCTDIMTYSISQVFYTIGFAGM
FT                   IFSIDVITADTSSLRDRGLAYAFTSSPYIITAFAGSAASERFYAYNWRWAYGSFAIILP
FT                   IVALPMFGILQYNRYKAKQKGLLPKKEHHDRTIAQSIVFYAIELDLLGVFLLATGLVLF
FT                   LLPFTIAGSTVDEWKSSYIITMLITGIGCLVTFILTERFVAPVPFLPWELLASRTVLGA
FT                   CLLGTSYQIAFYCWNEYYTSYLQVVYGTSISTAGYISSIFNVISGIWLLAVGFLIKKTS
FT                   RFRWLLFWAVPLYMLGVTLMIYFRKPGWSVGYLILCQVLIAFGGSTMISCQQVAVSAAS
FT                   DHNNIASALAFLGVFGSMGGAVGSSISGAIWTNTLPGALKRLLPESAKADWRVIYESLE
FT                   IQLSYPVGSPVRLAIASAYAETQTKMLIAGTGIMALSLIWMFLIKDIRLSKDAQSKGVV
FT                   L"
FT   gene            792020..796405
FT                   /locus_tag="ANIA_06237"
FT                   /old_locus_tag="AN6237.4"
FT                   /product="ABC multidrug transporter (Eurofung)"
FT   mRNA            join(792020..792197,792401..793333,793383..796405)
FT                   /locus_tag="ANIA_06237"
FT                   /old_locus_tag="AN6237.4"
FT                   /note="transcript_id=CADANIAT00006757"
FT   CDS_pept        join(792020..792197,792401..793333,793383..796405)
FT                   /locus_tag="ANIA_06237"
FT                   /old_locus_tag="AN6237.4"
FT                   /product="ABC multidrug transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006757"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006757"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006757"
FT                   /db_xref="GOA:Q5AZP3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZP3"
FT                   /protein_id="CBF69884.1"
FT                   /translation="MNSAHLGSGFRNQEPPNPLAGSASTIAMRSMTHLRKDTLPFPHGY
FT                   ATAADDSMWLGFSTVGMKLVQNLAGFPRLLLAGNPSKIDLGMLLVAILSAIASGVPFPL
FT                   IGILFGQLLDDFNAATCKSGDSSGDGEQGSINDKILIIVYLAIAQFVLIYIHLSFWTLN
FT                   GARLAQRLRESYLQNLLRQEPSFFDNLPPGEVASRLNGDIQTIRSGTSEKVGICLASFS
FT                   FFVTAYIVAFIKDTKLAGMLVSLIPAYFLMSFVGSHYIEKYSGLMSEYAATAASIASEA
FT                   LSNFTVVQAFGANDRLEEKFSKALKSSEKEGLKKATAVGIQSGVLYFVAYSANGLAFWE
FT                   GSRQVARTVNGEPGGVTVGATFTVIFILVEATLLLSQVAPFLHLFTAGVASYEKLHADI
FT                   NRQPLIDGTTPSGSRLTQAGGFELNEVSFSYPSRPEVTVLDKVSLSIPPNKHTAIVGLS
FT                   GSGKSTIAGLVTRLYDPTEGQILFDGHDLRDVNTRDLRSFVSLVQQEPNLLDRSILENI
FT                   AHGLVNSSNPSHTPLRAALLSSDIADIASEVREGKDLMEAAEKRGPEFVEIAKLVQKAA
FT                   QLADAEAFILALQHGYGTLVGSSGRLISGGQKQRISLARALVKDPAVLILDEATASLDS
FT                   RSEQRIQRAISNIASGRTMITIAHRLSTITNADNIVVMHKGHIVEQGNHATLMAKDGAY
FT                   ADLVKLQTLSTTDKNESTTSVDTISKTDQISSDGDLESSSLTDGPRFIEDEKKPETTET
FT                   PVTDSTEEPEEPDTPNKSLWALVKGYAPTLRPHLLFLLLALLGSSIVGGAFSGEAVIFG
FT                   NTVGSLNPCNSADYIRSKGNFFGLMFFVLAIIEFFANVVSWTGFGWVSEKVVYTVRVLS
FT                   FRSLMEQDLQWHQSKGRSPPLLLSYITRDGNALAGLSGSVVGTLFSITVNLIAAIILTH
FT                   IIAWRIALVCLALVPLLLGAGLMELHILGKFEERHENAYTKSVDIGVEAITSIKTIASL
FT                   SLEDETLKTYQRSLKGPRKETLTVTLQASFWQAMTYFLGNLVNALAYWWGSKQILAGNY
FT                   TQTQFLIVVFSLLVSALLWSQMFALAPELSAARAAMARLLGLIEIGSDKMQGHVPPRSL
FT                   TASSSGEEEAAVETKQHASDSKASSVQLRDVHFAYPARPDIKVMNGLTIDIKPGKFAAL
FT                   VGPSGAGKSTIISLVERLYTPQSGSILVDGVDITKHRDVGFRDSIALVPQESVLFEGTI
FT                   KFNISLGAKPGHEVSQGDIEKACKLANIHDTIAALPDGYDTLCGPNGSQFSGGQKQRLS
FT                   IARALVRKPKLLILDESTSALDAESEKLLQDGLEKAAKGITVIAIAHRLHTIKKADVIF
FT                   LIEGGRCVEHGTHEELLARSESYRANVMHQTVAT"
FT   gene            complement(796758..803124)
FT                   /locus_tag="ANIA_06236"
FT                   /old_locus_tag="AN6236.4"
FT                   /product="putative siderophore synthetase (Eurofung)"
FT   mRNA            complement(join(796758..801898,801959..802685,
FT                   802732..803124))
FT                   /locus_tag="ANIA_06236"
FT                   /old_locus_tag="AN6236.4"
FT                   /note="transcript_id=CADANIAT00006758"
FT   CDS_pept        complement(join(796758..801898,801959..802685,
FT                   802732..803124))
FT                   /locus_tag="ANIA_06236"
FT                   /old_locus_tag="AN6236.4"
FT                   /product="putative siderophore synthetase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006758"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006758"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006758"
FT                   /db_xref="GOA:Q5AZP4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZP4"
FT                   /protein_id="CBF69887.1"
FT                   /translation="MGSIQVEDFLGQGQPTGDSPKSFEIADLGADNTSATGLKEDIILV
FT                   SWFIALLRTRESSQVSYEWAYGGGDSPKRLAMEELKIGLQSSVEEAAGAVSDYIATVAT
FT                   AVADTSGSTSLILSNESLSQTAEAKDEGVLHLKLGFENGRLEIRPTWHTENMLPYTVSR
FT                   YINTFVDVVKLCIATPSALIQDFYLRPTDFDLDSIWSWNHVLPPSYKFCMHEMVSEQAR
FT                   RFPEKEAICSWDGSLTYGQVDLYSSFVAASLKDLGVRVHDVLPACFEKSRWTIVAVLGI
FT                   MKSGATFVLMDPTLPLARLQNIAQQVGAKMMLSSSKQHDLATMIMPDSNPFVVGEETFA
FT                   DASKLQSIPELAPVPSSALMYMIFTSGSTGTPKGVKLSHETYTSSAIPRAREVGYTENS
FT                   RVLDFASYAFDVSIDSMLLTLGNGGCLCIPSDEDRMNDINGVIRNMRVNYAGLTPSVAR
FT                   ILDTDVISSLEGLGLGGEAVSARDCTVWGKLARIIIGYGPCECTIGCTVNGNAATGRDY
FT                   ISIGKGNGAAMWITDPNDHELLVPVGAVGELLVEGPIVGQGYLNDPEKTAAAFIEDPSW
FT                   LVAGHKGYSGRRGRLYKTGDLGKYDPDGSGGIVFVGRKDTQVKLRGQRVELGEIESQLR
FT                   ARLPSELSIIAEVIVSHGQPTLVAFVSVQSTKKQDSVELQSIELSEELRQTISEADKDV
FT                   ATVLPRYMVPTAYIPVNYMPVLISGKTDRKRLRELGAKIDLSQLDQHSSSYNRSGELSE
FT                   LEQRLRQAWAETLKREPESIRLEDNFFALGGDSVMAMKLVTISRTHGLELTVGNTFNTP
FT                   VLSEMAAVVKVCDSQTRTETRPFSLIAQSPESAILEAAQACGTEPEAIEDIYPCTPTQE
FT                   SLFTFSLKAVVAYVAQRVATIPSHIDIDSWKKAWEDVVAANPILRTRVAQISERGLQQV
FT                   VLKEKISWGHATDLEQYLENDKAEKMELGQNLARYAIIESHGKQYMVWTIHHVVYDGWS
FT                   EPIVLQQVSKALQKQPIEIQSQMREFVKYVRDTDETAMEEFWRRELRGAVGPQFPRLPS
FT                   RDFLPTPNGMVERHINLEIGAGSTFTIATLIRGAWALVASQYTGSDDVVFGETLMGRDI
FT                   SLPGVEGIIGPLIATVPVRVHVHRTSSVEAYLQSVQKAMLSRTPYQHMGMQNIRKVSQD
FT                   AQHACETGTGLVIQPDPEYVGGELGFEVGDVVREALHFNPYPVMLGCGIQKGGFRICAS
FT                   FDVSLVEVRQMERILAQVETACLELLKNSSRRVGDISCVPEAELNHIWKWNQLPPLSVD
FT                   EATGKLRADAAVKPGSPYPRIAVPWVCDPRNPSRLSPIGCVGELWIEGAVLAAETVESP
FT                   AWLVSGSSTYPGRTGRVQSTGDMVQLREDGSLIFVGRKENVVGVQGHAVDIADLEAHLK
FT                   KHLPPTILAAAAVSQAPSEEPELVVLVEQPSEEASVNLLSKQHVITPSASTSQNSPVIS
FT                   AAISVNLALALKKLDKFIRDNLPAYMVPSTYVVINKIPTSTKTGQIDHGLLNELSSAIP
FT                   RQIISQLRVGFESAWKNLNQKTDLTANESILRAAWSAILKIEGERIDIDDNFFRLGGDS
FT                   VLAMKLVSSLREQGHTLTVADVFQHMRLGDAAKRLKVGQGPKSKKMQAQTYMPFSTLPA
FT                   IQDLERFLSGNVRPKMLDPTWAIQDICPVTDSQALDIKGTVDAPRTSIQYTMLIFDSGI
FT                   DSERLLRACNDLVRTHDILRTIFIEQESSFLQVILQTLEAPITRHQTEKKDLKRYITNL
FT                   CAADIETPLNLGAPFLSFFHIQGAAGSHALVLRLSHAQYDGVSLPRLLRDLETLYSGRP
FT                   ISLSTIQPFPSYVSQIMGNKSAESKAIAYWRNLLQDSTLSVLQGKSTDKAEKGIFLSSP
FT                   ANTTAQPFESLGYTTATLLTAAWAVLLSRTIKQKDVTFGGITSGRILDAENILLDNPEE
FT                   IVGPTYQFTPIRVPFGARESWTPTSLCHFIQSQSAESAAYDFLGFRRIAEHCTSWLSSS
FT                   TGGLFFDSLVHHQDHEDFDTMPFAGCECEVDIVNPHGDSPDPVKVVSLVKDQKLHFGIV
FT                   GRESDREFVESTLAELVGVVEELVAEPEGLIRLDG"
FT   misc_feature    803511..870685
FT                   /note="contig 1.106 681..67855(-1)"
FT   gene            complement(803617..804430)
FT                   /locus_tag="ANIA_06235"
FT                   /old_locus_tag="AN6235.4"
FT                   /product="enoyl-CoA hydratase/isomerase family protein
FT                   (AFU_orthologue; AFUA_3G03410)"
FT   mRNA            complement(join(803617..804122,804179..804430))
FT                   /locus_tag="ANIA_06235"
FT                   /old_locus_tag="AN6235.4"
FT                   /note="transcript_id=CADANIAT00006759"
FT   CDS_pept        complement(join(803617..804122,804179..804395))
FT                   /locus_tag="ANIA_06235"
FT                   /old_locus_tag="AN6235.4"
FT                   /product="enoyl-CoA hydratase/isomerase family protein
FT                   (AFU_orthologue; AFUA_3G03410)"
FT                   /note="transcript_id=CADANIAT00006759"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006759"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006759"
FT                   /db_xref="GOA:Q5AZP5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZP5"
FT                   /protein_id="CBF69889.1"
FT                   /translation="MQHPTVQGCLVSFPTPEILLLTLNRPEKRNSIPLAISADIIRLWE
FT                   WFDAEPTLRAAIITGTGESFCSGADLKEWNELNARGTVNKMTAPGLAGLPRRRSVKPII
FT                   AAVNGYCLGGGFEMAVNCDIVIASEKASFGLPEVQRGIAAVAGALPRLVRLIGKQRAAE
FT                   IALSGLPFPASQLERWGLVNRVVEHDQLLASAVETAKAIARNSPDSLRVTLEGLHYGWE
FT                   MASVEEASPPWSMSGIPN"
FT   gene            804618..806015
FT                   /locus_tag="ANIA_06234"
FT                   /old_locus_tag="AN6234.4"
FT                   /product="siderophore biosynthesis acetylase AceI, putative
FT                   (AFU_orthologue; AFUA_3G03400)"
FT   mRNA            join(804618..805577,805644..806015)
FT                   /locus_tag="ANIA_06234"
FT                   /old_locus_tag="AN6234.4"
FT                   /note="transcript_id=CADANIAT00006760"
FT   CDS_pept        join(804618..805577,805644..806015)
FT                   /locus_tag="ANIA_06234"
FT                   /old_locus_tag="AN6234.4"
FT                   /product="siderophore biosynthesis acetylase AceI, putative
FT                   (AFU_orthologue; AFUA_3G03400)"
FT                   /note="transcript_id=CADANIAT00006760"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006760"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006760"
FT                   /db_xref="GOA:Q5AZP6"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZP6"
FT                   /protein_id="CBF69890.1"
FT                   /translation="MAAKQQYPWVKLPHPYLTTYRIHIVSDSSPRVLQLRLHDSQVPGE
FT                   PLAEPLHNDALTYTDIAFDESAKDIPDNDNSPWARSQRAPGTTFQWTGTEPPSFAQIWN
FT                   VIHAIFLTHPQREVLRLDLKGAGNEIVREECIRTGLAVPYPSPRVPFGNESEPSGIDTL
FT                   ILLRSSFWQGAGSPLGPRPIWMVDQGTHGLARKSLSQYPVMPKNYEFSMKFPRERIYAR
FT                   HPVRPAKPTPGSLVYSRYIPHLDKHFSLMVVDWQNEEHLKRFNRWQNDPRVAKGWNETG
FT                   TLDEHREYLRRLHEDKHVLCLFGRFDDFPFAYYEIYWAKEDHYGAHYDAGDYDRGRHSL
FT                   VGEESIRGAERVNAWWSSCIHYCFLDEPRTQCVVGEPKATGGTVLSYENAQGLTIQSYV
FT                   DLGHKRSVHVFCSREKWFQLCPLFWDGRERPLESSDRAAWNAKL"
FT   gene            810600..811567
FT                   /locus_tag="ANIA_06233"
FT                   /old_locus_tag="AN6233.4"
FT                   /product="DnaJ domain protein (AFU_orthologue;
FT                   AFUA_2G13210)"
FT   mRNA            join(810600..810747,810816..811567)
FT                   /locus_tag="ANIA_06233"
FT                   /old_locus_tag="AN6233.4"
FT                   /note="transcript_id=CADANIAT00006761"
FT   CDS_pept        join(810600..810747,810816..811567)
FT                   /locus_tag="ANIA_06233"
FT                   /old_locus_tag="AN6233.4"
FT                   /product="DnaJ domain protein (AFU_orthologue;
FT                   AFUA_2G13210)"
FT                   /note="transcript_id=CADANIAT00006761"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006761"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006761"
FT                   /db_xref="GOA:Q5AZP7"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZP7"
FT                   /protein_id="CBF69892.1"
FT                   /translation="MSSRDQKVPEIPTEPPDETDLYLILGVKEDATPEQIKSAYRKLAL
FT                   RHHPDKAPADAREEANQQFQKIAFAYAILSDPRKRQRFDSTGSTAEAVELDDDFDWVDY
FT                   YREQFSTAIDTNALEKFKNEYQGSEEEGKDVLAAFETYGGDMDRVYESVMLCNVLDDDE
FT                   RFRAIIDKAIETGKVKGYKQYTEEPERKRQQRLKRAQKEAKEAEKLAKKLEKEKEVGSA
FT                   KAGGRKSNKGSAVETNDLAALIQQRQASRAESFFDRLEAKYNPSGKKRVAMDEPPDEAF
FT                   EATAARRGSKKTKSKTRA"
FT   gene            815577..817721
FT                   /locus_tag="ANIA_06232"
FT                   /old_locus_tag="AN6232.4"
FT                   /product="Vacuolar ATP synthase subunit B Fragment
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9P495]"
FT   mRNA            join(815577..815675,815767..815851,815929..815948,
FT                   816029..816064,816139..816300,816359..816675,
FT                   816733..817007,817059..817277,817349..817721)
FT                   /locus_tag="ANIA_06232"
FT                   /old_locus_tag="AN6232.4"
FT                   /note="transcript_id=CADANIAT00006762"
FT   CDS_pept        join(815577..815675,815767..815851,815929..815948,
FT                   816029..816064,816139..816300,816359..816675,
FT                   816733..817007,817059..817277,817349..817659)
FT                   /locus_tag="ANIA_06232"
FT                   /old_locus_tag="AN6232.4"
FT                   /product="Vacuolar ATP synthase subunit B Fragment
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9P495]"
FT                   /note="transcript_id=CADANIAT00006762"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006762"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006762"
FT                   /db_xref="GOA:Q5AZP8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005723"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZP8"
FT                   /protein_id="CBF69894.1"
FT                   /translation="MADTLDPRMTSVQPRIRYNTIGGINGPLVFLDNVKFPTYNEIVSL
FT                   TLPDGTERSGQVLEARGNRAIVQVFEGTSGIDVKKTKVEFTNHSLKLGVSEDMLGRVFD
FT                   GSGRAIDKGPKVLAEDYLDINGQPINPYSRVYPEEMISTGISAIDTMNSIARGQKIPIF
FT                   SASGLPHNEIAAQICRQAGLVKRPTKDVHDGHEDNFSIVFAAMGVNMETSRFFTRDFEE
FT                   NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVIMTDLSAYCDALRE
FT                   VSAAREEVPGRRGYPGYMYTDLSTIYERAGRVQGRNGSITQIPILTMPNDDITHPIPDL
FT                   TGYITEGQIFIDRQLYNKGIYPPINVLPSLSRLMKSAIGKGRTRDDHSDVSNQLYAKYA
FT                   IGRDAAAMKAVVGEEALSSEDKLSLEFLEKFERTFINQSAYESRSIFESLDIAWNLLRI
FT                   YPPHLLNRIPKRVLDEFYARSGRKIPNKDTRDNSVPEQGQSQTADLIET"
FT   gene            complement(817833..820448)
FT                   /locus_tag="ANIA_06231"
FT                   /old_locus_tag="AN6231.4"
FT                   /product="Bifunctional tryptophan synthase TRPB (EC
FT                   4.2.1.20) [Source:UniProtKB/TrEMBL;Acc:Q9P4D5]"
FT   mRNA            complement(join(817833..819766,819822..820125,
FT                   820232..820448))
FT                   /locus_tag="ANIA_06231"
FT                   /old_locus_tag="AN6231.4"
FT                   /note="transcript_id=CADANIAT00006763"
FT   CDS_pept        complement(join(818035..819766,819822..820125,
FT                   820232..820367))
FT                   /locus_tag="ANIA_06231"
FT                   /old_locus_tag="AN6231.4"
FT                   /product="Bifunctional tryptophan synthase TRPB (EC
FT                   4.2.1.20) [Source:UniProtKB/TrEMBL;Acc:Q9P4D5]"
FT                   /note="transcript_id=CADANIAT00006763"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006763"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006763"
FT                   /db_xref="GOA:Q5AZP9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZP9"
FT                   /protein_id="CBF69896.1"
FT                   /translation="MEHIKNTFEKVKREKRAALVAYITAGYPTIEESVDILLGLENGGA
FT                   DIIELGVPFTDPIADGPTIQKANTKALANGVTVSTVLEMVRSARNRGLKAPIMLMGYYN
FT                   PMLSYGEERMLRDCKEVGVNGFIMVDLPPEEAVRFRDLCTSTGLSYVPLIAPATSESRM
FT                   KLLCKIADSFIYVVSRMGVTGATGTLSSNIPELLARVHKWSGNVPTALGFGVSTREHFL
FT                   SVQEISEGVVIGSQIITVLGEAPAGQAAQKAEEYLSSVTGRKLERDTSGALTREVNVLE
FT                   PVLKIETPPMSQPTDVITEKDTPSGPGLGDQLEALNGGGSSSATPARFGEFGGQYVPES
FT                   LMDCLAELERGFDSALKDPSFWEEYRSYYPYMGRPSSLHLATRLTEHVGGANIWLKRED
FT                   LNHTGSHKINNALGQILLARRLGKTRIIAETGAGQHGVATATVCAKFGMKCVVYMGAED
FT                   VRRQALNVFRMKLLGASVVAVDAGSRTLRDAVNEALRAWVVDLDTTHYIIGSAIGPHPF
FT                   PTIVRTFQSVIGEETKQQLQEQIGKLPDAVVACVGGGSNAVGSFYPFSKDTSVKLLGVE
FT                   AGGDGIDTNRHSATLSGGSKGVLHGVRTYILQDEHGQVSETHSISAGLDYPGVGPELSN
FT                   WKDSDRAHFIAATDAQALSGFRTMAQTEGIIPALESSHAIWGAIELAKTMGKGKDIVLT
FT                   VSGRGDKDVESVAESLPKLGPQIGWDLRF"
FT   gene            complement(820680..825300)
FT                   /gene="medA"
FT                   /locus_tag="ANIA_06230"
FT                   /old_locus_tag="AN6230.4"
FT                   /product="Medusa [Source:UniProtKB/TrEMBL;Acc:O74251]"
FT   mRNA            complement(join(820680..821837,821893..823391,
FT                   823444..823609,823785..824494,824720..825300))
FT                   /gene="medA"
FT                   /locus_tag="ANIA_06230"
FT                   /old_locus_tag="AN6230.4"
FT                   /note="transcript_id=CADANIAT00006764"
FT   CDS_pept        complement(join(821400..821837,821893..823391,
FT                   823444..823483))
FT                   /gene="medA"
FT                   /locus_tag="ANIA_06230"
FT                   /old_locus_tag="AN6230.4"
FT                   /product="Medusa [Source:UniProtKB/TrEMBL;Acc:O74251]"
FT                   /note="transcript_id=CADANIAT00006764"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006764"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006764"
FT                   /db_xref="GOA:C8V1R3"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1R3"
FT                   /protein_id="CBF69898.1"
FT                   /translation="MSGYQRTPQAAVLDCDSAQSLQDGAAYSTYGQPVYMSTPLAPSPM
FT                   TDHISQMSDCMPYMAKPEYASSYEDEKSPMITVEPCQLPEVTSYSPQRGSEGTRVFVQL
FT                   QSPYDLHTTPYATLYIVFGSKKCECNPHFLGFRDSAFQYALSVDTPPFMSTGSPSLAVP
FT                   LQLAMGGQNESPATTLQVGVYTYENAGQQSPSEDGRKRRISSFSADSTSRPIKRASTLP
FT                   VQIKEEQSSYAAPYSPYLQPLPSMNGFAASYHTDSSPRMGATQYTTVSTNSQPSIRAPS
FT                   PMAPSPMAPSWNSSFLSVNHDQRGSGYAVGRGVCQPKPSSPASFSNPTLIRTSTLQQSA
FT                   GVVQTQSFNPYAMYPSKAVLKLNGDLNTMTHNWTREEQVAQRRLVQFTRMQSGSTIHAD
FT                   FKPVSPEERAPNSICISCIYWEGKDECFITSVDTIYLLESLVGVRFTVEEKNRIRRNLE
FT                   GFRPLTVSKSKADSEEFFKVIMGFPAPKPRNIEKDVKVFPWKILGHALKKIIGKYSASY
FT                   SSTAGALPTPIGSNYPSTGPASDSGAEGQSAASPQSISEGTPSSSYHQSNAVPIYSPPT
FT                   ETDGPIRTILPAVSQSYSNMTAPYSYTTVCHSGQVAPSGPAARSWELNQLATPSTMNGH
FT                   PNPGNFNYMPPMTYSQSDYPQGH"
FT   gene            complement(831751..833444)
FT                   /locus_tag="ANIA_10796"
FT                   /old_locus_tag="AN10796.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(831751..831793,831988..832099,
FT                   832417..832545,832893..833262,833337..833444))
FT                   /locus_tag="ANIA_10796"
FT                   /old_locus_tag="AN10796.4"
FT                   /note="transcript_id=CADANIAT00006765"
FT   CDS_pept        complement(join(831751..831793,831988..832099,
FT                   832417..832545,832893..833262,833337..833444))
FT                   /locus_tag="ANIA_10796"
FT                   /old_locus_tag="AN10796.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006765"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006765"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006765"
FT                   /db_xref="GOA:C8V1R4"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1R4"
FT                   /protein_id="CBF69900.1"
FT                   /translation="MDEDLIQKYGPGMSFYRAQIKAAQRQKRLGGEVVLTRYCAALREL
FT                   TLSNKLLEGKVKQLCSDSLRLTFDVTLLKRHMKAISGELLVTWQADILTRLVEVIYERH
FT                   GWRMPGEVLVSDKYSLDRDTLSKIYVMAARKIKKETIMKKAVGLSEQYYLALQRYRTGE
FT                   WFREVHSTTVARAKAPAARLFLTENWRSLLPCFARWLYLHGPFSKLGTVAVKSVFPRSL
FT                   LGLNAPTRVLHENPSPRSAIKTSCNYTGVTR"
FT   gene            complement(833654..834904)
FT                   /locus_tag="ANIA_10793"
FT                   /old_locus_tag="AN10793.4"
FT                   /product="alcohol dehydrogenase, putative (AFU_orthologue;
FT                   AFUA_2G13270)"
FT   mRNA            complement(join(833654..834034,834089..834904))
FT                   /locus_tag="ANIA_10793"
FT                   /old_locus_tag="AN10793.4"
FT                   /note="transcript_id=CADANIAT00006766"
FT   CDS_pept        complement(join(833738..834034,834089..834889))
FT                   /locus_tag="ANIA_10793"
FT                   /old_locus_tag="AN10793.4"
FT                   /product="alcohol dehydrogenase, putative (AFU_orthologue;
FT                   AFUA_2G13270)"
FT                   /note="transcript_id=CADANIAT00006766"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006766"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006766"
FT                   /db_xref="GOA:C8V1R5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1R5"
FT                   /protein_id="CBF69902.1"
FT                   /translation="MSKAIFLGKAEGKPGKVYYPLALKTLPQPTPKGTELLVKLSAAAL
FT                   NHRDVFLRQHLYPGLTFDVPMGADGVGTVVGAGPDVTNPERWQGKRVILNPGIGWKDSL
FT                   EGPEDPTGYKIMGGTKFYDKGTLQDYITIDESEVEEAPEHLSDAEAAALPLAGLTGWRA
FT                   LVVKAGESNTGKGAAVLITGIGGGVALISLLFAVARGADVYVTSSSEEKIRKSIELGAK
FT                   GGVNYKEDGWEKKLLGLLPKGKKNFDAVIDGAGGNSVEKSVKLLKAGGVLSIYGMTVSP
FT                   VMPFLMQAVLKNIDVRGSTMGSRKEFKDMVEFVKTHKVRPVVSRVVQAELSDVAALDGL
FT                   FQDMKDSKQFGKLVIEFGKPSGSKL"
FT   gene            837222..842328
FT                   /locus_tag="ANIA_06228"
FT                   /old_locus_tag="AN6228.4"
FT                   /product="GYF domain protein (AFU_orthologue;
FT                   AFUA_2G13290)"
FT   mRNA            join(837222..837290,837446..837630,837723..838137,
FT                   838214..841979,842030..842328)
FT                   /locus_tag="ANIA_06228"
FT                   /old_locus_tag="AN6228.4"
FT                   /note="transcript_id=CADANIAT00006767"
FT   CDS_pept        join(837536..837630,837723..838137,838214..841979,
FT                   842030..842328)
FT                   /locus_tag="ANIA_06228"
FT                   /old_locus_tag="AN6228.4"
FT                   /product="GYF domain protein (AFU_orthologue;
FT                   AFUA_2G13290)"
FT                   /note="transcript_id=CADANIAT00006767"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006767"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006767"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="InterPro:IPR035445"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZQ2"
FT                   /protein_id="CBF69904.1"
FT                   /translation="MPTPLPSSFASAAAGNTQDASRRGDGTSSGEWSRTRMNGATQTFR
FT                   RPSVATNPSHTRDATSATTPTGSAGGAYSTHMSSTRNGASVDTRYSKEQLLDLYKAQRE
FT                   SGVLSKNVADYFVADWNPHIETPTANGAWGKRDDHKDNPIGPEVCWDHGGQFEPLGLVD
FT                   MTDDEKETFSTSVNSPLKPPPTNAAKENAATGGSGRRTSVSYPQGNAPYNTSSPSSTRP
FT                   GPRRRETGDSIGNPMSPTTSGSRFFRDEPNTSTPPPSLLRRKTDFRDATSVSKWEEKEK
FT                   EAQGRDTADTSSPFGSLKRSSTNPVGLPGSTSPWPSASQNANFSPMGAFGAFNLGTSSA
FT                   AQTPTTEKRPGFGSLRGESRLKGLFSKDSSEDIPSVREKSSLSNLDRLGESEAEKRSQS
FT                   PWGEQLKTRTGRSETNPFSDEPRSGSAALGGSQDVSTPSQVADQLGFSAFGMTSSIPGF
FT                   RDLMQSHENSRNPTPHLPGREPTSPTNTNPYQSPHGDRGDVDDVDTDGSDIQNTNHPGL
FT                   SGLRDSAAFGSIRRVGSGMDLPSIDRSQSSSVAGNRSFSNLGSLGGLPSLGGAGWPSSG
FT                   AVGTPTKDRSAFATGFGDPIFGSMADLQSPSLATLGAGGLFSPHAGISTSGSIGRSSKL
FT                   GSLFPQAMQEQIQSEQPRHDLSSFDETQTGESILSLSKNSLTTSGHQADAPGQTVPATT
FT                   STSHTPVSAVGSIPTSMVPEGQQASQAGSTAGSVPTAQQRTMVMPDRMRWIYRDPQGNI
FT                   QGPWTGLEMHDWFKAGFFSPDLQIRKLEDPEFEPLAQLVRRIGNSREPFLVPQIGVPHG
FT                   PEPNASTWGGAAPTGSAQPPFPGSFPSFGTTLTAEQQNALERRKQEEQYLMARQKEHLA
FT                   QQQAMLKQTQFQPGVPGIYPPQLQHHSSAHSLHSQPSFGSIASPIGFQPSPIQGPLQQQ
FT                   QPGSGFFDASGAIRPNPLPNVGSQMLGTDFLNSSQEQLPSLLDRLNVNRSDPFTFGSPT
FT                   SFAARQPDNLFPNPQVATMLQDRARLQQEQEQFDSTHGDTLFDQQAREERLRQFHALRA
FT                   QEGDFGMRTTEGLPTHPATAPSQPAKNAEDNAALEELTKSITSEEPVLTLSQQVQKAAQ
FT                   EQEEQEQKKQQQQQQAQSTSDAAWATRGDSAMPQPFPPPPSASPLPAPAAQRNRQNVAE
FT                   SLAANSRSQTQTPVEAPTTSIAPWAKEVNEMPKGPSLKEIQEAEARNAAQREEMAAAAR
FT                   RAQLLAEQERLSQAQAQQSPGLPSSANWASAGSPATPTSTGSVWNNKGAATTSAAKKTL
FT                   AQIQKEEEARKQRSAAAAAAAAAQNIAATTPTPSSTGKRYADLASKAPAASPVSAGSGA
FT                   WTTVGASGKAKAPPVAPTGPRSTSGPVPVAASPVRPKAVTATTTAPRTVPATTPSSNPS
FT                   RAMEEFTKWAKLTLGKGLNSNINVDDFVQQLLLLPAEAEIISDSVYANSQTLDGRRFAD
FT                   EFIRRRKLADKGIVESVSTSALAEKNGGGWSEVAKKGSASTSREEDTSNAAFKMVAPRK
FT                   KGKR"
FT   gene            842482..844001
FT                   /locus_tag="ANIA_06227"
FT                   /old_locus_tag="AN6227.4"
FT                   /product="aminotransferase family protein (LolT), putative
FT                   (AFU_orthologue; AFUA_2G13295)"
FT   mRNA            join(842482..842560,842610..843213,843272..844001)
FT                   /locus_tag="ANIA_06227"
FT                   /old_locus_tag="AN6227.4"
FT                   /note="transcript_id=CADANIAT00006768"
FT   CDS_pept        join(842482..842560,842610..843213,843272..844001)
FT                   /locus_tag="ANIA_06227"
FT                   /old_locus_tag="AN6227.4"
FT                   /product="aminotransferase family protein (LolT), putative
FT                   (AFU_orthologue; AFUA_2G13295)"
FT                   /note="transcript_id=CADANIAT00006768"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006768"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006768"
FT                   /db_xref="GOA:Q5AZQ3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZQ3"
FT                   /protein_id="CBF69906.1"
FT                   /translation="MASPTPFGAPMKAHFLLDPNYNNLNHGSFGTYPSQVLEKQQSIQK
FT                   SLESRPDIFIRYIQPGLIDTSRAALAPLLNVPVSDLVLVKNATTGVNTVLHNLALTRTL
FT                   TADDVIFYFDTVYGAVERALFALKESWGVKLRKVKYVFPLEEGGMVKRFREALKSVRKE
FT                   GLTPKLAVFETVVSNPGIRFPFEEITRACKEEGVLSLIDGAHAVGMIKLDLAALGVDFF
FT                   TSNCHKWLYTPRSCAVLYVPERNQKFIRTSLPTSWGYVPPQVPPSESGEDKDIPPSTLP
FT                   NTGKSPFVALFEFTGTTDDSAYACVPAALNFRDEVCGGEERIYAYLERLAGEAGELLAS
FT                   ALGTDVLRAVKDASGAGKGGKGLGCSMVNVRLPIRITNLDLNSGTKDKAINVRPEDVSP
FT                   LSHWLHEQLIARGTFVPCFPHGQWMFVRLSAQVYLERSDFVWLGDVFKHIMEGVPGFLE
FT                   ANKNGTQAKAKI"
FT   gene            complement(844133..845849)
FT                   /locus_tag="ANIA_10795"
FT                   /old_locus_tag="AN10795.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(844133..845597,845665..845849))
FT                   /locus_tag="ANIA_10795"
FT                   /old_locus_tag="AN10795.4"
FT                   /note="transcript_id=CADANIAT00006769"
FT   CDS_pept        complement(join(844133..845597,845665..845849))
FT                   /locus_tag="ANIA_10795"
FT                   /old_locus_tag="AN10795.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006769"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006769"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006769"
FT                   /db_xref="GOA:C8V1R8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1R8"
FT                   /protein_id="CBF69908.1"
FT                   /translation="MRTLYHNASVFSRTEYDSKDADTCLLVEDESIIYVGSEQDAPASD
FT                   KQVNLAGRRVLPGFIDGHMHLLLFGSSLSKISLAGCTSLSEIQSTIRDAATSRSPTTYP
FT                   RLFCSGWMHSMTDGQALASDLDDLDPHGRPIFIDAKDLHSAWCNTAALTDLGIDKSTPT
FT                   PAGGDIARDNDGNPTGLLSESAAVTIVWPHVARVATTNEKKEYVKDAIRAYNAAGYTGM
FT                   VEMATDENIFETARQLREQEPESFSIRLAMHWLITPAASEEEVLAQVDRAIELHEKYNK
FT                   ETSSDFRIAGIKVICDGVVDACTAALLEPYTAGLSNTASTASPAPLWEEGILRKVVQRA
FT                   DGARLQVALHAIGDAAVALAINTLETVEPRPGSQSRRHRIEHLELTSPSDASRLASLGI
FT                   TASIQPVHADPAILRAWPRLLGPERVRRAFAYREFAEAGANVAIGTDAPTAPHSALRNL
FT                   YTATTRRSAREPECQETVNEGFKLSLVQAISAATRNAAYSCFADDVTGALEVGKKADFV
FT                   VLDMQWNENKLLEARVVKTYFQGRCVFAESES"
FT   gene            complement(846729..848652)
FT                   /locus_tag="ANIA_10792"
FT                   /old_locus_tag="AN10792.4"
FT                   /product="RING finger domain protein, putative
FT                   (AFU_orthologue; AFUA_2G13310)"
FT   mRNA            complement(join(846729..847300,847373..847861,
FT                   847909..848498,848611..848652))
FT                   /locus_tag="ANIA_10792"
FT                   /old_locus_tag="AN10792.4"
FT                   /note="transcript_id=CADANIAT00006770"
FT   CDS_pept        complement(join(847102..847300,847373..847861,
FT                   847909..848498,848611..848652))
FT                   /locus_tag="ANIA_10792"
FT                   /old_locus_tag="AN10792.4"
FT                   /product="RING finger domain protein, putative
FT                   (AFU_orthologue; AFUA_2G13310)"
FT                   /note="transcript_id=CADANIAT00006770"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006770"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006770"
FT                   /db_xref="GOA:C8V1R9"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1R9"
FT                   /protein_id="CBF69910.1"
FT                   /translation="MDTGDRVLCHACGQIEIPPDTDPEPSPSPSPSHPHPDPPESFPGQ
FT                   RSPTPSSSNPFADHNPWAHTDDIDDGHGWSNVVGYQYTHRTFQSPGGNIHFSYHAHSLP
FT                   PRRGQAATRGAVDDPTDPIQPAFHGFNSFFQSLTELNRQRAARAQGPGSPGSPGRPQPR
FT                   RSFFDEIYGPDNGPHSSRGPFDDGAGGLFPRDADRPQPMGSPLRSLGDILELFHTNLNN
FT                   LQAGQLGETDRPGRPNVRVVTGGTPIRALLEVLMDISRNGDAVYSQEELDRVISELVEQ
FT                   NGNRTAAPPAAQDVIRALPKKRADAEMLGGEGTECSICMDAVKVGDEVTVLPCTHWFHP
FT                   QCIELWLNQHNSCPHCRRGVDPTAADANATNTMPSGTEGTDAQARHSPSSSSNNRPPTA
FT                   SAEEEGSGSRPRTTSRSESTSSNSGGWTGWVRSRLGGGGS"
FT   gene            complement(849339..849977)
FT                   /locus_tag="ANIA_06225"
FT                   /old_locus_tag="AN6225.4"
FT                   /product="Mitochondria fission 1 protein
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZQ5]"
FT   mRNA            complement(join(849339..849665,849735..849828,
FT                   849885..849903,849956..849977))
FT                   /locus_tag="ANIA_06225"
FT                   /old_locus_tag="AN6225.4"
FT                   /note="transcript_id=CADANIAT00006771"
FT   CDS_pept        complement(join(849339..849665,849735..849828,
FT                   849885..849903,849956..849977))
FT                   /locus_tag="ANIA_06225"
FT                   /old_locus_tag="AN6225.4"
FT                   /product="Mitochondria fission 1 protein
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZQ5]"
FT                   /note="transcript_id=CADANIAT00006771"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006771"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006771"
FT                   /db_xref="GOA:Q5AZQ5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016543"
FT                   /db_xref="InterPro:IPR028058"
FT                   /db_xref="InterPro:IPR028061"
FT                   /db_xref="InterPro:IPR033745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZQ5"
FT                   /protein_id="CBF69911.1"
FT                   /translation="MTSSNLPYAADAESPLKPAELQVLRAQYEKEGDYVGVQTKFNYAW
FT                   GLIKSNFRADQQEGVRLLSEIFRAHPERRRECLFYLALGNYKLGNYGEARRYNDLLIDK
FT                   EPGNLQAASLRTLIDDRVSREGMVGIAIVGGLALAAGVVGGLLFRGQRR"
FT   gene            850218..850914
FT                   /locus_tag="ANIA_06224"
FT                   /old_locus_tag="AN6224.4"
FT                   /product="Probable kinetochore protein spc24
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZQ6]"
FT   mRNA            join(850218..850244,850292..850689,850737..850914)
FT                   /locus_tag="ANIA_06224"
FT                   /old_locus_tag="AN6224.4"
FT                   /note="transcript_id=CADANIAT00006772"
FT   CDS_pept        join(850218..850244,850292..850689,850737..850914)
FT                   /locus_tag="ANIA_06224"
FT                   /old_locus_tag="AN6224.4"
FT                   /product="Probable kinetochore protein spc24
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZQ6]"
FT                   /note="transcript_id=CADANIAT00006772"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006772"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006772"
FT                   /db_xref="GOA:Q5AZQ6"
FT                   /db_xref="InterPro:IPR013252"
FT                   /db_xref="InterPro:IPR038066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZQ6"
FT                   /protein_id="CBF69913.1"
FT                   /translation="MLLDENPSTLIHHTIGNFNIAPDKQAVSRINDSLATLQQSRELRM
FT                   REAESSLRKLSRHLQSLSTQHEEAVAAHDASKHAAAMVELDTKKFRIAKAASELEIESE
FT                   RLEGELEMLKERLADLEAQGLEGDEATRREREADDAILLRLKIYRALGIDIEPDEAGNF
FT                   TKAVIRNSRKGDVHVVNLDPKFSRFFYANYFWSTMQG"
FT   gene            852199..852876
FT                   /locus_tag="ANIA_06223"
FT                   /old_locus_tag="AN6223.4"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 21 (Mediator complex subunit 21)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZQ7]"
FT   mRNA            join(852199..852240,852307..852876)
FT                   /locus_tag="ANIA_06223"
FT                   /old_locus_tag="AN6223.4"
FT                   /note="transcript_id=CADANIAT00006773"
FT   CDS_pept        join(852199..852240,852307..852876)
FT                   /locus_tag="ANIA_06223"
FT                   /old_locus_tag="AN6223.4"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 21 (Mediator complex subunit 21)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZQ7]"
FT                   /note="transcript_id=CADANIAT00006773"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006773"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006773"
FT                   /db_xref="GOA:Q5AZQ7"
FT                   /db_xref="InterPro:IPR021384"
FT                   /db_xref="InterPro:IPR037212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZQ7"
FT                   /protein_id="CBF69915.1"
FT                   /translation="MADILTQLQTCLDQLATQFYATIGYLTTYHDNSPAIPPDNPTSAP
FT                   ALAKIQKNSTNPPIPAGAAAILNASQGSPSGAATGAVTPGPPAPNASAGSGAGEAGAAR
FT                   QEEGLPPRPDSPRTFTARQRELARDLVIKEQQIEYLISVLPGIGSSEAEQERRIRKLEE
FT                   ELRAVEEEREKRVRELRVLRRRVEEVLGAVEGGIYGGSSY"
FT   gene            complement(852937..856732)
FT                   /locus_tag="ANIA_10794"
FT                   /old_locus_tag="AN10794.4"
FT                   /product="single-stranded DNA-dependent ATPase (Eurofung)"
FT   mRNA            complement(join(852937..855954,856012..856732))
FT                   /locus_tag="ANIA_10794"
FT                   /old_locus_tag="AN10794.4"
FT                   /note="transcript_id=CADANIAT00006774"
FT   CDS_pept        complement(join(853163..855954,856012..856732))
FT                   /locus_tag="ANIA_10794"
FT                   /old_locus_tag="AN10794.4"
FT                   /product="single-stranded DNA-dependent ATPase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006774"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006774"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006774"
FT                   /db_xref="GOA:C8V1S3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1S3"
FT                   /protein_id="CBF69917.1"
FT                   /translation="MLLNPRAYKKQLQKNGKDPDILSCLSGLQQDHCTGPDSQNAPHTL
FT                   HSSYRRSPTPPEDPEGSDSEGLLATTVGQQGTNSQQRDIAPSMTPQGTAVADRLLSPQR
FT                   PSSHRASRSRAQYPSSAGSTNTSTSPQSSTHVTPEIDVQFTNTSGVDDCDGKRSARFVE
FT                   LSNDADLRPGSLIENMYGVERRAGNPYKRVKTEQEKIEKAKRGFTVGNSELGEYMRKDD
FT                   GGTGISTAITPDIVDLTIDASGSNDDDDLQVTGSNNLSVQRVCYGKLENATIQASLIPM
FT                   PAPQTILGDIAHWPSMKLGVHRQAGQTNNRIEVSDPNGKVFGVVDSRTAAVIVPLLDSP
FT                   ALKVEIAARLDVRKKLPNEVPWTPCSSIFRASINLYGLRQDAEKVGNYLGQNNVWLATP
FT                   FSVEQGVPVFNPHAERRRLQPSYAPTGSQRNRSGVNYEVRSAEEVTDAVMKMFDQLQSA
FT                   DNLPEMDPPAVVTTPLLRHQKQALWFMTEKEAPRKFGPKEEDNNSLWREEYSANGTKKY
FT                   REVISGIVLDQEPPQSLGGLLADMMGLGKTLSILSLVISSLAQAQEWARMIPQPGLVKS
FT                   RPGIRNTKTTLLVAPLSTVNNWVSQVKEHLRDGALTSYVFHGSSRTTSVDELSKYDLVI
FT                   TTYSIVLSELSGRGSRRAGSSPLTKMNMFRIVLDEAHTIREQSAAQTQAIFRLNAQRRW
FT                   SVTGTPIQNRLDDLLSVTKFLGIYPYDDRSRFNMHILSRFKTGDATVLASLRVLVDSFT
FT                   LRRVKDKIDLPARHDKIVMLEFSESEAQLHEFFRKESNVMMRVIAGEDKSKMKGRMYHH
FT                   ILKAMMILRQISAHGKELLDSDERARIKGLSVHDAIDLEEGPSADAVATDKKAYEMFTL
FT                   MQESSADMCAICSKRLEEPNPDANGSSVPGKVDIIAFILPCFDVLCPECFSGRKQVFNN
FT                   RVGDQDSFDVKCDVCEGWISASYSAITAAGLQDYLMEQAREKQTRKQAKVLGEYEGPHT
FT                   KTKALLSHLLATAEESAKLPEGEAPIKSVVFSAWTSHLDLIEIALRDQGLTGYTRLDGT
FT                   MSLPARNKALDNFRDDNNTTILLATIGAGGVGLNLTAASHVYIMEPQYNPAAVAQAIDR
FT                   VHRLGQTREVTTVQFIMKDSIEEKIAELAKKKQQLADMSLNRGKLDKAEVQEQRMREYR
FT                   SLFK"
FT   gene            complement(857580..859959)
FT                   /locus_tag="ANIA_10791"
FT                   /old_locus_tag="AN10791.4"
FT                   /product="phosphatidylinositol 4-kinase type II subunit
FT                   alpha, putative (AFU_orthologue; AFUA_2G13370)"
FT   mRNA            complement(join(857580..858407,858460..859959))
FT                   /locus_tag="ANIA_10791"
FT                   /old_locus_tag="AN10791.4"
FT                   /note="transcript_id=CADANIAT00006775"
FT   CDS_pept        complement(join(857580..858407,858460..859959))
FT                   /locus_tag="ANIA_10791"
FT                   /old_locus_tag="AN10791.4"
FT                   /product="phosphatidylinositol 4-kinase type II subunit
FT                   alpha, putative (AFU_orthologue; AFUA_2G13370)"
FT                   /note="transcript_id=CADANIAT00006775"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006775"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006775"
FT                   /db_xref="GOA:C8V1S4"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR039756"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1S4"
FT                   /protein_id="CBF69919.1"
FT                   /translation="MPKNNRPATSGYARLAQEEEDRHNDPYEYSDDDDLYHTSSTVNPY
FT                   GTHYEPISTRGSMPPGVATTPPEYRRRSSVQHRRGRRNSAVDIKAINARLERWAEEFAS
FT                   KFKIHRVKGKTLEEEKLEIYHSVFQPPNGVRPITAEELDSEEAEMATRKAREGFEEVVE
FT                   SVRLAIELGVHPRMISQGSSGSYFARNSEGKVVGVFKPKDEEPYASRNPKWTKWIHRNL
FT                   FPCFFGRACLIPNLSYVSEAAAYVLDSRLRTNMVPYTDIVWLSSKSFYYDFWDRRKAWM
FT                   GKKPLPPKAGSFQVFLKGYKDANLFLREHPWPDQTNTGFRAQDAPKRKKRPWNEACRPS
FT                   GIQSDDEDEGEEDEDYHARTPSPQEESRERRFYWTENLKQSFREELEKLVILDYIMRNT
FT                   DRGLDNWMIKIDWKTEDVSIVAEPPKPNEHQQDDDDHLVPPRPVSVNSDKATSPSYPYR
FT                   RHETMQAVSRTGTPLNSQEPQATIQIGAIDNSLSWPWKHPDAWRSFPFGWLFLPVSLIG
FT                   QPFSQKTRDHFLPLLTSTAWWSGTQMALRRVFSQDDDFKESMFARQIAVMKGQAWNVVE
FT                   TLKQPDHGPLELTRRTRVCVWDDLVDVPVAIPLRGPSTEAQRRKIRGYDDRYDPDNEEM
FT                   DIGAAMSVADQDLMGFQSPPSELPNPNRFELSRGRTSRDSVRPPTASSTDYGFSRDSAD
FT                   GLSPRRNGDQTWPSLPPRPGNKHQKHSSVSSARGAHVIWSSDDLEGDLGYAAAEGMEGN
FT                   QRKVIVERIEAVKSKNPVFTWC"
FT   gene            863741..864764
FT                   /locus_tag="ANIA_06221"
FT                   /old_locus_tag="AN6221.4"
FT                   /product="GATA factor AREB alphaPutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q9HEV2]"
FT   mRNA            join(863741..863971,864057..864764)
FT                   /locus_tag="ANIA_06221"
FT                   /old_locus_tag="AN6221.4"
FT                   /note="transcript_id=CADANIAT00006776"
FT   CDS_pept        join(863741..863971,864057..864764)
FT                   /locus_tag="ANIA_06221"
FT                   /old_locus_tag="AN6221.4"
FT                   /product="GATA factor AREB alphaPutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q9HEV2]"
FT                   /note="transcript_id=CADANIAT00006776"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006776"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006776"
FT                   /db_xref="GOA:G5EB05"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR039355"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB05"
FT                   /protein_id="CBF69921.1"
FT                   /translation="MASILADQKRPQLQPICQNCGTSKTPLWRRDELGSVLCNACGLFL
FT                   KLHGRPRPISLKTDVIKSRNRVKTAGQGPKRKSGSAVDGNGLSSSRSEAGTPPLGVSQG
FT                   YRRASRKMSPGHSDRSNSPVPPTDAHGLSALHQPLAQPHHNSNIAPQHLFDSVTAGDHT
FT                   SQLPSVQLRQPSPTSTTAPVDRHHEPPQTYEDLLAANTSLKTRVSELDLINGLFRGRVA
FT                   ELEQSDATARRSEMILRDSEVRLRRSLDDAQRREEELKRRIAELERQLAERTNGANTSQ
FT                   ENPLEPLAKRMKLSDVVEHDSNSPAKSPKSI"
FT   gene            867952..869259
FT                   /locus_tag="ANIA_06220"
FT                   /old_locus_tag="AN6220.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_2G13390)"
FT   mRNA            join(867952..868496,868544..868559,868607..868724,
FT                   868760..869259)
FT                   /locus_tag="ANIA_06220"
FT                   /old_locus_tag="AN6220.4"
FT                   /note="transcript_id=CADANIAT00006777"
FT   CDS_pept        join(867952..868496,868544..868559,868607..868724,
FT                   868760..869259)
FT                   /locus_tag="ANIA_06220"
FT                   /old_locus_tag="AN6220.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_2G13390)"
FT                   /note="transcript_id=CADANIAT00006777"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006777"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006777"
FT                   /db_xref="GOA:Q5AZR0"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZR0"
FT                   /protein_id="CBF69923.1"
FT                   /translation="MSAVLFHGDTGRFLLMLALGTSLVNFFSTPFMRLLAPAPAAPYIS
FT                   VSRPRSVESRPLRRPKSTELQSHFGDSGEAGMHTSTTIFSQSAIHSRNHSTASHSQPNG
FT                   NGPDFDELSSLVSKTPSRTSQESFYERNAEVDDDGFSDVTPDSRQPDIRGLAMLRKIEF
FT                   WQLFLTMALLSGIGLMTINNIGNSAKSLWEHYDDSASPKFIQERQVMHVSILSFGNFAG
FT                   RLSSGSHSLGIGSDILVKKFNMSRFWCLFMSSAVFTLTQLAGASIWNPNQLAIVSAFTG
FT                   IAYGFLFGVFPSLTAHTFGINGLSQNFGVMTMAPVLSGNIFNLFYGMVYDHHSIVDRNG
FT                   DRDCPDGLSCYQSAYYMTFFSGVGGIIVCLWSIWRDGRRTRTHAKLEHDRLA"
FT   gene            870096..870619
FT                   /locus_tag="ANIA_11504"
FT                   /old_locus_tag="AN11504.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(870096..870161,870413..870619)
FT                   /locus_tag="ANIA_11504"
FT                   /old_locus_tag="AN11504.4"
FT                   /note="transcript_id=CADANIAT00006778"
FT   CDS_pept        join(870096..870161,870413..870619)
FT                   /locus_tag="ANIA_11504"
FT                   /old_locus_tag="AN11504.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006778"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006778"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006778"
FT                   /db_xref="GOA:C8V1S7"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1S7"
FT                   /protein_id="CBF69925.1"
FT                   /translation="MPIKSLTRHQKQPWKASTAYYINNFRYPWDNLTSPCYYQRGDFNM
FT                   TFTGLVYQLPLFEPPNSTSQRARIDRADEPESTEPTSQYCRAVRA"
FT   misc_feature    870686..877350
FT                   /note="contig 1.204 330..6994(-1)"
FT   gene            871916..873119
FT                   /locus_tag="ANIA_11245"
FT                   /old_locus_tag="AN11245.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(871916..872293,872365..873119)
FT                   /locus_tag="ANIA_11245"
FT                   /old_locus_tag="AN11245.4"
FT                   /note="transcript_id=CADANIAT00006779"
FT   CDS_pept        join(871923..872293,872365..873058)
FT                   /locus_tag="ANIA_11245"
FT                   /old_locus_tag="AN11245.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006779"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006779"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006779"
FT                   /db_xref="GOA:C8V1S8"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1S8"
FT                   /protein_id="CBF69926.1"
FT                   /translation="MAFRSPLLTLFAAALLFLGVCTARSIPTRRSPVSLSSFDHDLDSV
FT                   EIWTRRVHDSGSDSDDASTSSTSTTSSSTTNSNNDNSDHDNDATSSSSTSDTCLKAKNV
FT                   TRIIQNDDGYGSYYSSGIGSENSTAGGTTPDGSGTAPRFDNSTGAFVTLADDNAANAVD
FT                   IKDQHYLSYLGGAAVPFKSGDHSPNGVSPKKLNNLPFTTVDENNVKDGSCAVPNTSYAY
FT                   DYQSKYSLGSAGNVPVYCLCDPYGLCGCDDHHGNSSFVDAMLAYMGLGDEAKNISRICT
FT                   VSLDGATTILVDGGLSNGSTKADPDADEVLARVPRTKSTRCGGNGGTGAAVAVSVNSWS
FT                   LGVISLAVASLVWL"
FT   gene            873636..875467
FT                   /locus_tag="ANIA_11244"
FT                   /old_locus_tag="AN11244.4"
FT                   /product="membrane protein TMS1, putative (AFU_orthologue;
FT                   AFUA_2G13400)"
FT   mRNA            join(873636..873732,873815..873894,873954..874542,
FT                   874587..875467)
FT                   /locus_tag="ANIA_11244"
FT                   /old_locus_tag="AN11244.4"
FT                   /note="transcript_id=CADANIAT00006780"
FT   CDS_pept        join(873682..873732,873815..873894,873954..874542,
FT                   874587..875297)
FT                   /locus_tag="ANIA_11244"
FT                   /old_locus_tag="AN11244.4"
FT                   /product="membrane protein TMS1, putative (AFU_orthologue;
FT                   AFUA_2G13400)"
FT                   /note="transcript_id=CADANIAT00006780"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006780"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006780"
FT                   /db_xref="GOA:C8V1S9"
FT                   /db_xref="InterPro:IPR005016"
FT                   /db_xref="InterPro:IPR029559"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1S9"
FT                   /protein_id="CBF69928.1"
FT                   /translation="MGALLSLPLLALPSAGTVLTAVGSCCGAATCSAVCSACGKFNNSM
FT                   ATRIAYAFILLINSIVSWIMLTPWALKKLQHLTLDYMEIKCDGKECYGWVAVHRINFGL
FT                   GLFHLVLALFLLGVRSSKDGRAALQNGFWGPKIVLWLLFVVMSFFIPEAFFFVYGHYIA
FT                   FFCAMLFLLLGLILLVDLAHTWAELCLQKIEESDSRTWRGLLIGSTLGMYIASIVMTIL
FT                   MYIFFAKSGCSMNQAAISINLVVFLIISFVSVQPAVQENNPRAGLAQAAMVTAYCTYLT
FT                   LSAVSMEPDDRQCNPLIRARGTRTATIVLGAIVTMATIAYTTTRAATQGFALGSKGHNY
FT                   SELGTDDNEHGLVTQQPSARREMRAEALRAAVASGALPASALDESDDEDDYDVKDDEKG
FT                   STQYNYSLFHIIFFLATTWVATLLTQNLDPESVDDFAPVGRTYWASWVKIISAWVCYAI
FT                   YLWTLVAPILLPDRFDMY"
FT   gene            complement(875669..877583)
FT                   /locus_tag="ANIA_09490"
FT                   /old_locus_tag="AN9490.4"
FT                   /product="methionine transporter (Eurofung)"
FT   mRNA            complement(join(875669..875897,875963..876215,
FT                   876268..876404,876459..876917,876966..877041,
FT                   877094..877189,877241..877480,877541..877583))
FT                   /locus_tag="ANIA_09490"
FT                   /old_locus_tag="AN9490.4"
FT                   /note="transcript_id=CADANIAT00006781"
FT   CDS_pept        complement(join(875669..875897,875963..876215,
FT                   876268..876404,876459..876917,876966..877041,
FT                   877094..877189,877241..877480,877541..877583))
FT                   /locus_tag="ANIA_09490"
FT                   /old_locus_tag="AN9490.4"
FT                   /product="methionine transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006781"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006781"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006781"
FT                   /db_xref="GOA:C8V1T0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1T0"
FT                   /protein_id="CBF69930.1"
FT                   /translation="MNVSKMVGTGIFSTPSSVFEGTGSIGLGLFYWVIGFAVAASMLSV
FT                   YLEFASYFPSRSGSEAVYLEQAYPRPRYFFPTVFAVQTVVFSFSSSNAIVLANYLFRLA
FT                   ESEPTAWQSKGVALASYTVAVLAVSFNTKWSLQLSNALGWVKLITLIFIAIAGLVVLGG
FT                   NVSSITDSTAHFRNAFEGTSNATVYGATNSLINVMFSYQGYENAFNLVNEVKNPVKTLK
FT                   WSTPASLITVGILYMLANIAYVAAASKQEIVESEINVASLFFQKVFGGGGASRALNFLI
FT                   CVSAFGNLLVVLIGQSRMLRECGRQGVLPFTRFWTSTRPFGTPLGPYWLKWALTAIMIL
FT                   APPAGDAFNFVVDLGIYPQSMFNFFLAVGLLFTRRHRKRLNIPRTEWHAWDIVVYFAIL
FT                   ANLYLLVAPWYPPAGGANGGDVSFWYGTYVVVGISLIGLCGVYYWVYMKVLPHFGGYQF
FT                   RQTIITGPAGETSHKMVKVPNDELARWDEEHDAAGRLRRRANAHKTEQPLEA"
FT   misc_feature    877351..1153779
FT                   /note="contig 1.105 755..277183(-1)"
FT   gene            complement(878527..879475)
FT                   /locus_tag="ANIA_10785"
FT                   /old_locus_tag="AN10785.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(878527..879029,879095..879475))
FT                   /locus_tag="ANIA_10785"
FT                   /old_locus_tag="AN10785.4"
FT                   /note="transcript_id=CADANIAT00006782"
FT   CDS_pept        complement(join(878694..879029,879095..879475))
FT                   /locus_tag="ANIA_10785"
FT                   /old_locus_tag="AN10785.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006782"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006782"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006782"
FT                   /db_xref="GOA:C8V1T1"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1T1"
FT                   /protein_id="CBF69932.1"
FT                   /translation="MESRTTSQPSTNPPSIEIAYKRKCIALKKRLSEIEAENELMRTRN
FT                   RRGWQYIQKMRLESCILLERLATVTGMAEEAQAGVNPELRARAAAMVTNTASLDGMAPP
FT                   RNGSGPGYYEDETEGSSDEQPPTPQERPLRVKRSRKSNLPIDDDDLPAGTTPETSGAGA
FT                   SSAWPRLAPAPSQEEMTSSFRIQQGNGSGQEKETPLPSDREGENRYVSGERAVDPSAET
FT                   SATPMELDNKVLKEES"
FT   gene            complement(879788..880931)
FT                   /locus_tag="ANIA_10782"
FT                   /old_locus_tag="AN10782.4"
FT                   /product="mitochondrial phosphate transporter Pic2,
FT                   putative (AFU_orthologue; AFUA_2G12080)"
FT   mRNA            complement(join(879788..879889,879942..880065,
FT                   880116..880712,880841..880931))
FT                   /locus_tag="ANIA_10782"
FT                   /old_locus_tag="AN10782.4"
FT                   /note="transcript_id=CADANIAT00006783"
FT   CDS_pept        complement(join(879841..879889,879942..880065,
FT                   880116..880712,880841..880931))
FT                   /locus_tag="ANIA_10782"
FT                   /old_locus_tag="AN10782.4"
FT                   /product="mitochondrial phosphate transporter Pic2,
FT                   putative (AFU_orthologue; AFUA_2G12080)"
FT                   /note="transcript_id=CADANIAT00006783"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006783"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006783"
FT                   /db_xref="GOA:C8V1T2"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1T2"
FT                   /protein_id="CBF69934.1"
FT                   /translation="MATQERKYPLGKIEPNTLKYFGACTMGGIIVDPKIYTSNISAWRS
FT                   IISKEGVRGIFFGWSPTFIGYSFQGAGKYGFYEYFKYLYGERMFPNTNRTVMHLAASAS
FT                   AEFIADIALCPFEAIKVRMQTTLPPYAHSLREGWSKIIAQEGVSGFYKGLYPLWARQIP
FT                   YTMTKFATFEETVSMIYKTLGGPKESYNSLQQTGISFAGGYIAGIFCAIVSHPADVLVS
FT                   KLNADRKAGESAMKAVSRIYGNIGFSGLWNGLPVRILMLGTLTGFQWLIYDSFKVFLGL
FT                   PTTGH"
FT   gene            complement(881684..883819)
FT                   /locus_tag="ANIA_06218"
FT                   /old_locus_tag="AN6218.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(881684..882610,882674..883378,
FT                   883493..883819))
FT                   /locus_tag="ANIA_06218"
FT                   /old_locus_tag="AN6218.4"
FT                   /note="transcript_id=CADANIAT00006784"
FT   CDS_pept        complement(join(881684..882610,882674..883378,
FT                   883493..883549))
FT                   /locus_tag="ANIA_06218"
FT                   /old_locus_tag="AN6218.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006784"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006784"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006784"
FT                   /db_xref="GOA:Q5AZR2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZR2"
FT                   /protein_id="CBF69936.1"
FT                   /translation="MVYAGRSRGCHLCRKRKIKCDEALPECGNCRVYGRPCPGYRLESI
FT                   FRNETSKVEQLVKKSAGCLVPSDSGIQRARRLRRDARASPSLTNYQIADSTWEERARCY
FT                   FFDQYTSGDDSDEAMSYLSFLPSLYSACRENRPESATAASMCLCLAVDATALMTLSNHV
FT                   NAPPLILHAREYYGRALRELQQALTTKTQAVKDETFATMVLLALFEDITGERNGLASSH
FT                   AAGFELLMKLRGEGQLGNPRGRDLFHFAYTHTHVEMLALRGKPHYNTDWIVERLNGADP
FT                   IARLILIASKMSQLFLATSSLQASASTSASASEPTIASSSANTNTNADDISRLTLLLLT
FT                   GRQIDLELTSWSQDLPERWLPIVVYPDKSPSRSSTSTVAYEPLITYHHLSIASVWTYYR
FT                   TVRIVSHLIMLELRRTLAAATGTDASVEDTPAAARTTPAIIQKQITDICRSIPFCLGDV
FT                   DVNGNRTTSPSAGSASAPDGISKPQPRARAFSVYSMIWPLWYILSCGLATPAQEDQIRT
FT                   CLARIGSVLGIKLALVLAEDAESQRRPPISLEGVMFPGPESEPGR"
FT   gene            complement(884029..886261)
FT                   /locus_tag="ANIA_06217"
FT                   /old_locus_tag="AN6217.4"
FT                   /product="F-box and WD repeat-containing protein
FT                   (AFU_orthologue; AFUA_2G12060)"
FT   mRNA            complement(join(884029..884475,884523..885860,
FT                   885923..886261))
FT                   /locus_tag="ANIA_06217"
FT                   /old_locus_tag="AN6217.4"
FT                   /note="transcript_id=CADANIAT00006785"
FT   CDS_pept        complement(join(884296..884475,884523..885860,
FT                   885923..886261))
FT                   /locus_tag="ANIA_06217"
FT                   /old_locus_tag="AN6217.4"
FT                   /product="F-box and WD repeat-containing protein
FT                   (AFU_orthologue; AFUA_2G12060)"
FT                   /note="transcript_id=CADANIAT00006785"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006785"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006785"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZR3"
FT                   /protein_id="CBF69938.1"
FT                   /translation="MGSHSKAIPPSDKPCTSIPPNLLPSAPASPPTPAPSPTPHQRLPS
FT                   WRAPEQEEDALLLNTKFFESLSGPRRQQYLEAILSLCSSQQLSFVSSYVAPRLRKDPFR
FT                   VFPTEISLRVLSFVEDPKTLARASQVSKRWHALLEDDITWKNLCEKHAFTHRRPAEDNQ
FT                   DIIESIHNHRTNSLSGLQRRPNSATIQSRDGFADIPRSLSGDWIASSSIQTRKRRVRPL
FT                   SYKYHFKQKYMIESAWSKGGRCTQRHISPDQGVVTSLHLTPKYIVASLDNAKIHVYDTN
FT                   GENQKTLEGHVMGVWAMVPWDNILVSGGCDREVRVWNMATGESIYLLRGHTSTVRCLKM
FT                   SDKNTAISGSRDTTLRIWDLRTGTCRSVLVGHQASVRCLAVHGDIVVSGSYDTTARVWS
FT                   ISEGRFLRALSGHFSQIYAIAFDGRRIATGSLDTSVRIWDPNTGQCHAILQGHTSLVGQ
FT                   LQMSGDTLVTGGSDGSVRVWSLTRMAPIHRLAAHDNSVTSLQFDNNRIVSGGSDGRVKV
FT                   WCLRTGQLLRELSTPSDTVWRVTFEEEKAVIMSSRSGRTVMEVWSFSPPPEDTEFDAAT
FT                   IGASSSISEPPPVRDSHPIRPLVLPDLPQRSDGDQVMVDVPP"
FT   gene            complement(887452..888876)
FT                   /locus_tag="ANIA_06216"
FT                   /old_locus_tag="AN6216.4"
FT                   /product="ZIP metal ion transporter, putative
FT                   (AFU_orthologue; AFUA_2G12050)"
FT   mRNA            complement(join(887452..887626,887681..888616,
FT                   888691..888876))
FT                   /locus_tag="ANIA_06216"
FT                   /old_locus_tag="AN6216.4"
FT                   /note="transcript_id=CADANIAT00006786"
FT   CDS_pept        complement(join(887452..887626,887681..888616,
FT                   888691..888740))
FT                   /locus_tag="ANIA_06216"
FT                   /old_locus_tag="AN6216.4"
FT                   /product="ZIP metal ion transporter, putative
FT                   (AFU_orthologue; AFUA_2G12050)"
FT                   /note="transcript_id=CADANIAT00006786"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006786"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006786"
FT                   /db_xref="GOA:Q5AZR4"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZR4"
FT                   /protein_id="CBF69940.1"
FT                   /translation="MEGLFTLLTLSTVMAITSFVVGSLPLAFKLSPSQLRLISSLGMGV
FT                   LVGTSLIVIIPEGVETLYDAMTVGHKGLSSRSVPLQFLHERSVIPTITTFPIGNDEAER
FT                   WEGFSKISTTDTPIIHLARDSHTEKAKDTSSAESEHDHNGESSPHAWVGIALISGFILM
FT                   YLIDKIPEFASPAKPQRPPHHISLDNLGSGLRRNSSPSRDGGLLAAAHSQRSSHSFATT
FT                   TGLVIHAAADGIALGASTSDTGLSFIIFLAIMVHKAPASFGLTSVLLRQGLSSRAARTH
FT                   LFVFSLAAPVGALATFLFVHLLGSGTTDEASARWRTGVLLLFSAGTFLYVAMHTMQENS
FT                   STPSRDLPVNGYDAREVAKPEKSTRDLIASVIGMILPLFLQIGHAH"
FT   gene            complement(889348..890307)
FT                   /locus_tag="ANIA_06215"
FT                   /old_locus_tag="AN6215.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(889348..890307)
FT                   /locus_tag="ANIA_06215"
FT                   /old_locus_tag="AN6215.4"
FT                   /note="transcript_id=CADANIAT00006787"
FT   CDS_pept        complement(889348..890307)
FT                   /locus_tag="ANIA_06215"
FT                   /old_locus_tag="AN6215.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006787"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006787"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006787"
FT                   /db_xref="GOA:Q5AZR5"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZR5"
FT                   /protein_id="CBF69942.1"
FT                   /translation="MSNTANHRITLIGLGTIGMSMAALHLSRDNTIVDVFDTRPDLEEA
FT                   LLKTLPIFLVSSSSRTESQPIEVTSLISSGRLNIHSSLETACASATIVQEQGPENLEFK
FT                   QTIWKKVEAIAPVSAHFWTSTSGISASAQQQLLHDKTRLLVVHPFNPPHIMPLIEIVPS
FT                   PETAQERVEFAREYFSIPGSRHRPVVIQKEIPGFVGNRLAFALLREACHLVQEDVVTAK
FT                   DLDTILMASLGPRWAGNGIFESYQQGGGVGGIRAFWDKLGGTMQEVWDGLGQVSVAEVK
FT                   EKVVRQTDEVYGTLTSEETRREKEERLREFLKVQTQSY"
FT   gene            890733..892535
FT                   /locus_tag="ANIA_06214"
FT                   /old_locus_tag="AN6214.4"
FT                   /product="Histone acetyltransferase type B catalytic
FT                   subunit (EC 2.3.1.48)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZR6]"
FT   mRNA            join(890733..890816,890878..891153,891222..891483,
FT                   891522..892535)
FT                   /locus_tag="ANIA_06214"
FT                   /old_locus_tag="AN6214.4"
FT                   /note="transcript_id=CADANIAT00006788"
FT   CDS_pept        join(890798..890816,890878..891153,891222..891483,
FT                   891522..892455)
FT                   /locus_tag="ANIA_06214"
FT                   /old_locus_tag="AN6214.4"
FT                   /product="Histone acetyltransferase type B catalytic
FT                   subunit (EC 2.3.1.48)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZR6]"
FT                   /note="transcript_id=CADANIAT00006788"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006788"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006788"
FT                   /db_xref="GOA:Q5AZR6"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017380"
FT                   /db_xref="InterPro:IPR019467"
FT                   /db_xref="InterPro:IPR037113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZR6"
FT                   /protein_id="CBF69944.1"
FT                   /translation="MSAEGEWSCDANDAVQITIVHPDQQKPKTLSSFHPQFTYPIFGEE
FT                   ERIFGYKGLIIRLRFAAHNLRPHVHVSYDEKFTAVDDAEPVDIIGALKEFLPEEAFSSL
FT                   PEFESAVQEEDAKEFVPPGKLSHSYSIRGRNYEIWAASLADPQVQLLLNRFQIMVSFYI
FT                   EAGTPLSTDDPEWTLDRWTVYFVLTAARYEKVEPPTPTASSYSIVGYATTYRWWFYKRD
FT                   RSENPMPRDGPFPPPELVRPGELPSRLRIAQFLILPPHQGTGHGVNLYNTIHKTCLDDP
FT                   TIMELTVEDPNESFDVLRDSADYHILRPEFLKHNIQINPDPWSDFSKKTKRVPTSSLLP
FT                   LKTLNEIRTAYKIEPTQFAHIQEMFLLGQIPLKNRRKGGANMARLLVKKYRDDDPNNRR
FT                   YYWWRMLTKQRLYKRSRDVLIQLKMSERHKALEDTVTNVEDGYEQLFGFFNEREERLRA
FT                   QQEEAETSNNRDQRTKRKFTVEDEDDEDESAAAKRPKA"
FT   gene            892806..893714
FT                   /locus_tag="ANIA_10781"
FT                   /old_locus_tag="AN10781.4"
FT                   /product="U6 snRNA-associated Sm-like protein LSM4,
FT                   putative (AFU_orthologue; AFUA_2G12020)"
FT   mRNA            join(892806..892956,893023..893214,893271..893714)
FT                   /locus_tag="ANIA_10781"
FT                   /old_locus_tag="AN10781.4"
FT                   /note="transcript_id=CADANIAT00006789"
FT   CDS_pept        join(892954..892956,893023..893214,893271..893435)
FT                   /locus_tag="ANIA_10781"
FT                   /old_locus_tag="AN10781.4"
FT                   /product="U6 snRNA-associated Sm-like protein LSM4,
FT                   putative (AFU_orthologue; AFUA_2G12020)"
FT                   /note="transcript_id=CADANIAT00006789"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006789"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006789"
FT                   /db_xref="GOA:C8V1T8"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027141"
FT                   /db_xref="InterPro:IPR034101"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1T8"
FT                   /protein_id="CBF69945.1"
FT                   /translation="MLPLGLLTAAQGHPMLVELKNGETLNGHLANCDNWMNLILREVVQ
FT                   TSPEGDRFFKLPEVYVRGNNIKYLRIPEEIIDMVKEQQQNQSQNRNRGPRDGGRGDRGG
FT                   RGGRGRGRGRGRGGN"
FT   gene            894154..895816
FT                   /locus_tag="ANIA_10784"
FT                   /old_locus_tag="AN10784.4"
FT                   /product="pentatricopeptide repeat protein (AFU_orthologue;
FT                   AFUA_2G12010)"
FT   mRNA            join(894154..894417,894473..895816)
FT                   /locus_tag="ANIA_10784"
FT                   /old_locus_tag="AN10784.4"
FT                   /note="transcript_id=CADANIAT00006790"
FT   CDS_pept        join(894154..894417,894473..895816)
FT                   /locus_tag="ANIA_10784"
FT                   /old_locus_tag="AN10784.4"
FT                   /product="pentatricopeptide repeat protein (AFU_orthologue;
FT                   AFUA_2G12010)"
FT                   /note="transcript_id=CADANIAT00006790"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006790"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006790"
FT                   /db_xref="GOA:C8V1T9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR033495"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1T9"
FT                   /protein_id="CBF69947.1"
FT                   /translation="MKALPTNELEDLLTRRSNTRVRLANAMQPLYVLLRDRRIRPNTRH
FT                   YKAVIQSNSDPEHGSSKTVRKLLVEMEKYNIPVDAGPLRAALLALAVHPDYLLRQDVLR
FT                   ALRDRWVTLSEDDWHYVVAGLIREQQFELALDHIAHMERKRIVVKDWLHSLLIYNLCDF
FT                   NEFDLVRELMVVRLNQGHVMSRELRTYVLDSASKAHHYDLTSFIWRRIVELKNAAPPRG
FT                   ICEQVLEVAARHGDTQLKNAVVNMLEHNELELGYKDFLSLVRGHLAAGDLYSALEICTG
FT                   TARGARMRCFKSIRVHCRENNIHPRDIWNTIKALKASGKVIQLEYAALVIELCEKAAAR
FT                   DPFVVDDGVNIYKGIYALCGRNPTLPMFNSLLAMCRAGNNVQSAVFFVKEMAKLGLVPN
FT                   GETFEHLLFLCLKTGNFKSAYLYLDDLYKRGFKVRIRLRNEMLRLCAESDDEYAAKLLE
FT                   HKEHPQLGKTAAQRERYKRQRAKYKERRKEKRKATSIAKAGEEEGWEDYEPSLSTPEDL
FT                   VAKTEKVKTAVEQKPTET"
FT   gene            896653..897132
FT                   /locus_tag="ANIA_10790"
FT                   /old_locus_tag="AN10790.4"
FT                   /product="hypothetical protein"
FT   mRNA            896653..897132
FT                   /locus_tag="ANIA_10790"
FT                   /old_locus_tag="AN10790.4"
FT                   /note="transcript_id=CADANIAT00006791"
FT   CDS_pept        896653..897132
FT                   /locus_tag="ANIA_10790"
FT                   /old_locus_tag="AN10790.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006791"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006791"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006791"
FT                   /db_xref="GOA:C8V1U0"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1U0"
FT                   /protein_id="CBF69949.1"
FT                   /translation="MHLSLSSTFATVALSVLSLTSTSAASLNLPKTAYRMPARTADPSN
FT                   PALTWHVSQFDLGCSPGGCVYSFNILGHASENTPGFNTSCNGTSTQDDYAPCKDEGILA
FT                   QIEPATYPNWTVSVQHQWREAMFEEYYAFGEKNVSVAGNSTRTFTIPVTSVYGVA"
FT   gene            897359..899409
FT                   /locus_tag="ANIA_10780"
FT                   /old_locus_tag="AN10780.4"
FT                   /product="phosphoinositide phosphatase Pten/Tep1, putative
FT                   (AFU_orthologue; AFUA_2G11990)"
FT   mRNA            join(897359..897607,897733..897881,897960..898391,
FT                   898428..899409)
FT                   /locus_tag="ANIA_10780"
FT                   /old_locus_tag="AN10780.4"
FT                   /note="transcript_id=CADANIAT00006792"
FT   CDS_pept        join(897359..897607,897733..897881,897960..898391,
FT                   898428..899409)
FT                   /locus_tag="ANIA_10780"
FT                   /old_locus_tag="AN10780.4"
FT                   /product="phosphoinositide phosphatase Pten/Tep1, putative
FT                   (AFU_orthologue; AFUA_2G11990)"
FT                   /note="transcript_id=CADANIAT00006792"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006792"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006792"
FT                   /db_xref="GOA:C8V1U1"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR029023"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1U1"
FT                   /protein_id="CBF69951.1"
FT                   /translation="MSHISCLSYTLLQTMHQYNLFAWDEPICTPYIVTIQCAPNDISVL
FT                   APVDHREGRAERVFRGKHVQIVILCTDSPRPNPLILLPASILRQLVAGPRLQHPETGLD
FT                   LCYVADNSEPSPISTLSNAARYLPGRFILTPLKQLVNFLDSKHGADWCIWEFRAEGTGY
FT                   PDSEVYGRIHHFPFPDHHPPPFALIPKVMASMRNWLQRLDGSGADGQENQRKGQRVAVV
FT                   HCKAGKGRSGTMACSYLISQEGWKMEDALQRFTERRMRVGFGSGVSIPSQLRWVRYVER
FT                   PVEILEIHVWGLRDGVKVVVEGFVEEGQKIKQFHLFRKDERTVMSDSTLQSQSSQRSSN
FT                   TTSEDDEDNKVSSNNDNNSKINPKQKLNATKLSGTSNQVQEQQPISATESDSSLLSTTT
FT                   PASNSASTTPTTTTTSQPPQKHTHAVFLRPSSPLILPSPDINIDFERRSKAASYTGLAM
FT                   VTSIAHVWFNPYFEGGDKYDSGVFEIDWDAMDGIKGTSRKGIKALDRLKVVWRYADDDT
FT                   TEVQNTHAQKRPVSRGVITEPKPGEPIPETRVKDWRLKDSHHGGGDETAEDKVDVDSSS
FT                   SNDEGSVGTASEKEKENVPMAGGKSGG"
FT   gene            complement(899588..902312)
FT                   /locus_tag="ANIA_06211"
FT                   /old_locus_tag="AN6211.4"
FT                   /product="Phospholipase A2
FT                   [Source:UniProtKB/TrEMBL;Acc:Q76H92]"
FT   mRNA            complement(899588..902312)
FT                   /locus_tag="ANIA_06211"
FT                   /old_locus_tag="AN6211.4"
FT                   /note="transcript_id=CADANIAT00006793"
FT   CDS_pept        complement(899785..902298)
FT                   /locus_tag="ANIA_06211"
FT                   /old_locus_tag="AN6211.4"
FT                   /product="Phospholipase A2
FT                   [Source:UniProtKB/TrEMBL;Acc:Q76H92]"
FT                   /note="transcript_id=CADANIAT00006793"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006793"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006793"
FT                   /db_xref="GOA:Q5AZR9"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZR9"
FT                   /protein_id="CBF69953.1"
FT                   /translation="MGAARAFCIRFAPPAALIYVGGRVLWSIEAARNNSQLFLLHSDPK
FT                   AAYSTTSTQCARGQVHHSVGEGRPGRSNTDRVEGSFHSSEPDSSIWSSMMQRFEGVKQS
FT                   VGSPEWIELDQLKNYIIPDWTKFLPETVQKLQRELSMAPGSLADEIWREAHDPDLHPEI
FT                   LREATVRVGNSLCDDELEFRRKRKKHAVKALSAYLNIPEEDIHPDDVPIISMCGSGGGL
FT                   RALVAGTGSYLATQEAGLWDCVTYTAGVSGSCWLQVLYHSSITGCNFTRLVAHLKNRLG
FT                   VHMAFPPAALKLLTHAPTNKYLLSGLVQKLKGDPGADFGLVDIYGMLLAARLLVPKGEL
FT                   GASDFDLKLSNQARNIASGAHPLPIYTAVRHEIPILEEKAEKNEKPMPEDLIKESQSES
FT                   WFQWFEFTPYEFFCEELNAGIPTWALGRHFNGGKNEVPAGTAPIPELHVGSLMGVWGSA
FT                   FCATLSHYYKEIRPLLRGIAGFGGIDSLIQGKSKDLIRVHPIDPATIPNYVLGMKDQLP
FT                   PSCPESIFQSQHLRLMDAGMSNNLPIYPLLRPGRDVDIIIAFDNSADIKQENWLSVVDG
FT                   YARQRGIKGWPIGAGWPRAADTLKETEQSLREPENISEEALNRRVSEAQQSSTHEHAHS
FT                   SSVTTKQTTTNPDFQPSPADTDLDYCNVWVGTMQERLSDKEPPPSKRLFDPRQSSSDPD
FT                   HRESDFHLMRPDAGIAVVYFPLLPNSSAPDLPSSTSLTKPSPSDQHSGSENNSSAQDTI
FT                   DTTKPLSPHPGTINPNVDDFLSTWNFVYTPEQIDAVVGLAKANFAQGEQQVKRVVRAVY
FT                   ERKKKDRLQREERMHGPHKTGLVLS"
FT   gene            902874..904886
FT                   /locus_tag="ANIA_06210"
FT                   /old_locus_tag="AN6210.4"
FT                   /product="Exocyst complex protein exo70
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZS0]"
FT   mRNA            join(902874..903157,903219..903436,903493..904886)
FT                   /locus_tag="ANIA_06210"
FT                   /old_locus_tag="AN6210.4"
FT                   /note="transcript_id=CADANIAT00006794"
FT   CDS_pept        join(902874..903157,903219..903436,903493..904886)
FT                   /locus_tag="ANIA_06210"
FT                   /old_locus_tag="AN6210.4"
FT                   /product="Exocyst complex protein exo70
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZS0]"
FT                   /note="transcript_id=CADANIAT00006794"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006794"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006794"
FT                   /db_xref="GOA:Q5AZS0"
FT                   /db_xref="InterPro:IPR004140"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZS0"
FT                   /protein_id="CBF69955.1"
FT                   /translation="MVAPRDTAFAEESAEVEVLYANLEKLKRLTKKIQGSLVRLETGGN
FT                   VVKHAIGPIYSNTQSLQITNNNIDRVIEAIERLRQPLDAKNREEGVIRAGPQPNNLPQY
FT                   LAAMRGVNDALMDLTSTNLKSNQKAISEFTSLLGIGNSKLQDLLRLKLGEHVSPIEPLH
FT                   YLTKDLPFPTIPEDRIAEIAPICAAINSAAVHVPHRGEGGSPALKIYADVRGPYISTSA
FT                   QNLAIASLNTLKRRVDDESPYKQGTNGIGTYSDALENFIYAEWEAIKRIFTGDHRGLAL
FT                   QMTCRSAIAEYSKTIRELNDYIRTNLLTDCFLAFEIIDIVTAKSYDIELKTGELKSLFL
FT                   EALRPVRETAKYSLAELLEETKRRAQAIPMLPPNGAPTPLVDKVMRSLIELTGYQKPLA
FT                   SILTSLGDGNWRSTSASSMNTPLDVNPDSDVLFSHFILDVIETLLIALEARARQLHRTK
FT                   AAQGVFLSNVFCLVDRAIRSSPELARFLGSPDSVSRIDTFRKRATSTYLDAWKETSHYL
FT                   LDVQYTSHTRGGSRPQSGGAVDSSAIVKSLSSRDKDAIKDKFKAFNASFDDLVARHKSF
FT                   YMEREVRSVLAREVQAVLEPLYARFYDRYHELDKGRGKYTKYDKGSLSAQLASLQ"
FT   gene            905729..907879
FT                   /locus_tag="ANIA_06209"
FT                   /old_locus_tag="AN6209.4"
FT                   /product="adenylosuccinate lyase (Eurofung)"
FT   mRNA            join(905729..905840,905912..905998,906061..906788,
FT                   906841..906957,906996..907086,907142..907220,
FT                   907278..907284,907342..907399,907450..907879)
FT                   /locus_tag="ANIA_06209"
FT                   /old_locus_tag="AN6209.4"
FT                   /note="transcript_id=CADANIAT00006795"
FT   CDS_pept        join(905789..905840,905912..905998,906061..906788,
FT                   906841..906957,906996..907086,907142..907220,
FT                   907278..907284,907342..907399,907450..907700)
FT                   /locus_tag="ANIA_06209"
FT                   /old_locus_tag="AN6209.4"
FT                   /product="adenylosuccinate lyase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006795"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006795"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006795"
FT                   /db_xref="GOA:Q5AZS1"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZS1"
FT                   /protein_id="CBF69957.1"
FT                   /translation="MSSSNDVYQTPLNSRYASDEMKYLFSPRNRFSTWRQLWLWLAEAE
FT                   KELGLPITDEAIEQMRKHTTINDEEFKVAAEEEKRRRHDVMAHVHAYGQVAPAAAGIIH
FT                   WGATSCYCTDNADLIFLRDGLNILIPKLAVVIDKLSAFAKQYKDLPCLGFTHGQPAQLV
FT                   TVGKRACLWIQDLLMDLRNLERARDDLRFRGVKGTTGTQASFLQIFNGDHDKVEQLDEL
FT                   VTKKAGFDSAFIISSQTYSRKIDVDVANALGSFGSTCERIGIDIRHLAMLKEVEEPFEK
FT                   DQIGSSAMAYKRNPMRSERLCSLGRHLQNLPKDALDTYSAQWFERSLLLMADKDDSAIR
FT                   RISIPELYLCADACLILLNNVTSGFVVYPEVIKRRVNDELPFMATENVIMACVKKGLSR
FT                   QDAHEEIRVLSHQASDNVKKHGKNNDLLDRIRRTEFFAPILGELDALLDPSTFVGRAPQ
FT                   QVEKFTSTEVKKALQPYETYLATAETSALHV"
FT   gene            complement(908221..910201)
FT                   /locus_tag="ANIA_06208"
FT                   /old_locus_tag="AN6208.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(908221..908455,908544..908980,
FT                   909033..909335,909388..909557,909630..910201))
FT                   /locus_tag="ANIA_06208"
FT                   /old_locus_tag="AN6208.4"
FT                   /note="transcript_id=CADANIAT00006796"
FT   CDS_pept        complement(join(908429..908455,908544..908980,
FT                   909033..909335,909388..909557,909630..909931))
FT                   /locus_tag="ANIA_06208"
FT                   /old_locus_tag="AN6208.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006796"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006796"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006796"
FT                   /db_xref="GOA:C8V1U5"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1U5"
FT                   /protein_id="CBF69959.1"
FT                   /translation="MSRRRASNSESLASSSVNEAVAYPFSGMQQNHTFSQRRGPIEGPG
FT                   GRRLVRRVTWRSSTYKLMASLWVLGVLYIVWLIRDIFYLPFSYSPKPAVTTNFGDDLLA
FT                   QFVGREECGISSQALYLPPSGDQSELYCRSREDLLSSMSNGGRHGFGAPYTSQGCFYRW
FT                   FTNAEICETLSRFDGVLFVGDDSLANAYAGFNILLRQDLKQGSLREWEMSTALQTSCGC
FT                   ESQFTNPACSSARITSSEELYSRSAMGTQTPYICSAKTPHKFLSITGSPATSSDHNVFK
FT                   NLLARPSESESAKKKPIAIIQSLSLSTSYSLSAAKNSIDEWLTLAKTSARSTPFLWIGP
FT                   TAPGHQKPPSDNVHATSWKYTQDTAQVAQAKGIDVLAMYNATLQAQSWDGMHYGEEVAL
FT                   MQAMMIVNWLASL"
FT   gene            complement(912016..912186)
FT                   /locus_tag="ANIA_11503"
FT                   /old_locus_tag="AN11503.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(912016..912085,912143..912186))
FT                   /locus_tag="ANIA_11503"
FT                   /old_locus_tag="AN11503.4"
FT                   /note="transcript_id=CADANIAT00006797"
FT   CDS_pept        complement(join(912016..912085,912143..912186))
FT                   /locus_tag="ANIA_11503"
FT                   /old_locus_tag="AN11503.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006797"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006797"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006797"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1U6"
FT                   /protein_id="CBF69961.1"
FT                   /translation="MVQLFAGQASTPEFIQSGDVRTLDHETRRGTEFARAL"
FT   gene            912943..914439
FT                   /locus_tag="ANIA_06207"
FT                   /old_locus_tag="AN6207.4"
FT                   /product="pyruvate dehydrogenase kinase (AFU_orthologue;
FT                   AFUA_2G11900)"
FT   mRNA            join(912943..913054,913140..913288,913432..914324,
FT                   914376..914439)
FT                   /locus_tag="ANIA_06207"
FT                   /old_locus_tag="AN6207.4"
FT                   /note="transcript_id=CADANIAT00006798"
FT   CDS_pept        join(912943..913054,913140..913288,913432..914324,
FT                   914376..914439)
FT                   /locus_tag="ANIA_06207"
FT                   /old_locus_tag="AN6207.4"
FT                   /product="pyruvate dehydrogenase kinase (AFU_orthologue;
FT                   AFUA_2G11900)"
FT                   /note="transcript_id=CADANIAT00006798"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006798"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006798"
FT                   /db_xref="GOA:Q5AZS3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR018955"
FT                   /db_xref="InterPro:IPR036784"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZS3"
FT                   /protein_id="CBF69963.1"
FT                   /translation="MWKPSERLMDTIRHYASFPATGVSLRQMVQFGDRPSTGTLFRASQ
FT                   FLSEELPIRLAHRVQDLGELPDGLSEMPSIKKVQDWYAQSFEILAETTQNPSVREGQYR
FT                   SAMTNGNGNGKAAAAARRYFVPSDDQGNWPPELNDYNERFAKTLQQIKRRHDSVVTTVA
FT                   QGILEWKRKRQRLQIDSTIQSFLDRFYMSRIGIRMLIGQHIALTEQTHVRHPNYVGIIC
FT                   TKTNVREVALEAIENARFVCEDYYGLFEAPKVQLVCKEDLNFMYVPGHLSHMLFETLKN
FT                   SLRAVVERHGADKEAFPVTKVIIAEGKEDITIKVSDEGGGIPRSAIPLVWTYMYTTVEQ
FT                   TPNLDPDFDKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYGTDVYLHLNRLSS
FT                   SSEPLQ"
FT   gene            complement(915252..916259)
FT                   /locus_tag="ANIA_06206"
FT                   /old_locus_tag="AN6206.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(915252..915674,915739..915959,
FT                   916008..916034,916238..916259))
FT                   /locus_tag="ANIA_06206"
FT                   /old_locus_tag="AN6206.4"
FT                   /note="transcript_id=CADANIAT00006799"
FT   CDS_pept        complement(join(915252..915674,915739..915959,
FT                   916008..916034,916238..916259))
FT                   /locus_tag="ANIA_06206"
FT                   /old_locus_tag="AN6206.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006799"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006799"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006799"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZS4"
FT                   /protein_id="CBF69965.1"
FT                   /translation="MVRLTGGICDPEIQSSRRQHIPGPGASSSSTPRPSPLTPASAASA
FT                   STSAYAVPSAQEKRMRSRLREERHAALCVLMDRELLTIQALAAQETLPQARRRFLSTLL
FT                   SPSDPTTAASIRADQFTIQRPTSSTPSSPFSTEPMVVSRSIVDVCETDDSGWYKPEPDL
FT                   ASESAMAASSPSAASSPMSGLKMKGRATPERSRAGRRVSSGRQQQTRERRRRWSGAERQ
FT                   DYGAGLSF"
FT   gene            916618..918878
FT                   /locus_tag="ANIA_06205"
FT                   /old_locus_tag="AN6205.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(916618..916675,916733..916854,916886..917940,
FT                   918025..918123,918248..918878)
FT                   /locus_tag="ANIA_06205"
FT                   /old_locus_tag="AN6205.4"
FT                   /note="transcript_id=CADANIAT00006800"
FT   CDS_pept        join(916618..916675,916733..916854,916886..917940,
FT                   918025..918123,918248..918878)
FT                   /locus_tag="ANIA_06205"
FT                   /old_locus_tag="AN6205.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006800"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006800"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006800"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZS5"
FT                   /protein_id="CBF69967.1"
FT                   /translation="MSNKRAKRPVRVANCSGYHGDPAYEMYRQATLGDVDFITGDYLAG
FT                   MWIMDDSSISSSLTRAWRAGKHPGYEETAWKGIQQTIDVIAEKGIKVVINGGALDPKAL
FT                   ALKVQGLVRERNLNLRVAYLSGDDVYDRVGPNMPTTKEELQHLDSGNSSAAPAALTYAF
FT                   LRGTADGKPIPMVSAHAYLGARGIVHGLRNGADIILCGRVADASPVIAAAWFWHDWAET
FT                   DYDELAGALIAGHLIECSAYVTGGNFSGFDRYNLDDLIEPGFPIAEIDADGACIITKHP
FT                   GTKGMVTVDTVRCQFLYELQGTVYLNSDVNAYIGDVAVEEVEKDRHDLLLSFQDLTKLI
FT                   MVHSIRVSGIKGTAPPPTTKLAIFYQGGYEAEILLNATGYATSKKWDLLEKQIRYFLPD
FT                   SVQKELETLEFQRIGTPSSNPISQASSTTYLRIFIASRSPHAHLTLTLDMRTAVPRPFL
FT                   AYYPALIAQADLGERINLLNDDNTITSIETGHPPAYAPLQPRENYHPPSISPESPEYKT
FT                   IFDGLTKRVKLGDVVLARSGDKGGNLNVGFFVPSSPPSPFTLETDKQRKQRERQKHLSL
FT                   WLRHYLTTSRMRDLLGTDWRDDYFIERVEFPAIGAVHFVIYGILGRGVSSSSRLDGLGK
FT                   GVADWLRDVVVEVPVALLE"
FT   gene            complement(918959..921570)
FT                   /locus_tag="ANIA_10789"
FT                   /old_locus_tag="AN10789.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(918959..919984,920038..920263,
FT                   920313..920941,920986..921066,921118..921570))
FT                   /locus_tag="ANIA_10789"
FT                   /old_locus_tag="AN10789.4"
FT                   /note="transcript_id=CADANIAT00006801"
FT   CDS_pept        complement(join(918959..919984,920038..920263,
FT                   920313..920941,920986..921066,921118..921570))
FT                   /locus_tag="ANIA_10789"
FT                   /old_locus_tag="AN10789.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006801"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006801"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006801"
FT                   /db_xref="GOA:C8V1V0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8V1V0"
FT                   /protein_id="CBF69969.1"
FT                   /translation="MSSLPRKENARSRRAARACTRCHSRKVRCDGSITGFPCTNCRLDA
FT                   RPCILHSGKRDKERQLFKAVAKERSNGYPTPAPDRVSLTFFKSQMTLKVPIQEILDVFV
FT                   KHYFIYVHPFLPVVDEAVFWAKYRGLDSSAGKISTLLFQTMLFAASPFIPIEAAKECGY
FT                   DSLISARDDLYRRAKRLYESGIEKDRLVIAQACLLLTWYTTDAERSTNSRWLRIAIRYA
FT                   KKEQAHLYHKMPQLGSKRKVSDLKRLWWCCMIRDRIISLGMRRPIQITPDEFDLQLQEG
FT                   LSLRDLEEECLNSEVYTSEIKIALCGVLASLCHLVAAVTDVIMLVYPTTQNMPFSLADR
FT                   RAQLNRLEETKFALLDWELNWVANPDGKEYYIHPSLTLHTNLCAIYFQSARIALCNRIC
FT                   LLIGHNAYLTDETDLSRIESCRADLASAICSTAHNVKQLILNGVADKLPISAYALPSSS
FT                   HCSLGILLSIQTQLSPTPEDKELHELMLVFFTEVFRFFRSQYYTRLILAVSWKALELCQ
FT                   PRTQTQTQTLLQHQPSSDTSDISIGTTVVSSENGTSGNSDSNELILHGQRQLIPENALF
FT                   YYPDLFQLKLTDYIRLLQYVDEFMSLRSMPGENAIYQAPSPALAPAPAIETHVQLQRQQ
FT                   AHAHARTYSHSSICSISSTRPAVTSTTGATAVNSPGCSSTIYSVDGVAVDPTSPKWTED
FT                   YFWVYFGEKELEGEPLQTAFTPNAGSPSNSSSVVSEIGGDSVSGNKNENGKSPQSHASV
FT                   PPRDSGTPGTPKQEWMETQGTCRELAVVPAPADPASTAVQNMLDCLPLLGE"
FT   gene            complement(922707..924952)
FT                   /locus_tag="ANIA_10779"
FT                   /old_locus_tag="AN10779.4"
FT                   /product="putative 1,6-beta-glucan synthetase (Eurofung)"
FT   mRNA            complement(join(922707..922758,922822..923299,
FT                   923362..923884,923931..924032,924082..924146,
FT                   924222..924259,924312..924952))
FT                   /locus_tag="ANIA_10779"
FT                   /old_locus_tag="AN10779.4"
FT                   /note="transcript_id=CADANIAT00006802"
FT   CDS_pept        complement(join(922707..922758,922822..923299,
FT                   923362..923884,923931..924032,924082..924146,
FT                   924222..924259,924312..924952))
FT                   /locus_tag="ANIA_10779"
FT                   /old_locus_tag="AN10779.4"
FT                   /product="putative 1,6-beta-glucan synthetase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006802"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006802"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006802"
FT                   /db_xref="GOA:C8V200"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR005629"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C8V200"
FT                   /protein_id="CBF69971.1"
FT                   /translation="MSEYSPEIPHRETPHIRLNSEQHDVFSDEDVTSRPLVPEHGVVGL
FT                   GVSGRPLTPRADSSQSTGTLPTVYSSLNAHGSTEFLIPPQPQTYRQRSGDDITSPNLSD
FT                   RSYRRASWSSVGSYSTRRGFAYSTRSRSRAESEGDDVNTQTVTEKYNIMPTDGLLLFPE
FT                   DVEKDDYLHNPDPSDREGECDVWNKRGMINVGGLVLLTIGFLVLFIGYPVVTAMKGFEK
FT                   TQSGYPDTPESAYSKMSADGKEWKLVFSDEFNTPGRTFFDGDDPYYQAVDIWYGVTQDL
FT                   EWYDPDAVTTRDGVLEIRFDTFPNHDLEYRSGMLQSWNKLCFSGGRLEASISLPGNGEV
FT                   SGFWPGFWAMGNLGRPGYAATTEGMWPYSYYDECDAGITPNQSSTDGISWLPGMRLPAC
FT                   TCPGSDHPSPGRSRSAPEIDVIEASVSPLNGDADKMVGSVSQSLQMAPFDIWYMPDYDF
FT                   TAVYDPSITQINTYRGGPYQQAMSGVTNLNNDWYNGKAYQIYAFEYTPGIQGNVSWFVG
FT                   ADKTWTLDGRAIGPNGNVGQRVIPLEPLSIIMNLGMAWNFAPIDDDIQKYTPAYLRFDY
FT                   IRIYQDPDAISVTCDPEGWETTEYIEKHPKAYMDANKTHWADAGYEWPTNTLMHKC"
FT   gene            complement(926092..926805)
FT                   /locus_tag="ANIA_06203"
FT                   /old_locus_tag="AN6203.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(926092..926366,926461..926805))
FT                   /locus_tag="ANIA_06203"
FT                   /old_locus_tag="AN6203.4"
FT                   /note="transcript_id=CADANIAT00006803"
FT   CDS_pept        complement(join(926092..926366,926461..926701))
FT                   /locus_tag="ANIA_06203"
FT                   /old_locus_tag="AN6203.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006803"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006803"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006803"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZS7"
FT                   /protein_id="CBF69973.1"
FT                   /translation="MSSDDAYMSFLDKANADLDSGRAQQANTTQQARTETVDVNVKVPA
FT                   PLTSVDAYYISDTDEPFEPVALKWEGAQRGVWPDASSFSKLISVNTDLSDTIETLSPSS
FT                   FDPRNQYASALRAVRAAAVENSKGDESAVEVKVYRVEVGTSRVEYYITALDGEGGLLVG
FT                   LRAKAIES"
FT   gene            complement(927212..928852)
FT                   /locus_tag="ANIA_06202"
FT                   /old_locus_tag="AN6202.4"
FT                   /product="60S ribosomal protein L3
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9UV31]"
FT   mRNA            complement(join(927212..927548,927599..928272,
FT                   928328..928484,928552..928609,928691..928722,
FT                   928796..928852))
FT                   /locus_tag="ANIA_06202"
FT                   /old_locus_tag="AN6202.4"
FT                   /note="transcript_id=CADANIAT00006804"
FT   CDS_pept        complement(join(927293..927548,927599..928272,
FT                   928328..928484,928552..928609,928691..928722,
FT                   928796..928797))
FT                   /locus_tag="ANIA_06202"
FT                   /old_locus_tag="AN6202.4"
FT                   /product="60S ribosomal protein L3
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9UV31]"
FT                   /note="transcript_id=CADANIAT00006804"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006804"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006804"
FT                   /db_xref="GOA:C8V202"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="UniProtKB/TrEMBL:C8V202"
FT                   /protein_id="CBF69975.1"
FT                   /translation="MSHRKYEAPRHGSLAYLPRKRAARHRGRVKSFPKDDPKKPVHLTA
FT                   SMGYKAGMTTVVRDLDRPGAKMHKKEIVEAATVIETPPLIAVGVVGYIETPRGLRSLAT
FT                   VWAEHLSDEVKRRFYKNWYKSKKKAFTKYAKKHSEENGASITRDLERIKKYCTVVRVLA
FT                   HTQIRKTPLKQKKAHLMEIQVNGGSVAEKVDFARNLFEKPIEIDTIFEKDEMIDVIAVT
FT                   KGHGFQGVTSRWGTKKLPRKTHKGLRKVACIGAWHPSHVQWTVARAGQMGYHHRTSCNH
FT                   KVFRIGKGSDEANASTDFDVSKKQITPLGGFVRYGEVKNDFILLKGSVPGVKKRVMTLR
FT                   KTLYPQTSRRATEKVDLKWIDTSSKFGHGAFQTPEEKRAFMGTLKKDLVTSA"
FT   gene            complement(936107..936329)
FT                   /locus_tag="ANIA_11502"
FT                   /old_locus_tag="AN11502.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(936107..936131,936194..936284,
FT                   936317..936329))
FT                   /locus_tag="ANIA_11502"
FT                   /old_locus_tag="AN11502.4"
FT                   /note="transcript_id=CADANIAT00006805"
FT   CDS_pept        complement(join(936107..936131,936194..936284,
FT                   936317..936329))
FT                   /locus_tag="ANIA_11502"
FT                   /old_locus_tag="AN11502.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006805"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006805"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006805"
FT                   /db_xref="UniProtKB/TrEMBL:C8V203"
FT                   /protein_id="CBF69977.1"
FT                   /translation="MTDIQVELQPVLDPGYGSGGWSKVAKVRKVPVPVELWPILRI"
FT   gene            941365..942453
FT                   /locus_tag="ANIA_06201"
FT                   /old_locus_tag="AN6201.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(941365..941907,941977..942453)
FT                   /locus_tag="ANIA_06201"
FT                   /old_locus_tag="AN6201.4"
FT                   /note="transcript_id=CADANIAT00006806"
FT   CDS_pept        join(941365..941907,941977..942453)
FT                   /locus_tag="ANIA_06201"
FT                   /old_locus_tag="AN6201.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006806"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006806"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006806"
FT                   /db_xref="GOA:Q5AZS9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZS9"
FT                   /protein_id="CBF69979.1"
FT                   /translation="MSQSHVYSQNEPQIVTAYLSGAEGHPAAPPTAYLPAETQSSSQRH
FT                   SGADHNGIAEFPSSERASVHTATSRPYPSDSWDSSYPQSNRHSIQPSVKPVSRPDLEPT
FT                   AAPVASVSSAYLEGNPILSSYGNGAARKEDRIRGSWTDHSSYMSGDERNPNVARAQKRE
FT                   THGGDFLSDDGEDAVLMLFRMSLPIPVFSSLASIYTVFGLLFTLFTLPLRLCSCVPYLR
FT                   KTSLRTQLCDLLVPQLHIHERLIGLRPPSVYNDGEQSSVGEIGEGYSVGGLIMVLLLSS
FT                   FMSFGLLLLAWIAAFFWVFAMMLGNPDGTERKDDGRAAVLGVSRWWQIWLSKARSPSG"
FT   gene            complement(943727..947805)
FT                   /locus_tag="ANIA_06200"
FT                   /old_locus_tag="AN6200.4"
FT                   /product="pre-rRNA processing protein Rrp12, putative
FT                   (AFU_orthologue; AFUA_2G11810)"
FT   mRNA            complement(join(943727..945728,945778..947688,
FT                   947743..947805))
FT                   /locus_tag="ANIA_06200"
FT                   /old_locus_tag="AN6200.4"
FT                   /note="transcript_id=CADANIAT00006808"
FT   gene            943727..944275
FT                   /locus_tag="ANIA_10786"
FT                   /old_locus_tag="AN10786.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            943727..944275
FT                   /locus_tag="ANIA_10786"
FT                   /old_locus_tag="AN10786.4"
FT                   /note="transcript_id=CADANIAT00006807"
FT   CDS_pept        943818..944258
FT                   /locus_tag="ANIA_10786"
FT                   /old_locus_tag="AN10786.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006807"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006807"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006807"
FT                   /db_xref="GOA:C8V205"
FT                   /db_xref="UniProtKB/TrEMBL:C8V205"
FT                   /protein_id="CBF69981.1"
FT                   /translation="MTIPLNPLPPPSFSSNTNATSPAPSSARIPTLLDPTGTVGLGHSQ
FT                   TPTTRRIAASATTATTWTSPPSLRGRLSVCVGTVFIAIINIHLVVPLGLFLLRLCHLDL
FT                   SALAAADGIRSSNGLYIRVDSALAVIAVSASHIDVLGVVITA"
FT   CDS_pept        complement(join(943839..945728,945778..947688,
FT                   947743..947805))
FT                   /locus_tag="ANIA_06200"
FT                   /old_locus_tag="AN6200.4"
FT                   /product="pre-rRNA processing protein Rrp12, putative
FT                   (AFU_orthologue; AFUA_2G11810)"
FT                   /note="transcript_id=CADANIAT00006808"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006808"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006808"
FT                   /db_xref="GOA:Q5AZT0"
FT                   /db_xref="InterPro:IPR012978"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZT0"
FT                   /protein_id="CBF69983.1"
FT                   /translation="MATLAERLEKIKSPKLQNQHHTAVVLNAVEDTLRDQKADFSPTAY
FT                   FAALLALLSQSLSAAQGIVNKDLATSVVYLLDITTNYVPAPILQSKFSQILTSLAPALS
FT                   LPEVDAPLLRPSIGCLESLLIAQDAAAWNLPHTQIGPRRAIAGLLSLSVDHRPKVRKRA
FT                   QDALIKVLKTPPPTPALDHPAADMCAESALKTLGDSIAAASKQKRGRNDPHNRENHDPL
FT                   VIHSLQLVKTVAVASGGWPSKKIEPLCELLMNASRSTNEYITMGAFEVFEVIFSSMANE
FT                   FTSSKLPRLLEAISELKPAQNDSQLLPPWIAVLSRGYDVSAQISPEDTFEKLPELFNMI
FT                   SSYLASPSSNIRVSASECLVSFVANCIPASVIIEPSVYDEKTLEKLAKSTKDLLSVKYQ
FT                   AAWMEVFNVCAAMFESFKWQSSPFLDDIVKTVGELRSNEAFQGKKEADNVLGAAIEAMG
FT                   PEAVLNILPLNLIEQKAGQPGRVWFLPILRDSVTNTNLSHFRSEFVPLSEALYQRVMEY
FT                   ASAEKTVEVKIFETLVQQTWAILPGYCELPLDLIESFDQSFAELLSNILYKQTDLRVDI
FT                   CKALQNLVESNQAILSVENEKDDLILQRRITKEAAKKNIAHLAGFASNLLAVLFNVYSQ
FT                   TLPHYRGYILQCINAYLSITPEKELNDTFERVTQMLESSVTSEQEAAKQGNQPTNSGDK
FT                   MPPTSHTLIDLVIAMSIYLPRSSFAALFSLAAAILNGGTADQQLIKKAYKLIPRLATTE
FT                   TGAAALRERNAELQGLILATADKTPASARRDRMLAIHELVSHLPTSDLHFIPSILSEVV
FT                   LGCKESNEKARTASFDLLIQLAKRTIDHELNPPGTTIRNSLVPHMPDDAPDAPATIEEF
FT                   FTMVSAGLAGSSPHMVAASVTALSRLFFDFHKDIQSAIRLDLVQTVELFLTSNNREIVR
FT                   SVLGFVKVAVVVLSDDELRPRLNTLVPNLMVWSKEHKGRLKSKVKGILDRLIRRFGAAP
FT                   LEELVGEADRKLVVNIRKLRERRKKKKKEGEADDDEDDDDGHNPGTADKNAKSFGNAFD
FT                   KAVYDSDFSDSDDDASEISVDEEGTTHVQSKGGRKAQGRKGKQSEQYIRELSPEDNPLD
FT                   LLAPDALANISTTKPSVRFLNTGPGSRRKHAAKVGPDGRLLLGGDDDAEDIDMAGGDGD
FT                   NGESGINAYVQAVAGPDAIRRGQRGKIKMAQAQKKKSQRDDEMDVDDGNENSANTNRQS
FT                   SSQAGRGGPGRGSSRGGSNPPGRRGLGMPKTHGPSGIQKRRNPRGGRSGRGGIRVGRER
FT                   GRR"
FT   gene            complement(948560..949269)
FT                   /locus_tag="ANIA_06199"
FT                   /old_locus_tag="AN6199.4"
FT                   /product="small nuclear ribonucleoprotein (LSM1), putative
FT                   (AFU_orthologue; AFUA_2G11800)"
FT   mRNA            complement(join(948560..948864,949107..949269))
FT                   /locus_tag="ANIA_06199"
FT                   /old_locus_tag="AN6199.4"
FT                   /note="transcript_id=CADANIAT00006809"
FT   CDS_pept        complement(join(948560..948864,949107..949269))
FT                   /locus_tag="ANIA_06199"
FT                   /old_locus_tag="AN6199.4"
FT                   /product="small nuclear ribonucleoprotein (LSM1), putative
FT                   (AFU_orthologue; AFUA_2G11800)"
FT                   /note="transcript_id=CADANIAT00006809"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006809"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006809"
FT                   /db_xref="GOA:Q5AZT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZT1"
FT                   /protein_id="CBF69985.1"
FT                   /translation="MERLSINDPPGTGPHGNLPQGIPPQGNLGPMTHGPPQLPPQMFTT
FT                   AAQLLDLTDNIPRGVFLVRGENVLLLGEIVRSSWPQYTGTIIKMLTCGFSYLQDLDKED
FT                   DIPPNLIKATFKEVFELKKKEDNERKSHDKKRNNKLQELGFEAEHSGEILF"
FT   gene            complement(949695..951109)
FT                   /locus_tag="ANIA_06198"
FT                   /old_locus_tag="AN6198.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(949695..949723,949904..949967,
FT                   950456..951109))
FT                   /locus_tag="ANIA_06198"
FT                   /old_locus_tag="AN6198.4"
FT                   /note="transcript_id=CADANIAT00006810"
FT   CDS_pept        complement(join(949695..949723,949904..949967,
FT                   950456..951109))
FT                   /locus_tag="ANIA_06198"
FT                   /old_locus_tag="AN6198.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006810"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006810"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006810"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZT2"
FT                   /protein_id="CBF69987.1"
FT                   /translation="MTQDDSARIMCADAPEAASKMKSRPDSTAGVPSLSTDSASTRSTS
FT                   SSLSLRTMWASGVIGGGILEEDDTGALVLPPDHINQRHIQSPSPPSSPLLRQQQIYTCL
FT                   FHILDCHDTFDNCEQWKTHVLSHFRMHEPPDTARCPLCPAQRFSSTPHQRAWDLMLKHV
FT                   DVAHYQQGQTLAGSRPDFELMRYLYNLRVISVEQFKAMQLAPQPSSPAYHRRQDTSVVD
FT                   ISHVAVLRSSNLALSCAFCRNPFHAE"
FT   gene            952152..953602
FT                   /gene="nudF"
FT                   /locus_tag="ANIA_06197"
FT                   /old_locus_tag="AN6197.4"
FT                   /product="Nuclear distribution protein nudF
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q00664]"
FT   mRNA            join(952152..952189,952246..952411,952472..953602)
FT                   /gene="nudF"
FT                   /locus_tag="ANIA_06197"
FT                   /old_locus_tag="AN6197.4"
FT                   /note="transcript_id=CADANIAT00006811"
FT   CDS_pept        join(952152..952189,952246..952411,952472..953602)
FT                   /gene="nudF"
FT                   /locus_tag="ANIA_06197"
FT                   /old_locus_tag="AN6197.4"
FT                   /product="Nuclear distribution protein nudF
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q00664]"
FT                   /note="transcript_id=CADANIAT00006811"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006811"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006811"
FT                   /db_xref="GOA:Q00664"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017252"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00664"
FT                   /protein_id="CBF69989.1"
FT                   /translation="MSQILTAPQAEALHKAMLAYLSVINAPQTAETLREELHFDESYNE
FT                   ATCKKFEGVLEKKWTGIARLQRRINDLEAEVRSLQAELEASPSAARAKNQDPTNWLPKP
FT                   SSTHTLTSHRDAVTCVAFHPVFTSLASGSEDCTIKIWDWELGEIERTLKGHIRGVSGLD
FT                   YGGQKGNTLLASCSSDLTIKLWDPSKDYANIRTLSGHDHSVSSVRFLTSNDNHLISASR
FT                   DGTLRIWDVSTGFCVKVIKSATESWIRDVSPSFDGKWLVSGGRDQAITVWEVSSAEPKA
FT                   ALLGHENFIECCVFAPPASYEHLATLAGLKKPPPATSSCEFVATGARDKTIKLWEARGR
FT                   LIKTLHGHDNWVRGLVFHPGGKYLFSVSDDKTIRCWDLSQEGRLVKTISGAHEHFVSCI
FT                   RWAPSPNTDNPDPAGEKAGKKDAVKPSYRCVIATGCADNSVRVFS"
FT   gene            complement(954986..955884)
FT                   /locus_tag="ANIA_06196"
FT                   /old_locus_tag="AN6196.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(954986..955444,955566..955884))
FT                   /locus_tag="ANIA_06196"
FT                   /old_locus_tag="AN6196.4"
FT                   /note="transcript_id=CADANIAT00006812"
FT   CDS_pept        complement(join(954986..955444,955566..955781))
FT                   /locus_tag="ANIA_06196"
FT                   /old_locus_tag="AN6196.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006812"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006812"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006812"
FT                   /db_xref="GOA:Q5AZT4"
FT                   /db_xref="InterPro:IPR024145"
FT                   /db_xref="InterPro:IPR025718"
FT                   /db_xref="InterPro:IPR038291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZT4"
FT                   /protein_id="CBF69991.1"
FT                   /translation="MAPPRQRTTAVQDDSRSEASSTTTKELKAAAARGRKGANVGNATA
FT                   VSRDLKSTSNVTSAPATQGEQTDNLPRIPWSEMPLEFLHSYRHAYKLTCPSAHSSEYAH
FT                   NLLSRGIGLLSPTAIAARRAQNHGSQPSDGSLKSHHNRSRPNGTSGDPQNSFSKRSGPH
FT                   NGKGTLNHIISQDRVAKSQLATAVRKHFNSAGLVEQEAIARFLYKVREEGRGRHFRLKF
FT                   QP"
FT   gene            965719..967720
FT                   /gene="creA"
FT                   /locus_tag="ANIA_06195"
FT                   /old_locus_tag="AN6195.4"
FT                   /product="DNA-binding protein creA (Carbon catabolite
FT                   repressor) [Source:UniProtKB/Swiss-Prot;Acc:Q01981]"
FT   mRNA            965719..967720
FT                   /gene="creA"
FT                   /locus_tag="ANIA_06195"
FT                   /old_locus_tag="AN6195.4"
FT                   /note="transcript_id=CADANIAT00006813"
FT   CDS_pept        966105..967355
FT                   /gene="creA"
FT                   /locus_tag="ANIA_06195"
FT                   /old_locus_tag="AN6195.4"
FT                   /product="DNA-binding protein creA (Carbon catabolite
FT                   repressor) [Source:UniProtKB/Swiss-Prot;Acc:Q01981]"
FT                   /note="transcript_id=CADANIAT00006813"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006813"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006813"
FT                   /db_xref="GOA:Q01981"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01981"
FT                   /protein_id="CBF69992.1"
FT                   /translation="MPQPGSSVDFSNLLNPQNNTAIPAEVSNATASATMASGASLLPPM
FT                   VKGARPAAEEARQDLPRPYKCPLCERAFHRLEHQTRHIRTHTGEKPHACQFPGCSKRFS
FT                   RSDELTRHSRIHNNPNSRRGNKAQHLAAAAAAAAANQDGSAMANNAGSMMPPPSKPITR
FT                   SAPVSQVGSPDISPPHSFSNYANHMRSNLSPYSRTSERASSGMDINLLATAASQVERDE
FT                   SFGFRSGQRSHHMYGPRHGSRGLPSLSAYAISHSMSRSHSHEDEDSYASHRVKRSRPNS
FT                   PNSTAPSSPTFSHDSLSPTPDHTPLATPAHSPRLKPLSPSELHLPSIRHLSLHHTPALA
FT                   PMEPQAEGPNYYNPNQPHVGPSISDIMSRPEGAQRKLPIPQVPKVAVQDMLNPSGFTSV
FT                   SSSTANSVAGGDLAERF"
FT   gene            complement(968670..971788)
FT                   /locus_tag="ANIA_10788"
FT                   /old_locus_tag="AN10788.4"
FT                   /product="Vacuolar protein-sorting protein bro1 (BRO
FT                   domain-containing protein 1)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q6XPR4]"
FT   mRNA            complement(join(968670..969800,969857..971450,
FT                   971511..971788))
FT                   /locus_tag="ANIA_10788"
FT                   /old_locus_tag="AN10788.4"
FT                   /note="transcript_id=CADANIAT00006814"
FT   CDS_pept        complement(join(968670..969800,969857..971450,
FT                   971511..971788))
FT                   /locus_tag="ANIA_10788"
FT                   /old_locus_tag="AN10788.4"
FT                   /product="Vacuolar protein-sorting protein bro1 (BRO
FT                   domain-containing protein 1)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q6XPR4]"
FT                   /note="transcript_id=CADANIAT00006814"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006814"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006814"
FT                   /db_xref="GOA:C8V212"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="InterPro:IPR025304"
FT                   /db_xref="InterPro:IPR038499"
FT                   /db_xref="UniProtKB/Swiss-Prot:C8V212"
FT                   /protein_id="CBF69994.1"
FT                   /translation="MVQSPMISCPLKQTNEIDWIQPLKDYIRQSYGEDPERYSQECATL
FT                   NRLRQDMRGAGKDSATGRDLLYRYYGQLELLDLRFPVDENHIKISFTWYDAFTHKPTSQ
FT                   YSLAFEKASIIFNISAVLSCHAANQNRADDIGLKTAYHNFQASAGMFTYINENFLHAPS
FT                   TDLNRETVKTLINITLAQGQEVFLEKQIMDHKKAGFLAKLASQASYLYAQAIEGTQEHA
FT                   KGIFDKSWVTLLQVKSAHMGSVASYYQALADGESGSHGVAVARLQLAEKHSTSALSWAK
FT                   SLPSSISPNTNLTSEAGPSLVDIVKFHLANVQSQLATFVKDNDFIYHQPVPSEAGLSAV
FT                   SKLPAAKAIPVSELYQGQDIQRIIGPDIFQKLVPMSVTETASLYDEEKAKLIRAETEKV
FT                   ETADGEMAASLDYFKLPGSLNILKGGMDQEVMVDEEFQRWCQELAGHDSFAKAFDTLQD
FT                   RKSEVLATLDQCAKQLDLEESVCEKMRSKYGADWSQQPSSRLNMTLRNDIRTYRDTVHE
FT                   ASASDAQLSATLRQYESDFDEMRSAGETDEADVLFQRAMIKAGSKQGKTKNGVTSPYSA
FT                   TEGSLLDDVYDDGVPSVAEQIARVESILKKLNLVKRERTQVLKDLKEKVRNDDISNVLI
FT                   LNKKSITGQESQLFEAELEKFHPHQMRIVQANHKQTALMKELTKTYGDLLQDKRVRAEQ
FT                   SKYESITRQRNSVMARYKKIYDSFNNLGSGIKQAQTFYAEMTETVDSLKKNVDTFINNR
FT                   RSEGAQLLGQIEREKAAGTSDHEEREREKLRQLMERLSTEPKPPSVPPGSSTAGPAKAK
FT                   SPPPPVKAPAYPTNIAPPKASPHFAPTVPQQHGTPVSHSPAPYSQYVPPGAGVSYLPSQ
FT                   SFQQGAAAPLSEGYNPMAYPIPASSMSPPPSQPFYSPTPTPFYTSPTPPVPSGQYMPQG
FT                   YVPPPPPPRPQQPTYPPSTGPFPSGPGGYAQSRPYGSSQHHKAHSQSSPQTGPSVSANS
FT                   SDPWAGLNAWK"
FT   gene            complement(972427..974278)
FT                   /locus_tag="ANIA_10778"
FT                   /old_locus_tag="AN10778.4"
FT                   /product="mitochondrial DnaJ chaperone (Mdj1), putative
FT                   (AFU_orthologue; AFUA_2G11750)"
FT   mRNA            complement(join(972427..972607,972660..973912,
FT                   973975..974278))
FT                   /locus_tag="ANIA_10778"
FT                   /old_locus_tag="AN10778.4"
FT                   /note="transcript_id=CADANIAT00006815"
FT   CDS_pept        complement(join(972427..972607,972660..973912,
FT                   973975..974184))
FT                   /locus_tag="ANIA_10778"
FT                   /old_locus_tag="AN10778.4"
FT                   /product="mitochondrial DnaJ chaperone (Mdj1), putative
FT                   (AFU_orthologue; AFUA_2G11750)"
FT                   /note="transcript_id=CADANIAT00006815"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006815"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006815"
FT                   /db_xref="GOA:C8V213"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:C8V213"
FT                   /protein_id="CBF69996.1"
FT                   /translation="MNPSSALMPKATAIPGCILRTSRQCSKHNQTSGIRASSSTRQYHV
FT                   AAIESPARRRRDSTFMKRSDFIQARNFHATKVLAAIPDPYKVLGVDKGASAGDIKKAYY
FT                   GMAKKYHPDTNKDPGAKEKFAEAQSAYELLSDKKKRETYDRFGSAAFDQNGGFDPSAGA
FT                   GGNPFAGGGGFHGFGGGFGGGFPGGFAADINIEDLFGAFAGGARRSGRGRRGPFQEILV
FT                   GEDIEVQTNISFMEAAKGTSQDIVITPLKECGTCKGDGLKEGAKRTQCRQCNGTGTRVH
FT                   LMQGGFQVAATCDACGGAGLIVPRGSHCGTCKGDGVVRERKTVRVDIPGGVEDGMRLRI
FT                   SGEGDAPPTGTAAAPGTRTQRGDLYVSIRVSPDERFSRSGSDILYTASIPLTTALLGGE
FT                   VLVPTLDGQVKVKVATGTGTGDRITLSGMGMKKLGGRSRGFSPNGDLKVEFKVAMPKYL
FT                   TSNQRTILEVLADEMGDKTARRIMDIPRDGLSTAPAADASSGNESKSEGFLKSAWHKLM
FT                   NHKKPAGSENSSDSSSNKDSNSSGDSKKSE"
FT   gene            974456..978361
FT                   /locus_tag="ANIA_06193"
FT                   /old_locus_tag="AN6193.4"
FT                   /product="mitochondrial serine protease Pim1, putative
FT                   (AFU_orthologue; AFUA_2G11740)"
FT   mRNA            join(974456..977524,977579..977796,977855..978361)
FT                   /locus_tag="ANIA_06193"
FT                   /old_locus_tag="AN6193.4"
FT                   /note="transcript_id=CADANIAT00006816"
FT   CDS_pept        join(974584..977524,977579..977796,977855..978010)
FT                   /locus_tag="ANIA_06193"
FT                   /old_locus_tag="AN6193.4"
FT                   /product="mitochondrial serine protease Pim1, putative
FT                   (AFU_orthologue; AFUA_2G11740)"
FT                   /note="transcript_id=CADANIAT00006816"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006816"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006816"
FT                   /db_xref="GOA:Q5AZT7"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZT7"
FT                   /protein_id="CBF69998.1"
FT                   /translation="MLRGQTLRWRAALQTPRSLILRPLFAPGGYNVGPRSVLETSRRFR
FT                   SLPPSLRTFSSSTARRKEKPPPGDEKEDSNKKENKDNDDGTEDKEVERDPRRKQADSSG
FT                   KHGSSVDPGAPTSGFARRREKAADRDQRSVTEDAKREAEAKGNSSDTPSAIPVSDSSSE
FT                   SKPSGSHNGGDDGGKKGKKNDKALQKPSVPDVYPQVMAIPIAKRPLFPGFYKAITIRDP
FT                   NVATAIQEMMKRGQPYVGAFLFKDENADGDVIESTDDVYDTGVFAQVTAAYPLRGEQSG
FT                   VTAVLYPHRRIKISSLIPPGDSTKSGNSEDKTTEKRGDVVASFEENAAELVTKDHYEPT
FT                   SFLRKYPVSLVNVENLTEEPFDKKSAIIRAVTSEIVNVCKEIATLNPLFRDQISAFYTD
FT                   QFPGNLSDEPAKLADFAAAVSGGELHELQEVLESMNIEERLPKGLVVLKKELMNAQLQT
FT                   KISKDVEAKIQKRQREYWLMEQMKGIKRELGIESDGKDKLVEKFKEKAEKLAMPEAVKK
FT                   VFDEELNKLAHLEPAASEFNVTRNYLDWLTQIPWGQKSVENFGISHATDVLNEDHYGLK
FT                   DVKDRILEFIAVGKLRGTVEGKILCLVGPPGVGKTSIGKSIARALNRQYYRFSVGGLTD
FT                   VAEIKGHRRTYVGALPGRIIQALKKCQTENPLILIDEVDKIGRGHQGDPSSALLELLDP
FT                   EQNSSFLDHYMDVPVDLSKVLFVCTANVTDTIPRPLLDRMELIELSGYVADEKMAIAQK
FT                   YLAPAARELTGLKNVDVTLTEEAIEELIKSYCRESGVRNLKKQIEKVYRKAAFKIVSDL
FT                   GEDVLAEDKALTAEGKAAQEESEKETGPIESTSEQEKATTENPRVALNVPDSVHLSIGK
FT                   DSLTDYVGPPIFTTDRLYDTFPPGVTMGLAWTSMGGAALYVESILENALTPESQPGLDI
FT                   TGNLQNVMKESTQIAYSFVKSVMAKQFPENRFFEKAKLHMHCPEGAVPKDGPSAGITMA
FT                   TSLLSLALNHPLDPTIAMTGELTVTGKVLRIGGLREKTVAARRAGAKTIIFPADNMSDW
FT                   LELPENIKSGIEGHAVSWYSEVFDILFADLDKQAANRVWQKQLSKEPKKSNDKDDH"
FT   gene            980129..983587
FT                   /locus_tag="ANIA_06192"
FT                   /old_locus_tag="AN6192.4"
FT                   /product="Protein kinase domain-containing protein
FT                   (AFU_orthologue; AFUA_2G11730)"
FT   mRNA            980129..983587
FT                   /locus_tag="ANIA_06192"
FT                   /old_locus_tag="AN6192.4"
FT                   /note="transcript_id=CADANIAT00006817"
FT   CDS_pept        980129..983587
FT                   /locus_tag="ANIA_06192"
FT                   /old_locus_tag="AN6192.4"
FT                   /product="Protein kinase domain-containing protein
FT                   (AFU_orthologue; AFUA_2G11730)"
FT                   /note="transcript_id=CADANIAT00006817"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006817"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006817"
FT                   /db_xref="GOA:Q5AZT8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZT8"
FT                   /protein_id="CBF70000.1"
FT                   /translation="MAISIADSSNSSPRSSLAFLLDPDKVEPPRPKQSMWHRLGLRRWL
FT                   GRDDRDFHSRSPASASNESSPPASNDRFKGNNTPPKSHDNLTRRLSRKVGVGLPRSTTF
FT                   KRQESERRDRLSPVESEPRPRAVSADRRTLSLQRTKSPQSVVDPRLSAPEINWPRDEPD
FT                   PDPDPSITKDDEPPASNEETTQDNDGRSEWDHNPEVTDTPEGYPVDSVDMELDRRWILN
FT                   LSMHFRDRSEREKFFVTYAEAANRWRRVTISCDYRDAEPESLEEDLKELRYQRDKCARI
FT                   YESIRESLPEIQFYDTVTNLKLETRDGRLHVHVTEDVNEIIPYPPISSIGHLPEARLVP
FT                   ERWLHFEAHLSGFVYNVRLGDKSFIKKEIPGPDTVDEFLYEINALHALQGIPNVIQVEG
FT                   IVVDDRQEVVKGLLISFAEKGALVDILYEYRGTISWERRERWARQIVQGLCEIHEAGYV
FT                   QGDFTLSNIVIDANDDAKIIDINRRGCPVGWEPPEIAAKIESNQRISMYIGVKTDLFQL
FT                   GMTLWALAMEEDEPERQRRPFVLDGDVPVPDYYRRLVSICLSPSPRQRLSAKELLTLFP
FT                   PETGTFDQLPRMQPHTSIGVGLHNGALPLYDSRAAFLYSRGRQLGNFTHSNTHIPEQPP
FT                   INSSESIHSPETDRTVSDREEQEQRMELYDEAVQLNGFRKSESLIFDERSSVVDDMVQM
FT                   RRLARPEEAQQSRRSPPIDYAENEFDVDPRYRSSSTDMTMVDPTSNGEPLSDGIVGGES
FT                   WKISSENSSIHYNAPEQPATTPAPADTYPVDSVTKSLSSLESLRPVPTLLLSSLPINPA
FT                   AESLEQVICTTGDILRPSNVALENTQQAIDQPSTYLSDSVLPINPAARALERVLPGKVQ
FT                   SQANIQSTLEYPQDVAVISRLSDRSLPLNLVTKQPEAESVDLSAENASNSQDEGASEWH
FT                   QQVIQAQIPDWSVPRLTANPATESTGDLKPEAGTSFIHGIDSTQPTEQTSEDQNQNLSN
FT                   SQLPINPATITSGDISSDNIDASLTPIAQSIRCTQQTIRDQNQSSFLRNYHLPINPAIT
FT                   SPEGTIGYEAIIKPGINAGSTSYALPVIQDSNQNSFLNASHLPINPAAKCSNEGTYNTN
FT                   SMPPTTINAQPTPNSRHGVHDRSFHLNDSHLPINPAFADKALQSV"
FT   gene            complement(984379..985992)
FT                   /locus_tag="ANIA_06191"
FT                   /old_locus_tag="AN6191.4"
FT                   /product="CobW domain protein (AFU_orthologue;
FT                   AFUA_2G11720)"
FT   mRNA            complement(join(984379..984404,984571..984850,
FT                   984903..985434,985493..985589,985642..985653,
FT                   985709..985792,985872..985992))
FT                   /locus_tag="ANIA_06191"
FT                   /old_locus_tag="AN6191.4"
FT                   /note="transcript_id=CADANIAT00006818"
FT   CDS_pept        complement(join(984379..984404,984571..984850,
FT                   984903..985434,985493..985589,985642..985653,
FT                   985709..985792,985872..985992))
FT                   /locus_tag="ANIA_06191"
FT                   /old_locus_tag="AN6191.4"
FT                   /product="CobW domain protein (AFU_orthologue;
FT                   AFUA_2G11720)"
FT                   /note="transcript_id=CADANIAT00006818"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006818"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006818"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8V216"
FT                   /protein_id="CBF70002.1"
FT                   /translation="MEDDDAPPDLVDVSQLPKSELQSSSAELPPQQRVPITLVTGYLGA
FT                   GKTTLLNYILSEKHGKKIAVIMNEFGDSTDIEKPMTVNQDGQEVTEWLEVGNGCICCSV
FT                   KDSGVMAIESLMERRGTFDYILLETTGLADPGNIAPIFWVDDNLGSSIYLDGIVTLVDA
FT                   KNILHLLDEPTPEETVAVENSKDGSDHDHDHAHSGPVLSMAHMQISHADVIILNKTDLV
FT                   TAEELEHVRDRVTAINSAAKIHVTDHSRTPQIEGVVLDLHAYDHLDSLDFSQKGHSHID
FT                   PSISTILLTHPPLHHSKIPLVDVWLRSVLWDSTLPLPSGSEAQNPSFDIHRLKGILALS
FT                   DGSSRIIQAVREVFEIRDEATPTKSSSAAEDSDRRITIMSDVL"
FT   gene            986344..987864
FT                   /locus_tag="ANIA_06190"
FT                   /old_locus_tag="AN6190.4"
FT                   /product="Mob1 family protein (AFU_orthologue;
FT                   AFUA_2G11710)"
FT   mRNA            join(986344..986580,986653..987864)
FT                   /locus_tag="ANIA_06190"
FT                   /old_locus_tag="AN6190.4"
FT                   /note="transcript_id=CADANIAT00006819"
FT   CDS_pept        join(986344..986580,986653..987864)
FT                   /locus_tag="ANIA_06190"
FT                   /old_locus_tag="AN6190.4"
FT                   /product="Mob1 family protein (AFU_orthologue;
FT                   AFUA_2G11710)"
FT                   /note="transcript_id=CADANIAT00006819"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006819"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006819"
FT                   /db_xref="GOA:Q5AZU0"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="InterPro:IPR036703"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZU0"
FT                   /protein_id="CBF70004.1"
FT                   /translation="MTTAAVSPSSSPRLPSPPPFTEVQIGPKSPSVGESFGAEADLQLL
FT                   GVSSGTDDGPTRRIRPGSKSSEMAAGPPLIPLSQLDSPFQLQEHLKALYNHYTRPEDSD
FT                   TVVPIQREVARQLAEPPEGVERSLWLYELCRFLTMKVNNLIIAFFAENPPCSAQTCPEM
FT                   RASEWQYLCAVHDPPKACCAIDYCCHTLDWATNILTSPKHFPSRLTLGSESGGGPQAGL
FT                   RHLTNIFRRLYRIFAHAWFQHREVFWQVEGHDGLYMFFKTVCDVYHLIPEDNYTVPPEA
FT                   EGDDAHQPQHVQEQGDGRRLTILRKDNESLLPPLDQVEPASISTGATTRRHKSSPSIGS
FT                   RVTTISESVEDNEEQPQQPQQPPLEVALPQQQLPSEPSSGSPGEPVDSPTQSAESQITV
FT                   AEVEPEDEASEAAEASSAAQELDENPHSDIAKEESPAVAPEDAKPGATSESDPAVTKSE
FT                   SEPETDSDTNSESRQKEEEPAKKD"
FT   gene            988237..988831
FT                   /locus_tag="ANIA_06189"
FT                   /old_locus_tag="AN6189.4"
FT                   /product="HIT domain protein (AFU_orthologue;
FT                   AFUA_2G11700)"
FT   mRNA            join(988237..988293,988358..988831)
FT                   /locus_tag="ANIA_06189"
FT                   /old_locus_tag="AN6189.4"
FT                   /note="transcript_id=CADANIAT00006820"
FT   CDS_pept        join(988237..988293,988358..988831)
FT                   /locus_tag="ANIA_06189"
FT                   /old_locus_tag="AN6189.4"
FT                   /product="HIT domain protein (AFU_orthologue;
FT                   AFUA_2G11700)"
FT                   /note="transcript_id=CADANIAT00006820"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006820"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006820"
FT                   /db_xref="GOA:Q5AZU1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039383"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZU1"
FT                   /protein_id="CBF70006.1"
FT                   /translation="MPLPKGLPIHFGPFLVTPQVFHTTPLSFALVNLKPILPGHVLVSP
FT                   RRVVPRVSDLTPPEAADLFLTVRHVGRMIERVYGASSLNIAIQDGAEAGQSVPHVHAHI
FT                   IPRKKRDLNSTDEIYDKLDGEEGDLARGLKGRQGDDRERLRVDDEERVARGPEEMEAEA
FT                   IMLAREMEKEPLD"
FT   gene            complement(989196..990046)
FT                   /locus_tag="ANIA_06188"
FT                   /old_locus_tag="AN6188.4"
FT                   /product="HD family hydrolase, putative (AFU_orthologue;
FT                   AFUA_2G11680)"
FT   mRNA            complement(join(989196..989839,989895..990046))
FT                   /locus_tag="ANIA_06188"
FT                   /old_locus_tag="AN6188.4"
FT                   /note="transcript_id=CADANIAT00006821"
FT   CDS_pept        complement(join(989196..989839,989895..989943))
FT                   /locus_tag="ANIA_06188"
FT                   /old_locus_tag="AN6188.4"
FT                   /product="HD family hydrolase, putative (AFU_orthologue;
FT                   AFUA_2G11680)"
FT                   /note="transcript_id=CADANIAT00006821"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006821"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006821"
FT                   /db_xref="GOA:C8V219"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:C8V219"
FT                   /protein_id="CBF70008.1"
FT                   /translation="MGSQHPFEQSLWTPQSVLSTLPNPPEENSTSPIPFFHLLERLKTT
FT                   KREGWRRFNINDGESISDHMYRMSMMTMLAPPSLAARLDLPRCMKMALVHDMAESLVGD
FT                   ITPNDPIKKDEKARREAAVMEYIANSLLRNVPSGVSAGDDILAVFNEYEANETLEAQFV
FT                   HDVDKMELLLQMIEYERSYEIDLNEFLGVAKRIQLPEIKEWAATVLEERKALWKSRQQQ
FT                   ESTSEATT"
FT   gene            990116..992159
FT                   /locus_tag="ANIA_06187"
FT                   /old_locus_tag="AN6187.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(990116..990197,990243..990478,990555..992159)
FT                   /locus_tag="ANIA_06187"
FT                   /old_locus_tag="AN6187.4"
FT                   /note="transcript_id=CADANIAT00006822"
FT   CDS_pept        join(990116..990197,990243..990478,990555..992159)
FT                   /locus_tag="ANIA_06187"
FT                   /old_locus_tag="AN6187.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006822"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006822"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006822"
FT                   /db_xref="GOA:Q5AZU3"
FT                   /db_xref="InterPro:IPR028163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZU3"
FT                   /protein_id="CBF70010.1"
FT                   /translation="MNHGRRFLSTVNNPFDNLYQLHVPYLIEMQASKNPRPKPSNWPPQ
FT                   SFHTVLIRNLQLLELDQLEDWPGITPRTLLPTSQNQRQRVKAIEWILFRLVALWDPETA
FT                   RDKLRPFFPPLEPLQSVNLRAALYRILSDLKKNGDLGRETILRKSMLDDCKGEKFDELL
FT                   AVFSTNVLRRKISTRNPAIDLSLTSGLTRQEYTRLLPLILAHRASLSTLSERRERVRDT
FT                   HEKFSQLLDRKKEELDTRSAIDTHAIRVRDTEIEALAHETRANWQGSVEWVNVLLYGGL
FT                   SSSRDAFLELPFDSAWSQAMASTVDKLRTTATRSDLILDLETRVSRQRARLQHWCRYSD
FT                   SLKRSGLASPAKPAATNKGPQLIFRDHQNLTIASISKAVRQPVNRGPPDVDDQNILHSL
FT                   STAMERINGVSRQRQSSPSPISGLEPEPEPKTSRSYPPIERPEVIEPPTGSNASDYIDE
FT                   ESLKKRHREIFTLTERTRRSMSFFEGIPESPPQAEPNPVKDSTNSSPEEEPPRESYTLV
FT                   ERTRKSMSLLPPPRDPPRPPRQSRKSRASFPVNQFETPPKPSYDIPSRASTPRDELFEE
FT                   QADYASVFKSRPRIALSPVASPAVHINPIEDFDLSADGNFGQGHTKDDLNHAALGSPLR
FT                   SRGRW"
FT   gene            complement(992328..995218)
FT                   /locus_tag="ANIA_06186"
FT                   /old_locus_tag="AN6186.4"
FT                   /product="hypothetical DNA excision repair complex
FT                   component (Eurofung)"
FT   mRNA            complement(992328..995218)
FT                   /locus_tag="ANIA_06186"
FT                   /old_locus_tag="AN6186.4"
FT                   /note="transcript_id=CADANIAT00006823"
FT   CDS_pept        complement(992328..995153)
FT                   /locus_tag="ANIA_06186"
FT                   /old_locus_tag="AN6186.4"
FT                   /product="hypothetical DNA excision repair complex
FT                   component (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006823"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006823"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006823"
FT                   /db_xref="GOA:Q5AZU4"
FT                   /db_xref="InterPro:IPR004583"
FT                   /db_xref="InterPro:IPR018325"
FT                   /db_xref="InterPro:IPR018326"
FT                   /db_xref="InterPro:IPR018327"
FT                   /db_xref="InterPro:IPR018328"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZU4"
FT                   /protein_id="CBF70012.1"
FT                   /translation="MPPFIRSKRQSSEHNTTSNRHATTAVTTPSASTSLTPASDSSLTP
FT                   VPTDLDNDSSNEDKKVVSDSDVTDSEEVDWEDAIHTAAPATSFVSPHENLELTLDRNEV
FT                   HLEDILQGQKAPTKIERQIRILIHRLHVQCLLAHNAIRNDWINDPKCHDILRQRLPPAI
FT                   QAEIQKWRRASGLEPPEAPKNPPSQEKKGKQSKHQVKSQQRDWGEDSSRQESGQPDLSN
FT                   GDPIIYLMRILAAYWKNKFKITAPGLRKHGYRPMSQLQTQIASFHKDKHDPELYGEKIP
FT                   SVEEFRQAAERMEGSRDLGAQLFTALLRAIAIEARLVASLQPLGFGWTKAEAHTSPKSK
FT                   TKPKHTNLESDGDGFPDSDEEEDAQPSSRGRKAAPRYDQDLPFPIYWTEVVSPITHQVI
FT                   SVDPLVLSNAVAATQELQAAFEPRGAKAEKAKQVICYVIAFSADKTAKDVTTRYLRRRT
FT                   WPGKTKGFRLGKKGPDDDLLDWFRVLLRNYERPYKDRTAVDDIEDAKDLVPNRPTKSKP
FT                   TNETVDTLQSLRTSSEFVLERFLRREEALRPGALPVRTFTPGGKKKNANGNGASTPTES
FT                   PKAENVYRRSDVVKCQTAESWHKEGREPLPSAKPLKHVPIRAVTLLRKREVDEEARRTG
FT                   QKPLQGLYSFEQTQEIIPPPIVDGIIPKNEYGNIDCFVPRMVPKGAVHIPFSGTARICK
FT                   KLGIDYAEAVTGFEFGSQMAVPVIEGVVVAAENKDLVVDAWRADNEEKRRKEARKAEAK
FT                   ILATWRKFLFGLRIAQRVQEEYAEDEEGHLPDAHNPFASRKASTHARGHTQTPAEEQHP
FT                   AGLVDEEEEEEEADRGGGFLLGDDHADDGDLIIEVRQPPVRRVQNISSENESLSGDVGR
FT                   GGGFLLDGNNDSNDEGQLAQMRKPPVRRIPRILYRDGSPVLEEESSPEEYTEDISPPPQ
FT                   KRRRTRNSRKT"
FT   gene            995367..997199
FT                   /locus_tag="ANIA_06185"
FT                   /old_locus_tag="AN6185.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(995367..995451,995506..995820,996118..997199)
FT                   /locus_tag="ANIA_06185"
FT                   /old_locus_tag="AN6185.4"
FT                   /note="transcript_id=CADANIAT00006824"
FT   CDS_pept        join(995367..995451,995506..995820,996118..997199)
FT                   /locus_tag="ANIA_06185"
FT                   /old_locus_tag="AN6185.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006824"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006824"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006824"
FT                   /db_xref="GOA:Q5AZU5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZU5"
FT                   /protein_id="CBF70014.1"
FT                   /translation="MEAVKRFFSSPRFAVAGASNDSHKFGYKLLAWYHQHSLPVTPLNP
FT                   RSPSIQLSPSHSYDTVASPRLLSSPSQTSLSVVTPPAVTLPLLQEAHSVGIPAVWLQPG
FT                   TFDDAILDFARSHFEAVVAGDGGRGSEGWSSSFLFDSPIPPHLDLVGAPSPLFQVPPTP
FT                   SASSALYRSISISQRKRSRQAQENSRVDVFQTPHRPPPPVNSYFEDPEEAYDHEDHDIH
FT                   RPSRYREYPRTPLDASMTDSVDDFRRKRCRREDPSLVIAASPSGIDEKAAAPEHMATEA
FT                   RPFRWSQAVLNMVGKVWDFCWSGPFRGFYAGGGRGYSLDPPQRTPEEVYPHRRSSTPHP
FT                   VTIPPRSSSLSPPPAEKRAVSVPGEYPLDAGEEALRGSWVMISPNEGASSFKTPSARSH
FT                   ARKSHAPRRVVHRRSPSRRTLIPHPPFSAPAKPRESPVSVETQRYLAKQRRLEREEDAS
FT                   LQRLNRQLQAMIKEGRQALGTRVEVEDDLDMDLED"
FT   gene            complement(998212..999343)
FT                   /locus_tag="ANIA_10783"
FT                   /old_locus_tag="AN10783.4"
FT                   /product="6-phosphogluconate dehydrogenase family protein
FT                   (AFU_orthologue; AFUA_2G11600)"
FT   mRNA            complement(join(998212..999192,999247..999343))
FT                   /locus_tag="ANIA_10783"
FT                   /old_locus_tag="AN10783.4"
FT                   /note="transcript_id=CADANIAT00006825"
FT   CDS_pept        complement(join(998290..999192,999247..999294))
FT                   /locus_tag="ANIA_10783"
FT                   /old_locus_tag="AN10783.4"
FT                   /product="6-phosphogluconate dehydrogenase family protein
FT                   (AFU_orthologue; AFUA_2G11600)"
FT                   /note="transcript_id=CADANIAT00006825"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006825"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006825"
FT                   /db_xref="GOA:C8V223"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8V223"
FT                   /protein_id="CBF70016.1"
FT                   /translation="MASETVAWIGLGNIGRGMSRNIALKGPQKTPVILYNRTASKASAF
FT                   AESINAEKPQAAVAVSSLPAAVKDASIAFICVGDDSALDQIINTITSDDSPDLQGKIIV
FT                   DCSTVHPDTSRRVHATLSSKGTSFIACPVFGAPNAADAGQMVVVPAGSRAAINRIQPFL
FT                   EGVTSKAVLDVGPEAEKDVGRASLLKVLGNTFILNTVETLAEGLVAAEKSGLGIDVYQQ
FT                   WVTTMFPGPFAKYAERMATGEYFKREEPLFAVDLARKDLRHAADLAKAAGMTLPSVKVT
FT                   DDLLKVVKEEKGEKGDIAGVYGAIRKASGLPYDNQ"
FT   gene            complement(999769..1001376)
FT                   /locus_tag="ANIA_10777"
FT                   /old_locus_tag="AN10777.4"
FT                   /product="UDP-glucoronosyl and UDP-glucosyl transferase
FT                   family protein (AFU_orthologue; AFUA_2G11590)"
FT   mRNA            complement(join(999769..1000042,1000106..1000744,
FT                   1000802..1001376))
FT                   /locus_tag="ANIA_10777"
FT                   /old_locus_tag="AN10777.4"
FT                   /note="transcript_id=CADANIAT00006826"
FT   CDS_pept        complement(join(999772..1000042,1000106..1000744,
FT                   1000802..1001367))
FT                   /locus_tag="ANIA_10777"
FT                   /old_locus_tag="AN10777.4"
FT                   /product="UDP-glucoronosyl and UDP-glucosyl transferase
FT                   family protein (AFU_orthologue; AFUA_2G11590)"
FT                   /note="transcript_id=CADANIAT00006826"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006826"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006826"
FT                   /db_xref="GOA:C8V224"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="UniProtKB/TrEMBL:C8V224"
FT                   /protein_id="CBF70018.1"
FT                   /translation="MAKPTVLFVTNQELGQATVVLSVAYEFLIRQSYNVHIASSRQLEP
FT                   EVSKLNAQAARATQLQSSSTTANFHTLPGRTMFEAAMNRGNSSSSSSGSWFNAHNIGLF
FT                   GARQAYTMLCGVMVPWTGDEYIAVYHRCIEIIKKVQPRIVVIEPLCAQAIDACRTLRCK
FT                   YAILSPNTVKDHVVQPMLGNLWKFPVLCSGYSFPLPWRHILPNAFLAICAGLTFANSRV
FT                   FKAIDERRHAEGITGPYPVMASLAKNPTPLLIASRPEIDFPCFVPDSIISCGPILRPCA
FT                   PINEECPELAEWLLRGPTVLVNLGSNVCFDRDQTRKFAHGLRMLLDARPDIQVLWKLKP
FT                   DRKVEAALWIAEAVEGIFDEVFAGRVRIEEWLPVEPICILESGQICCMVHHGGANSYNE
FT                   AIRAGVPQIVLPVWFDTYDFAARVEYLGVGVWGSKMSAPAINGPELGKALLCVLHSNES
FT                   STIRDQAKTIAAEIGFSEGRVVACEKLLELIER"
FT   gene            complement(1001730..1003014)
FT                   /locus_tag="ANIA_06183"
FT                   /old_locus_tag="AN6183.4"
FT                   /product="F-box domain protein (AFU_orthologue;
FT                   AFUA_2G11570)"
FT   mRNA            complement(join(1001730..1001932,1001984..1002349,
FT                   1002400..1002763,1002812..1003014))
FT                   /locus_tag="ANIA_06183"
FT                   /old_locus_tag="AN6183.4"
FT                   /note="transcript_id=CADANIAT00006827"
FT   CDS_pept        complement(join(1001832..1001932,1001984..1002349,
FT                   1002400..1002763,1002812..1002862))
FT                   /locus_tag="ANIA_06183"
FT                   /old_locus_tag="AN6183.4"
FT                   /product="F-box domain protein (AFU_orthologue;
FT                   AFUA_2G11570)"
FT                   /note="transcript_id=CADANIAT00006827"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006827"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006827"
FT                   /db_xref="GOA:C8V225"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C8V225"
FT                   /protein_id="CBF70019.1"
FT                   /translation="MAAESTSGLHLYSLPNEVFVQILYPFSTRELLHLATVSQRFYALV
FT                   LRLLHYRLLLSAQLTDYKLILECFHPTSKLTEPHVFCKYLGTPCLSDKYEGEGSLYENI
FT                   DTAQQLGRLGTLYSIFKPVETEEETEEGSAAVALDPDSLAVRRPISIESFEDFSQLCVV
FT                   VNVVKVLPGTDVLLSAVNVEDGVIRLFRDWLKGQSNRLPDLQPHTSSESQGEVLWVDQN
FT                   RNVGLKFRVSDVTKLDSNFPVLVHRDDETFSSYEIVIDELHIRTTRLLLTVEQSLQEQQ
FT                   SYPKAVIFTSMG"
FT   gene            1003559..1005065
FT                   /locus_tag="ANIA_06182"
FT                   /old_locus_tag="AN6182.4"
FT                   /product="galactose-1-phosphate uridylyltransferase
FT                   (AFU_orthologue; AFUA_2G11560)"
FT   mRNA            join(1003559..1003699,1003800..1003984,1004043..1004808,
FT                   1004863..1005065)
FT                   /locus_tag="ANIA_06182"
FT                   /old_locus_tag="AN6182.4"
FT                   /note="transcript_id=CADANIAT00006828"
FT   CDS_pept        join(1003599..1003699,1003800..1003984,1004043..1004808,
FT                   1004863..1004968)
FT                   /locus_tag="ANIA_06182"
FT                   /old_locus_tag="AN6182.4"
FT                   /product="galactose-1-phosphate uridylyltransferase
FT                   (AFU_orthologue; AFUA_2G11560)"
FT                   /note="transcript_id=CADANIAT00006828"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006828"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006828"
FT                   /db_xref="GOA:C8V226"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C8V226"
FT                   /protein_id="CBF70021.1"
FT                   /translation="MVESVLDDISHRRYNPLRGAYVLVSPHRTKRPWQGAQETPSKTTL
FT                   PDYDATCYLCPGNKRAQGDHNPKYEKTFIFVNDYSAVKEEQAPYHPEAGTETESFFLRA
FT                   DPVTGKCYVLTFSAAHNLTLADLSPVEIVPVINAWTDVYIAHLSPSSPLAAAASKLTIS
FT                   SGSPAASLAKPNEQYRYMQIFENKGAAMGCSNPHPHGQIWTTSSLPEELAAELEQMKKY
FT                   RREHNGGHMLADYAALESKKQERVVFENDAFLVVCPWWAIWPFETMIISKTHKRALVDL
FT                   DDNEKAQLAEAIAEVTRRYDNLFETHFPYSMGIHQAPLEGSEEEIEASYLHLHFYPPLL
FT                   RSATVRKFLVGYELMAEPQRDITPEQAAARLRGCGGELYRKKLDS"
FT   gene            complement(1005019..1006315)
FT                   /locus_tag="ANIA_06181"
FT                   /old_locus_tag="AN6181.4"
FT                   /product="60S ribosomal protein L44 P (Broad)"
FT   mRNA            complement(join(1005019..1005370,1005436..1005620,
FT                   1005685..1005777,1006258..1006315))
FT                   /locus_tag="ANIA_06181"
FT                   /old_locus_tag="AN6181.4"
FT                   /note="transcript_id=CADANIAT00006829"
FT   CDS_pept        complement(join(1005331..1005370,1005436..1005620,
FT                   1005685..1005777,1006258..1006260))
FT                   /locus_tag="ANIA_06181"
FT                   /old_locus_tag="AN6181.4"
FT                   /product="60S ribosomal protein L44 P (Broad)"
FT                   /note="transcript_id=CADANIAT00006829"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006829"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006829"
FT                   /db_xref="GOA:Q5AZU9"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZU9"
FT                   /protein_id="CBF70023.1"
FT                   /translation="MVNVPKTRKTYCKGKECHKHTQHKVTQYKAGKASLFAQGKRRYDR
FT                   KQSGYGGQTKPVFHKKAKTTKKVVLRLECTQCKTKKQLALKRCKHFELGGDKKTKGAAL
FT                   VF"
FT   gene            complement(1006545..1008530)
FT                   /locus_tag="ANIA_06180"
FT                   /old_locus_tag="AN6180.4"
FT                   /product="hypothetical protein similar to SPBC24C6.01c
FT                   (Broad)"
FT   mRNA            complement(join(1006545..1007176,1007236..1007530,
FT                   1007580..1007714,1008225..1008257,1008456..1008530))
FT                   /locus_tag="ANIA_06180"
FT                   /old_locus_tag="AN6180.4"
FT                   /note="transcript_id=CADANIAT00006831"
FT   CDS_pept        complement(join(1006545..1007176,1007236..1007530,
FT                   1007580..1007714,1008225..1008257,1008456..1008530))
FT                   /locus_tag="ANIA_06180"
FT                   /old_locus_tag="AN6180.4"
FT                   /product="hypothetical protein similar to SPBC24C6.01c
FT                   (Broad)"
FT                   /note="transcript_id=CADANIAT00006831"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006831"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006831"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZV0"
FT                   /protein_id="CBF70025.1"
FT                   /translation="MQCRSTFEVVVLGGLVIGPTEQGETSGSMSSSISFPTTGDSVKKT
FT                   GLMCVRFSAMATASSVVSQQATNPFTQLLLDCQNDPNMIQARYETHRTNRNAQFKEKLL
FT                   HEDFPGWQVDEILRKLVAQSKAQNEDAVPAPDPASTKAPVNFADHRHNLNLYARPPKHI
FT                   KELVAEIQQEIHDIAPSIWFTPPESLHITLLEIVNSRTQEEVDALAGRLLQDGTALKLV
FT                   NYAYDNNYCVRLIKPIISYDASAMALSFVPVTSEATAADKQQPEDAYTYHHLRRDLAAT
FT                   VLESGVGLAARYIVPSAHITIARFVTQDGFLLDGRKVDRNSVAELVQRIERINAILRKE
FT                   YWPQEGGEGSTRAKGEWVVGQEQGLEFNKGTSWYGGGDKVLVGGCLGLQ"
FT   gene            1008136..1008887
FT                   /locus_tag="ANIA_06179"
FT                   /old_locus_tag="AN6179.4"
FT                   /product="hypothetical protein similar to SPBC24C6.01c
FT                   (Broad)"
FT   mRNA            join(1008136..1008146,1008210..1008264,1008333..1008415,
FT                   1008476..1008887)
FT                   /locus_tag="ANIA_06179"
FT                   /old_locus_tag="AN6179.4"
FT                   /note="transcript_id=CADANIAT00006830"
FT   CDS_pept        join(1008136..1008146,1008210..1008264,1008333..1008415,
FT                   1008476..1008572)
FT                   /locus_tag="ANIA_06179"
FT                   /old_locus_tag="AN6179.4"
FT                   /product="hypothetical protein similar to SPBC24C6.01c
FT                   (Broad)"
FT                   /note="transcript_id=CADANIAT00006830"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006830"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006830"
FT                   /db_xref="GOA:Q5AZV1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038738"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZV1"
FT                   /protein_id="CBF70027.1"
FT                   /translation="MLIKVRTLTGKEIELDIEPDYKVSRIKERVEEKEGIPPVQQRLIF
FT                   GGKQMADDKTAQDYNLEGGATLHLVLALRGGCAALQ"
FT   gene            complement(1009213..1010269)
FT                   /locus_tag="ANIA_06178"
FT                   /old_locus_tag="AN6178.4"
FT                   /product="RNA polymerase II transcription factor SIII
FT                   (Elongin) subunit A, putative (AFU_orthologue;
FT                   AFUA_2G08170)"
FT   mRNA            complement(join(1009213..1010025,1010078..1010154,
FT                   1010212..1010269))
FT                   /locus_tag="ANIA_06178"
FT                   /old_locus_tag="AN6178.4"
FT                   /note="transcript_id=CADANIAT00006832"
FT   CDS_pept        complement(join(1009213..1010025,1010078..1010154,
FT                   1010212..1010269))
FT                   /locus_tag="ANIA_06178"
FT                   /old_locus_tag="AN6178.4"
FT                   /product="RNA polymerase II transcription factor SIII
FT                   (Elongin) subunit A, putative (AFU_orthologue;
FT                   AFUA_2G08170)"
FT                   /note="transcript_id=CADANIAT00006832"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006832"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006832"
FT                   /db_xref="GOA:Q5AZV2"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZV2"
FT                   /protein_id="CBF70029.1"
FT                   /translation="MSPPTLRQLCIAAAIRNVKYLNDIGNIPYALARPFLLKIESPEKL
FT                   RSLELQSPHLINDDAELWLEFLKRDIPNLEEYQLPEQPDCWYDLYCELREEVQRGVDED
FT                   AEKLKMALDGLNSERAKHSTKFVADRRTIGVPRSRTTARHRFSTFGGFTPKKSNIFSAT
FT                   RRNNALTVPTKQLNNRATQVRQAPRSLIEEHRRPAEPAIARRPPLRAPGRSNSQDAPST
FT                   RSYSSPSGLSSSLQEREARLRAIASGHVRTPLPLQSSRPASTKTSSGASPTLSESQLGA
FT                   TTNSEPSRLSPPRASIRKRPARNLFIQPKKKKVN"
FT   gene            complement(1011188..1012669)
FT                   /locus_tag="ANIA_06177"
FT                   /old_locus_tag="AN6177.4"
FT                   /product="flotillin domain protein (AFU_orthologue;
FT                   AFUA_2G08180)"
FT   mRNA            complement(join(1011188..1011456,1011509..1012026,
FT                   1012076..1012455,1012506..1012605,1012665..1012669))
FT                   /locus_tag="ANIA_06177"
FT                   /old_locus_tag="AN6177.4"
FT                   /note="transcript_id=CADANIAT00006833"
FT   CDS_pept        complement(join(1011188..1011456,1011509..1012026,
FT                   1012076..1012455,1012506..1012605,1012665..1012669))
FT                   /locus_tag="ANIA_06177"
FT                   /old_locus_tag="AN6177.4"
FT                   /product="flotillin domain protein (AFU_orthologue;
FT                   AFUA_2G08180)"
FT                   /note="transcript_id=CADANIAT00006833"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006833"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006833"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZV3"
FT                   /protein_id="CBF70031.1"
FT                   /translation="MRYCIAEPSEYLVLTGAGIADIEICKKAWVWPWQRCARISVMPFD
FT                   FSLSLQAMTIEKLQFSLPAVFTIGPEDKLSSLKKYALLLSGKTGHQPSTRPAAATEDLN
FT                   TPTTRNHVQDIVKGIIEGETRVIVSSMTMEEIFKERQIFKSKVISNVQNELEQFGLKIY
FT                   NANVKELQDTKGSEYFAFLSRKAQEGALNQAKIDVAEARMRGEIGEAEKKGRTKQEISK
FT                   IDAETAVLETKRKAEKAKADSELLNRQTELDSQVEMGKIIAKRQTESRDAELQKQVETK
FT                   RAETELERLRAKQVTKSKVERESAQEQADALYYSNTKAAEGRLYEEKMEADARFYRSCK
FT                   DDDAMFNTKKREAEGVMEMAKAYGALIDVLGGPDAFLQWKMIETGMYERLALANGQAIQ
FT                   GLQPKITTWNTGGKWPRLFTIGPH"
FT   gene            1013813..1014336
FT                   /locus_tag="ANIA_06176"
FT                   /old_locus_tag="AN6176.4"
FT                   /product="tubulin-specific chaperone Rbl2, putative
FT                   (AFU_orthologue; AFUA_2G08190)"
FT   mRNA            join(1013813..1013980,1014036..1014122,1014179..1014336)
FT                   /locus_tag="ANIA_06176"
FT                   /old_locus_tag="AN6176.4"
FT                   /note="transcript_id=CADANIAT00006834"
FT   CDS_pept        join(1013813..1013980,1014036..1014122,1014179..1014280)
FT                   /locus_tag="ANIA_06176"
FT                   /old_locus_tag="AN6176.4"
FT                   /product="tubulin-specific chaperone Rbl2, putative
FT                   (AFU_orthologue; AFUA_2G08190)"
FT                   /note="transcript_id=CADANIAT00006834"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006834"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006834"
FT                   /db_xref="GOA:C8V232"
FT                   /db_xref="InterPro:IPR004226"
FT                   /db_xref="InterPro:IPR036126"
FT                   /db_xref="UniProtKB/TrEMBL:C8V232"
FT                   /protein_id="CBF70033.1"
FT                   /translation="MAPRSQLEIATSAVQRLVKEEASYRREAEQQKERIKKLEAQDAST
FT                   DENRDYMLKQERLALEETERIFPSLKQKIEESIAKLNGLLVEEGKKGAESNVEHINAAK
FT                   EAIANARVAEREIA"
FT   gene            complement(1014410..1015472)
FT                   /locus_tag="ANIA_06175"
FT                   /old_locus_tag="AN6175.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1014410..1015383,1015436..1015472))
FT                   /locus_tag="ANIA_06175"
FT                   /old_locus_tag="AN6175.4"
FT                   /note="transcript_id=CADANIAT00006835"
FT   CDS_pept        complement(join(1014410..1015383,1015436..1015472))
FT                   /locus_tag="ANIA_06175"
FT                   /old_locus_tag="AN6175.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006835"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006835"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006835"
FT                   /db_xref="GOA:Q5AZV5"
FT                   /db_xref="InterPro:IPR008501"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZV5"
FT                   /protein_id="CBF70035.1"
FT                   /translation="MTSYGLLDQADEDALHKTRLLNVEEKPFKRISKRLLNPESIIISN
FT                   ATLPTPPPEGADEDATASAEAEKQKKLEEWRQFREDASLDFAAFEGSIARIQFLLTSNE
FT                   KERERYVAEKERILSTMQAVRNSTVELRVQLEEAQRILALRKSYDEQTEKITSNRLLKP
FT                   REDQQANLQKLQAEIAELEKESKEYAKTWAERREQFGRIVEEGMQLRRLIRDEKEEVER
FT                   REGMQEDEDGDDGETSKGKLSGANTPRPDQESSTPSQPGHDEGDRSPLPVPTDKATPGA
FT                   TTPLRQVTTAAEVKQEDATMVDEGEVTGDEDERNDDLEEGEEVPDTSNVDKMDTT"
FT   gene            1015920..1017680
FT                   /locus_tag="ANIA_06174"
FT                   /old_locus_tag="AN6174.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1015920..1017185,1017295..1017680)
FT                   /locus_tag="ANIA_06174"
FT                   /old_locus_tag="AN6174.4"
FT                   /note="transcript_id=CADANIAT00006836"
FT   CDS_pept        join(1016040..1017185,1017295..1017333)
FT                   /locus_tag="ANIA_06174"
FT                   /old_locus_tag="AN6174.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006836"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006836"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006836"
FT                   /db_xref="GOA:C8V234"
FT                   /db_xref="InterPro:IPR004332"
FT                   /db_xref="UniProtKB/TrEMBL:C8V234"
FT                   /protein_id="CBF70037.1"
FT                   /translation="MTEMYSGLHVGQRFASLEDFKALVRSISVRQHWELRVTRSNKKSV
FT                   VIGCRSSPNCFFRVVCRANRNATYISSLQDSHSCRRNATSTTKTPARSEASHVRFLLSE
FT                   IPKLFDMRNKIKAQDIVDAVKRYHGYDISTRQAQRALIRLQQRGSQQQSDAANSSSGED
FT                   RQESQPPPVEGQSEGSAYAGIPGQRWMPESVPPNLVDNPQSQNEDPPNPTFSATPLQGQ
FT                   PIQQHPQQLQNPQRIQSTVQTQQPLPPPTPVLQAPAVPQHEPTSLNHPLHAQVTSQQPS
FT                   YSLPTPIQPTPRQAGLTKSPTQTQPQPTQGHPSAPQLVLTNFKIEFSCTTCGALNQSFF
FT                   PNQGNVTGGHYIPPHPIPDHASIPHGAGPSAPTAAAQAIVESLQHIPTIVLHKV"
FT   gene            1017934..1020426
FT                   /locus_tag="ANIA_06173"
FT                   /old_locus_tag="AN6173.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(1017934..1018050,1018097..1018162,1018242..1018997,
FT                   1019047..1020426)
FT                   /locus_tag="ANIA_06173"
FT                   /old_locus_tag="AN6173.4"
FT                   /note="transcript_id=CADANIAT00006837"
FT   CDS_pept        join(1017934..1018050,1018097..1018162,1018242..1018997,
FT                   1019047..1020426)
FT                   /locus_tag="ANIA_06173"
FT                   /old_locus_tag="AN6173.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006837"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006837"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006837"
FT                   /db_xref="GOA:C8V235"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8V235"
FT                   /protein_id="CBF70039.1"
FT                   /translation="MNPSDLAAPQTRASSPYRDYNPRKRGRTACTRCKTRKQKCDNEYP
FT                   VCSNCLRAGAECDKASTPDRYTRALEERIAYLESQLESEAAKSRTASNHAHPVATFLSP
FT                   HAQDTAGQGQAGSTGSAGSGMGNGIDHNAVGELVGFLAINSTEAPAYIGSSSGLSLAAN
FT                   LGEMVQATVWNQVLSSSRNQPSLSGEGRANLDPRVSGLPPQPTPSDRAPGLDRPRTLRM
FT                   EELLAKSTEPPNDEMGGRILHAYLTRLHVRYPFLDRKELWCLHEDRWRLAKAKREELTK
FT                   SERFGIFKLYLTYAIGATTMQLSEKYDYVPPERFYITALQQVPAMCETRSVENVEAMTL
FT                   LVVYHLRSASSQGVWYMIGLAMRTAIDLGLHRKANELNLDPITAQMRRRLFWTVYYLER
FT                   VVSVSLGRPFSIADRHIDLPLPVDVDDDVRDPALLPPESPPVTSPEGNTNGNSTSSRIT
FT                   SLTFSIYLITLRRIDSRIQHKIYRADRPLHLLRSKMDRLFLELEEWKVSALQRFTGSDL
FT                   DYPMLHYNRALRLLIQPFLPSLPLTDPYYHICLRAAGDICQTHKRLHQTLEYGHSFLAV
FT                   QTVFISGITLLYALWTHSDQVWSVRMSNDIRACSTVLFVMGERAVWVKKYRDAFELLVN
FT                   AAMEKLQGNEAAKKAGMAELMTAQHAGLGVGPGAGYGLGISSHASAGQNPNPAIATASG
FT                   YPGTAHTHHTVVTPDSNPNQGLFDPASQDHGVRMALQLAPWIDLEDGHGPFWVPDFETL
FT                   ENFSGNLWSAGDPTAFNPL"
FT   gene            1021634..1022872
FT                   /locus_tag="ANIA_06172"
FT                   /old_locus_tag="AN6172.4"
FT                   /product="hypothetical protein"
FT   mRNA            1021634..1022872
FT                   /locus_tag="ANIA_06172"
FT                   /old_locus_tag="AN6172.4"
FT                   /note="transcript_id=CADANIAT00006838"
FT   CDS_pept        1021634..1022872
FT                   /locus_tag="ANIA_06172"
FT                   /old_locus_tag="AN6172.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006838"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006838"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006838"
FT                   /db_xref="GOA:Q5AZV8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZV8"
FT                   /protein_id="CBF70041.1"
FT                   /translation="MASITCHRHLPPGPGGYDHYVHHHNSDVPPLHLAASTLAAPSSAP
FT                   LCSDPKQDVSSIPTSLAVPVPVPVPVASLDTSSHTSTAAAASEKPHSCHSLDLAGSVYI
FT                   LSEARLSKGAKSTRAANGGMLDHSSPLPVSDKLRTPERRRTVSPSTRSSGEIRSTSRST
FT                   RRSGGGNGGGDGGHSHSRRSSLHSHRRTVTTTSLTPSRPDSPVRRENLIALHRESCRLF
FT                   QDNNLASTTAAVTRQSSFSSSPPFTPRQARTYSNVSSPPVTPILERHHSSTFRHSYSSS
FT                   NLHANHGTVPVSRVEVNLSAETKPTIIEWTSPSTRRREYKEIDRASSGVRGLWRRVAPR
FT                   WCQFGDKRIPFFEEERDGKANYEGSVRRFRMDLPDELESGEYRNQGRRGLGMKLKPRLV
FT                   VQVKRSKTSMSWL"
FT   gene            complement(1023168..1023916)
FT                   /locus_tag="ANIA_06171"
FT                   /old_locus_tag="AN6171.4"
FT                   /product="U3 small nucleolar ribonucleoprotein subunit
FT                   (Imp3), putative (AFU_orthologue; AFUA_2G08320)"
FT   mRNA            complement(join(1023168..1023341,1023419..1023779,
FT                   1023844..1023916))
FT                   /locus_tag="ANIA_06171"
FT                   /old_locus_tag="AN6171.4"
FT                   /note="transcript_id=CADANIAT00006839"
FT   CDS_pept        complement(join(1023168..1023341,1023419..1023779,
FT                   1023844..1023875))
FT                   /locus_tag="ANIA_06171"
FT                   /old_locus_tag="AN6171.4"
FT                   /product="U3 small nucleolar ribonucleoprotein subunit
FT                   (Imp3), putative (AFU_orthologue; AFUA_2G08320)"
FT                   /note="transcript_id=CADANIAT00006839"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006839"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006839"
FT                   /db_xref="GOA:Q5AZV9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZV9"
FT                   /protein_id="CBF70043.1"
FT                   /translation="MVRKLKHHEQKLLRKVNLTTYKSDHAHRESQIIQRYYLQNPVDYK
FT                   KYSAIVGSLRQLAHKLSALDPDSDPIRQKTESEVLDKLWRMGILKQSREQGAGLSRIER
FT                   EVTVSAFCRRRLAVVMARSGMVENIKTAVTFIEQGHVRVGSEVVTDPAYLVTRNMEDFV
FT                   TWVDSSKIKRNIMRYRENLDDFDLM"
FT   gene            complement(1024091..1025501)
FT                   /locus_tag="ANIA_06170"
FT                   /old_locus_tag="AN6170.4"
FT                   /product="DnaJ domain protein, putative (AFU_orthologue;
FT                   AFUA_2G08300)"
FT   mRNA            complement(join(1024091..1025195,1025251..1025501))
FT                   /locus_tag="ANIA_06170"
FT                   /old_locus_tag="AN6170.4"
FT                   /note="transcript_id=CADANIAT00006840"
FT   CDS_pept        complement(join(1024115..1025195,1025251..1025426))
FT                   /locus_tag="ANIA_06170"
FT                   /old_locus_tag="AN6170.4"
FT                   /product="DnaJ domain protein, putative (AFU_orthologue;
FT                   AFUA_2G08300)"
FT                   /note="transcript_id=CADANIAT00006840"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006840"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006840"
FT                   /db_xref="GOA:Q5AZW0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZW0"
FT                   /protein_id="CBF70045.1"
FT                   /translation="MRLMRELFFTFAVVLLLVQLVLAAEDYYKILGLDKGASEKDIRRA
FT                   YRTLSKKFHPDKNPGDDTAREKFVEIAEAYEVLSTPSTRKIYDQYGREGVEQHRQGGQA
FT                   GGHTHDPFDLFSRFFGGGGHFGHAPGHRRGPDMEFRIGLPLRDFYTGRSFELNIERQQI
FT                   CETCQGTGSADREVITCDKCSGRGVVIQKHMLAPGMFQQVQMQCDKCRGQGKTIKKPCP
FT                   VCHGHRVVRKDVETSVTIEPGMDKGTRLVFENEGDESPDYIAGDLVLILEEKEPELGTA
FT                   EEYRTDGTFFRRKGRDLFWKETLSLREAWMGDWTRNITHLDGHVVRLGRSRGEVVQPLS
FT                   VETVKGEGMPFWSDGHIHDHDDQGPGNLYVEYIVILPDQMESGMEKDFHALWEKWRRKN
FT                   GVDLAKDSQRPPAPVKDEL"
FT   gene            complement(1025840..1028238)
FT                   /locus_tag="ANIA_06169"
FT                   /old_locus_tag="AN6169.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1025840..1027790,1027842..1028238))
FT                   /locus_tag="ANIA_06169"
FT                   /old_locus_tag="AN6169.4"
FT                   /note="transcript_id=CADANIAT00006841"
FT   CDS_pept        complement(join(1025983..1027790,1027842..1028238))
FT                   /locus_tag="ANIA_06169"
FT                   /old_locus_tag="AN6169.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006841"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006841"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006841"
FT                   /db_xref="GOA:Q5AZW1"
FT                   /db_xref="InterPro:IPR017943"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZW1"
FT                   /protein_id="CBF70047.1"
FT                   /translation="MSRAETEPLLPRYDDETSRQRRLHQKIHTYQMLRAFSEGYMPSTE
FT                   QAVANLRSLLAFDIFNPRNPDIGSVGRQLVRDCRLWIQLLIEFLQTKNSEDQLQEFIWH
FT                   LSHGRATIHARQLTQRAADTKAKADTKAAYDSLRTVGNLLLTNADFRLFVEDLTTVGRE
FT                   IFSDTAFSLSRASRKAGKKLKPKQEDQQALSGAGADEGHTVSNEELREEVTHVADVAKN
FT                   GLVQTGKEAKESVEEHLTGKEQETLLYRLKQTVLKLRERRDYTDSVAILARLLQKYASV
FT                   YVNAATDAVATAEDETEINEDLKKAIRKFWALLQTIGDSKEWQALEQRLHDVLQHASGD
FT                   PDFENLVSEIGSAMQEMMTNPDSFDSAQEKIGELKEKSKQVGAESSLRKDVDEFLAQAK
FT                   RALHTISQDESVSKLTSASRKLYKDVSEGYHNRRGNLPADMLEIFLPLVLRNIQYIPIP
FT                   RLEISAPEVDLLIENLILEPGHTVNYSSFLPYRMHVTTRNDIDVVKRHSKRTTANLRTM
FT                   FTVSLSGINVSASEFGFWLRTHKALFFYLKDQGIASFYLDKRGIDISLDVEVGRDRLEQ
FT                   IFTLRGVRVRIHKLDYKVHSGRWRFLIWLTKPFLKHMIRRVLEKQIAESIVQAAHALNR
FT                   ELVFARERLRAARIASPQDLFTFVRAVLARLAPAPNPDIDARVGIDAPGSGVFKNVYAP
FT                   GSLVKVWNDEARQAHDAVEEGEETPGLHRTWRNTIFDVPV"
FT   gene            1030734..1032980
FT                   /locus_tag="ANIA_06168"
FT                   /old_locus_tag="AN6168.4"
FT                   /product="Malic enzyme
FT                   [Source:UniProtKB/TrEMBL;Acc:Q8J260]"
FT   mRNA            join(1030734..1030972,1031043..1031149,1031199..1031311,
FT                   1031370..1031448,1031510..1031858,1031921..1032980)
FT                   /locus_tag="ANIA_06168"
FT                   /old_locus_tag="AN6168.4"
FT                   /note="transcript_id=CADANIAT00006842"
FT   CDS_pept        join(1030734..1030972,1031043..1031149,1031199..1031311,
FT                   1031370..1031448,1031510..1031858,1031921..1032980)
FT                   /locus_tag="ANIA_06168"
FT                   /old_locus_tag="AN6168.4"
FT                   /product="Malic enzyme
FT                   [Source:UniProtKB/TrEMBL;Acc:Q8J260]"
FT                   /note="transcript_id=CADANIAT00006842"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006842"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006842"
FT                   /db_xref="GOA:G5EAT6"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:G5EAT6"
FT                   /protein_id="CBF70049.1"
FT                   /translation="MRWIPSPGGSMLVSRGLLHKIRPSPSAQLPLSVFPSSSFVFGSRC
FT                   HSGAAVTQKSRMARFPSQQSRPVHATPHVNHNGPIEQNYDTANPAYIRKYLRTYGLTPP
FT                   RPESYETQKTRCLAQLALKQTPIDKFLYLSTLRKNNVHLFYRLVTDHLRELTPLIYTPV
FT                   VGEACQRWSEIYQQPEGMYLSWEDRGNLASVIANWPQPNVEITCITDGSRILGLGDLGI
FT                   NGMGIPIGKLALYTTCAGIRPEATLPLTLDLGTSNKALREDPLYLGSRRDKITPDEERE
FT                   FLDELMAALTERWPGIVIQFEDFKNPFPALERYQDVYTCFNDDIQGTGAVILGGVINAV
FT                   KRSGVPCKDQRAVFFGAGSAGVGVAKQIVAFFMREGMTEDEARSCFWLVDTKGLVTADR
FT                   GDKLAEHKVYFARTDNAGQQFKTLEEVVDHVKPSILMGLSTQGGVFTPEILRKMAEWNT
FT                   NPMIFPLSNPSSKSECDFETAVTNTDGRVLFASGSPFPTMSFTNSAGETKMYYPGQGNN
FT                   MYVFPGIGLGTILSKAVKVTDSMIYASGEALSKALTAEEIERGLLYPDLTRIRKVSVVV
FT                   ARNVIRAAQEAKVDRETTLRTMDDETLDAWIKSRMYDPHTEVQSLEREVGSILSTLGAP
FT                   QQFVNGSSDEAKL"
FT   gene            1034330..1035844
FT                   /locus_tag="ANIA_06167"
FT                   /old_locus_tag="AN6167.4"
FT                   /product="FMN binding oxidoreductase, putative
FT                   (AFU_orthologue; AFUA_2G08260)"
FT   mRNA            join(1034330..1034429,1034501..1034920,1035071..1035291,
FT                   1035379..1035702,1035800..1035844)
FT                   /locus_tag="ANIA_06167"
FT                   /old_locus_tag="AN6167.4"
FT                   /note="transcript_id=CADANIAT00006843"
FT   CDS_pept        join(1034330..1034429,1034501..1034920,1035071..1035291,
FT                   1035379..1035702,1035800..1035844)
FT                   /locus_tag="ANIA_06167"
FT                   /old_locus_tag="AN6167.4"
FT                   /product="FMN binding oxidoreductase, putative
FT                   (AFU_orthologue; AFUA_2G08260)"
FT                   /note="transcript_id=CADANIAT00006843"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006843"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006843"
FT                   /db_xref="GOA:Q5AZW3"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZW3"
FT                   /protein_id="CBF70051.1"
FT                   /translation="MAEMLGGFQNIPTPALINVYDQWAKGGWGAVLTGNVQVDVNHLGS
FT                   PFDPALSGEYIDAETNKDLFEQYRKYAEVSQAHGTPAIVQLSHPGRQSPRGAGRKGLLG
FT                   STMAPSAIPLDMGAGFVQRWLSWLVFPPPREMTQGDIETVTRQFVDAARLMADAGFSGI
FT                   ELHGAHGYLIDAYGGSAANRARFVLDIIAQTRAVVPSTFCIGIKFNSADHNSSSFEDTM
FT                   TQIGLLVDAGIDFIEISGGSYEDPKQAEKSARTVAREAFFLEFAAAVRERYPTLILMLT
FT                   GGFRSRAGADYALSQNACDLVGIGRPAAIDPHFPKLLLDESVQESEAQLHLNRIPVPFW
FT                   AKWIPLAAIGAGAESIQRIAKGMKTIVPL"
FT   gene            complement(1036792..1038594)
FT                   /locus_tag="ANIA_06166"
FT                   /old_locus_tag="AN6166.4"
FT                   /product="transcription factor TFIIE complex alpha subunit,
FT                   putative (AFU_orthologue; AFUA_2G08450)"
FT   mRNA            complement(join(1036792..1038039,1038108..1038203,
FT                   1038275..1038594))
FT                   /locus_tag="ANIA_06166"
FT                   /old_locus_tag="AN6166.4"
FT                   /note="transcript_id=CADANIAT00006844"
FT   CDS_pept        complement(join(1036920..1038039,1038108..1038203,
FT                   1038275..1038369))
FT                   /locus_tag="ANIA_06166"
FT                   /old_locus_tag="AN6166.4"
FT                   /product="transcription factor TFIIE complex alpha subunit,
FT                   putative (AFU_orthologue; AFUA_2G08450)"
FT                   /note="transcript_id=CADANIAT00006844"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006844"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006844"
FT                   /db_xref="GOA:Q5AZW4"
FT                   /db_xref="InterPro:IPR002853"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="InterPro:IPR024550"
FT                   /db_xref="InterPro:IPR039997"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZW4"
FT                   /protein_id="CBF70053.1"
FT                   /translation="MDLANTLIRTVARSFYETRHILIVDALFIHSVLHAEDLAFLLGMQ
FT                   QKDLRKLCAKLREDRLIAVNTRAEIRDGSTRPVNREYYYIPLHPVIDAIKYKVSKLTST
FT                   IKLQYTPSQERKEYICLRCGAEWTELDVLSLYSEEGFECQNCGAILERTEDVKGSEGID
FT                   RTGHEKNSKLMAQLDGMLKLLKQIDSVEIPPNDFDTAWDHKIDVVRNQHTNPTRAAVVV
FT                   PSKKQEAVRGNLKTDASALEISLTSSEEKSAAEQKEEAARKAALEKQNALPVWHTHSTV
FT                   STTAGNVSSIKTEPDVKIKPELLKEEEDQKPSLVDLDDKVAAYYAEMEREKALQAQEDA
FT                   SSAEDSDEFDEFEDVGVSASASPAVGGVNGADPTRAPSGIKRELDTDSGTSAPQTATGT
FT                   PSTPADEGPAAKKIKTELENEVKKEESDEDDEEFEDV"
FT   gene            1038933..1040840
FT                   /locus_tag="ANIA_06165"
FT                   /old_locus_tag="AN6165.4"
FT                   /product="tRNA pseudouridine synthase, putative
FT                   (AFU_orthologue; AFUA_2G08460)"
FT   mRNA            join(1038933..1039018,1039091..1039294,1039344..1040555,
FT                   1040618..1040840)
FT                   /locus_tag="ANIA_06165"
FT                   /old_locus_tag="AN6165.4"
FT                   /note="transcript_id=CADANIAT00006845"
FT   CDS_pept        join(1038933..1039018,1039091..1039294,1039344..1040555,
FT                   1040618..1040840)
FT                   /locus_tag="ANIA_06165"
FT                   /old_locus_tag="AN6165.4"
FT                   /product="tRNA pseudouridine synthase, putative
FT                   (AFU_orthologue; AFUA_2G08460)"
FT                   /note="transcript_id=CADANIAT00006845"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006845"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006845"
FT                   /db_xref="GOA:Q5AZW5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR041708"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZW5"
FT                   /protein_id="CBF70055.1"
FT                   /translation="MDNNGTRTEGPQDAGRKHKKRDMGRAEWSRQMPDKRERNERAEQA
FT                   KRRKLENGEEVVAPIYATQFSKEDIENEQRRPKKKVAVLIGYSGTGYKGMQLSTTEKTI
FT                   EGELFTAFVAAGAISKANAADPKKSSLVRCARTDKGVHAAGNIVSLKLIVEDPDIVQKI
FT                   NDHLSPQIRVWGILVANKSFSSYQMCDSRIYEYLIPSHCFLPPHPNTYLGKKLVEIAEK
FT                   EGDLEAYKARQEEVANYWEDIDERVIKPLLESFPEDIRKPVEKALHMDDDTDGVPETKQ
FT                   TSTERGAKTAPVAEASSEETSAEPEPLDEAEIAFRRQIYEAVKTVKAAYLKARREYRIP
FT                   ATRLARIQQALDKYVGTKNFYNYTIQKQYRDPSAKRHIKSFKLNPEPIIIDGTEWLSLK
FT                   VHGQSFMMHQIRKMVAMATMVVRCGCDPARINDSYGEFKMAIPKAPGLGLLLERPVFDG
FT                   YNKKAADLKKEPIDFGKYEEEISEFKQREIYDRIFREEEQTHAFSSFFNHIDHYAQEEF
FT                   LYVTSGGIAAAKPALGPGESADAKPNDTAQSKRKSQREALAEVEQESEDEQNGTEDN"
FT   gene            complement(1041571..1049776)
FT                   /locus_tag="ANIA_06164"
FT                   /old_locus_tag="AN6164.4"
FT                   /product="ubiquitin C-terminal hydrolase, putative
FT                   (AFU_orthologue; AFUA_2G08440)"
FT   mRNA            complement(join(1041571..1041767,1041818..1043875,
FT                   1044055..1044618,1044677..1044873,1044930..1045033,
FT                   1045086..1045678,1045737..1045887,1045943..1046104,
FT                   1046163..1048884,1048939..1049092,1049146..1049776))
FT                   /locus_tag="ANIA_06164"
FT                   /old_locus_tag="AN6164.4"
FT                   /note="transcript_id=CADANIAT00006846"
FT   CDS_pept        complement(join(1041571..1041767,1041818..1043875,
FT                   1044055..1044618,1044677..1044873,1044930..1045033,
FT                   1045086..1045678,1045737..1045887,1045943..1046104,
FT                   1046163..1048884,1048939..1049092,1049146..1049776))
FT                   /locus_tag="ANIA_06164"
FT                   /old_locus_tag="AN6164.4"
FT                   /product="ubiquitin C-terminal hydrolase, putative
FT                   (AFU_orthologue; AFUA_2G08440)"
FT                   /note="transcript_id=CADANIAT00006846"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006846"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006846"
FT                   /db_xref="GOA:Q5AZW6"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR021905"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZW6"
FT                   /protein_id="CBF70057.1"
FT                   /translation="MAAAPLESSSTPPDATVYPQTRSLGDSMEEIDPQSTRKRPRLDSG
FT                   SGACESLPAPDEASAPLPETAPDAPAIADQEAAVPNRPASRMTINMKSPTAANKRPTAT
FT                   EDTPIEGPGADPDAPAKITGGQPLNVVSLSSSPAQSPEIEVAELEDMDQDPNTTNWKSL
FT                   GGALRDPLVADVVQLREQVHLPDSFPVLDQDREPRENLEEICLYIEKGSEHDTIVFTMV
FT                   KQWLDDVANSLENFTYETFMDSKLFWDDVPMLADCLLRRAEQFRPDDTAEFWRCLEGFL
FT                   INYARLAFHLIHLDAQLLGQLTNENDPPELDLMSRNYLYSLGWFLSYDKNPFYVALQRQ
FT                   YGHEVSNMITRLNDQVLAAPINGVQCLSAYTSNIAALIPRWPQLSQPLIQALSIVHDLA
FT                   EPKDDHSGYGPDDQMVPHGHQQAMDTIYSLVRSVDELYQTHITKKSPWITNEASATVLR
FT                   HISNTYMALCNQSASLASQIADDLSIQVPDDAPPVSLPIIVFYGWRFGVLKKHIMDGRM
FT                   ELRVAGIDTMQGDFVNVYSQYMRRDISSGLHNPVVQFMLKMLRENRIVEYMVSIESHPQ
FT                   LISRSHNIVGFLVVTGTYTDADTDTIWKTVTESPDPRTVSEVLGMLMKTFSLHHDLSGL
FT                   LYLCSKLLELPLTHFDQRMVEFCEQLFHVLRERNPIRQDSFDSVHVDVRPLRLCVRLIR
FT                   ESAATEDLAVDQKASLQKFAGGQLSSFMDVGLSDADKMDIYERCVQDIAEKNQFSVGSI
FT                   QALNALLSSQDSQEIRKLATEFNLTYLLISEMAEVVQGNRTDFADTFSRNGFISRVQML
FT                   SRIIERMPDSITPELGDILWQNIFMSSSLPQQGRRILWDMFCAITRHVVTGNPFIDRCI
FT                   QYYLPKLSPSADYSLEVLAFAKQTINYEIRFNPPSSVADNEVISIPGMDRIWNFILTAP
FT                   PNSIEADATAFAIEVYLDHNIIHRSPSSSVEATHMALVDRCVDQLKSAASKLKLHSGDP
FT                   ADAEEMMVVEDPSDGTFADELKFSRSLFFLRQFLQALRSRPQYSPPQNSPPSIPIQPEK
FT                   GELIDIRYQAFDGGSRSKVRSLRIGDLSTASELHETLVKMTGFSKLMIIFSGQRMDLLE
FT                   KPDQVLRDLKLSSGLMIVRRDPSCRGTAGRKFQPLTSVDNEVLKHFDDLYELLNLDDHL
FT                   AREIYEFLIVFPPQEKVMDMVKSPSETDQNMFPMDRPYKFLYSVNALSESLRQEALEPT
FT                   PSESMVSHSVQSVITALTRGELLETLGTSPISIQLAASLIECLLSALTVKAPVSGDVPV
FT                   IPDSTALVTQLVRILEVGQGLRNPQMSELTIQRLVCCIFAIFLEGSLRDPSFWDATKHQ
FT                   AKFDRLLFSLLIEESHQPIRKGISDIIFLICSPSKQFKKPKFPAPQAQEAREVALSENP
FT                   TRIDILATIWDAFVRTFSRVLEFPTQSQEFFEAAYIVFTSVAEKSPHDLIFSEYLRQWS
FT                   GIMLSHRTNEFVGREPVDHIILGFSRLLKSCLDISASANITLDTFNLTEQLFDNYLFPD
FT                   LSMPSHDSIVPQIPVMHTQTRQELYTIVGLLSKYGDNYNQLITRLEDIIPQDHTYQPGW
FT                   SFERQKLIRSPEGYSGLKNLSNTCYLNSLLSQLFMNVGFREFMLGLKLTDPSASQKLLE
FT                   ETKKVFAYMQESWLRAVDPQEFVDSIRTYDNEPVDVTIQMDVDEFYNLLFDRWEAQILS
FT                   PEDRKRFRSFYGGQLVQQIKSKECDHISERLEPFSAIQCDIKGKANLEESLQAYVEGEI
FT                   MQGDNLIFHLKRFDFDMVTMMRSKINDEFHFPERIDMTPFTVDYLSDSNGDTQQDVFEL
FT                   VGVLVHSGTAESGHYYSYIRERPTANGRGTWVEFNDSDVTRFDPGRIGEQCFGGYSDSL
FT                   HSTSAGQVRFNKVWNAYMLFYQRVSSMISAKSTYHAAENNYPVRVPLPLALANHIVMEN
FT                   ELFVRAYCLLDPYHSVFVRYLVSQLNEEKLAKSEPRNKLDKSVVFIALDTLEQLLNRTK
FT                   EPTGYENLVKEIYRITNEIPKGPQRVLQWAFDRPAGIPHLLKSVHPQIRNGSVRFIVHA
FT                   LARLRENVITTEDGSFEREKWNAVYLDGLEFVIATLDGMWPTLHSVSRPWDDYFELLCS
FT                   LASFGSQEVGVILEHGFLLKCLEILWLDSEDSMRLKRQYPTYYKLLEKGRRFSHRKLMD
FT                   LLSELLAKIDFTARPVSEDERQALPNERFSLTLTEHDLIRPLGQRRELVILKKILTQYN
FT                   NPQACRNIFGLLMDAEPDAGLMEPIFQVLLEGLRFAPAERCAPFLEAALILCRRGPNMD
FT                   RIVAILNHVAKGVDTINDSGGREHLLFFTNSMNSRNERLGLDEAWFSSHVIELIPDWVP
FT                   ALLIYPDRTIRNMTMDFLRKILFIDETTADGEEGQSRYAEVAKELLSASVDKLRKLYLA
FT                   TPGISVEAGALEAIRAVIDHCLVSYFTDTEEDQKIVSQAQAVVSAIEEMAVEVPEELPS
FT                   GRSAFYFVSTLASNPRPPESDVPSPEEWDDGSMIASDSEMGMAGTP"
FT   gene            1050604..1051156
FT                   /locus_tag="ANIA_06163"
FT                   /old_locus_tag="AN6163.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1050604..1050621,1050684..1050732,1050861..1051156)
FT                   /locus_tag="ANIA_06163"
FT                   /old_locus_tag="AN6163.4"
FT                   /note="transcript_id=CADANIAT00006847"
FT   CDS_pept        join(1050604..1050621,1050684..1050732,1050861..1051156)
FT                   /locus_tag="ANIA_06163"
FT                   /old_locus_tag="AN6163.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006847"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006847"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006847"
FT                   /db_xref="GOA:Q5AZW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZW7"
FT                   /protein_id="CBF70059.1"
FT                   /translation="MSSLMKSRGWSIIYHLEANRLQDSPTLTGKRSRASMRTLVTTLPA
FT                   PITAPSPIVTPGSTVTFPANQQSSPIWISFPDSGPDVPLRKSGSRGCVPLYKLTLGPNR
FT                   VRAPMVTRRVSIMTQS"
FT   gene            1052030..1052998
FT                   /locus_tag="ANIA_06162"
FT                   /old_locus_tag="AN6162.4"
FT                   /product="Prenylcystein carboxymethyl transferase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q7SI75]"
FT   mRNA            1052030..1052998
FT                   /locus_tag="ANIA_06162"
FT                   /old_locus_tag="AN6162.4"
FT                   /note="transcript_id=CADANIAT00006848"
FT   CDS_pept        1052030..1052998
FT                   /locus_tag="ANIA_06162"
FT                   /old_locus_tag="AN6162.4"
FT                   /product="Prenylcystein carboxymethyl transferase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q7SI75]"
FT                   /note="transcript_id=CADANIAT00006848"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006848"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006848"
FT                   /db_xref="GOA:C8V246"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="InterPro:IPR025770"
FT                   /db_xref="UniProtKB/TrEMBL:C8V246"
FT                   /protein_id="CBF70061.1"
FT                   /translation="MANDTAVPSASSATPTAAAYNTWTPPNPSLSQSQLQPQSQSQSQS
FT                   QPIPITNKTTSTDALLYPSGSKSLSGISLRAFLLGTTLGLSSALTISLLNLTISDSQPH
FT                   YLWRLPFFLASLSLFHFLEYYITAAHNTRYADISAFLLSSNGWAYNVAHSSAALECLLG
FT                   YVFFPHDSYFKFTASVGGVKVQAVLGLFLMILGQTVRTLAMAQAGSNFNHTVQVERKEG
FT                   HTLVQHGVYSVLRHPSYFGFFWWGLGTQLVLGNVVCFVGYAVVLWKFFNNRIQSEFSPF
FT                   FYRRLMALMVLLGEERFLIAFFGNEYVEYKKRTIIGIPGIA"
FT   gene            complement(1053155..1055428)
FT                   /locus_tag="ANIA_06161"
FT                   /old_locus_tag="AN6161.4"
FT                   /product="microbody (peroxisome) biogenesis protein peroxin
FT                   8 (Eurofung)"
FT   mRNA            complement(join(1053155..1053730,1053783..1054231,
FT                   1054281..1055284,1055355..1055428))
FT                   /locus_tag="ANIA_06161"
FT                   /old_locus_tag="AN6161.4"
FT                   /note="transcript_id=CADANIAT00006849"
FT   CDS_pept        complement(join(1053155..1053730,1053783..1054231,
FT                   1054281..1055284,1055355..1055428))
FT                   /locus_tag="ANIA_06161"
FT                   /old_locus_tag="AN6161.4"
FT                   /product="microbody (peroxisome) biogenesis protein peroxin
FT                   8 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006849"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006849"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006849"
FT                   /db_xref="GOA:C8V247"
FT                   /db_xref="InterPro:IPR030476"
FT                   /db_xref="UniProtKB/TrEMBL:C8V247"
FT                   /protein_id="CBF70062.1"
FT                   /translation="MATERSLGALLRSLQIPPHEQDGLSLLPTATSLLAVLKNPLNITL
FT                   LASQLLAAPAIWDQPVDLHVCRRIISVFNTAAMAILQSEESEDPRIPWGGPGPRKLDRE
FT                   QWVKAVVGGADEKSPRWRHLLLIGGVLLGFEGQDRQGLSWSVRRKLESALVTAAQLALD
FT                   ELDPRDGIDGHCIIMVLNYSFQLLSDGERERLDYDRLLPVMVQTTYFSPEGFESAYFLG
FT                   SVDQDIVQTPSKRFAWPSQSATVQRITAIASSPLVSALGPLSRLIAHAVENSRDPRLVA
FT                   QSVDRIADFVRTLIVQWRQNKLSEVDKAEEQEFLDAESLRDTIPNLWKLLRNCLYSVVI
FT                   ILRAVLGRVVNDRALASDKSAPFISMQTLHILRNLYFISSRVGQNSSSQHTFVTLAAVD
FT                   ILAQYPELTENFLTSIKPSELGQIPAHPLDRCLDLYFLNTSELFTTVISPKFSEDVLIQ
FT                   AALPYLPAGGNNHLLEIFEAAHSLVLAVFAIPNNAAVAAKHLPFYIDNLFAVFPNNLSG
FT                   RQFRLAFKTVLQVTAPPSPIANRQPLLPSILLEVLYDRAYNSASKTPLPPSSQAPSAST
FT                   SDPEMAKAAQIPLSEQAFLVLALIDSLCFLRVEDLEEWLPLTANLINAVSPSEMRKVCV
FT                   GRFWDALSNGEMDVERAHYCVTWWSTKGGREMIILGSENASAQGDEVQGAYMSGAIGAV
FT                   ASESKL"
FT   gene            complement(1056432..1058544)
FT                   /locus_tag="ANIA_06160"
FT                   /old_locus_tag="AN6160.4"
FT                   /product="Polyadenylation factor subunit 2
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZX0]"
FT   mRNA            complement(join(1056432..1057736,1057863..1058063,
FT                   1058121..1058236,1058284..1058544))
FT                   /locus_tag="ANIA_06160"
FT                   /old_locus_tag="AN6160.4"
FT                   /note="transcript_id=CADANIAT00006850"
FT   CDS_pept        complement(join(1056432..1057736,1057863..1058063,
FT                   1058121..1058236,1058284..1058365))
FT                   /locus_tag="ANIA_06160"
FT                   /old_locus_tag="AN6160.4"
FT                   /product="Polyadenylation factor subunit 2
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZX0]"
FT                   /note="transcript_id=CADANIAT00006850"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006850"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006850"
FT                   /db_xref="GOA:Q5AZX0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZX0"
FT                   /protein_id="CBF70064.1"
FT                   /translation="MAYYDDGGNDSQPFGRAQGGIQGPRRPRLVTDYGSSMVQWMRNRR
FT                   PKYQGGHRMETERPSASYMVDMLPPLARIHSPVDSIPVRHLHQSIGKSKKPITVVRWTP
FT                   EGRRLLTGGHTGEFMLWNGTAFNFETVMDKGDVKYWRPNFNNVETIDDAHHDAVRDLAW
FT                   SPSDTKFLSASDDTTLKIYDFTARTCDTVLTGHNWDVKSCDWHPTKGLLVSGSKDHQVK
FT                   FWDPRTARCLTTLHSHKNTVTATKFSRVNNNLLATSSRDQTARVFDLRMMRDICILRGH
FT                   EKPISTLTWHPVHCSLISTGSEDGSLYHYLLDEPNLPAGQIPTVAPYDSPDPANTPAQV
FT                   IYPAHRIQYAHAATIWTLDWHPLGHILASGSKDNFTRFWSRARPGETSYLKDRFHIGEE
FT                   AAEAQGTWSRNFGRRQMREEEEQELQDEADSLVDQRKTPGTGLPGIQSASQPDGLGSSL
FT                   LPGIGAAQPPPPPGLSTSMAPPGNAFPPNPVFPAFPFAPPFSGAPPASGAQPMNSPNVN
FT                   LAELQKQLAAQGITLPPGFPHHFTPVSTPLAGGGLPGLQGGYQPDNNYGR"
FT   gene            1059227..1060752
FT                   /locus_tag="ANIA_06159"
FT                   /old_locus_tag="AN6159.4"
FT                   /product="diacylglycerol O-acyltransferase (DgaT), putative
FT                   (AFU_orthologue; AFUA_2G08380)"
FT   mRNA            join(1059227..1059362,1059414..1059454,1059506..1060499,
FT                   1060547..1060752)
FT                   /locus_tag="ANIA_06159"
FT                   /old_locus_tag="AN6159.4"
FT                   /note="transcript_id=CADANIAT00006851"
FT   CDS_pept        join(1059227..1059362,1059414..1059454,1059506..1060499,
FT                   1060547..1060752)
FT                   /locus_tag="ANIA_06159"
FT                   /old_locus_tag="AN6159.4"
FT                   /product="diacylglycerol O-acyltransferase (DgaT), putative
FT                   (AFU_orthologue; AFUA_2G08380)"
FT                   /note="transcript_id=CADANIAT00006851"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006851"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006851"
FT                   /db_xref="GOA:Q5AZX1"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR014371"
FT                   /db_xref="InterPro:IPR027251"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZX1"
FT                   /protein_id="CBF70066.1"
FT                   /translation="MATRKTAIYRHAVAVHSQVQHSCLSRDSTKATSFIGFRNLMVVVL
FT                   VAMNLRLVIENFLKYGVLICIRCHDYRKQDVVIGAILFALVPCQLLCSYFIELAASRHA
FT                   QRVIGRAKKQDKDRILNESKRTWFAIALLHSIISFFGLAATSYVIFYYVNHPGIGTVCE
FT                   VQVIIVSLKSYSYALTNRDLRRAMLGSPSADSDIPELYRSCPYPRNITLGNLAYFLWAP
FT                   TLVYQPVYPRTPRIRWSFVGKRLFEFVCLSVVMWLLSAQYAAPLLRNATQKIATLDIAS
FT                   ILERGLKLSTISLVIWLAGFYALFQSLLNGLAEIMRFGDREFYTDWWNSPSFGVYWRSW
FT                   NRPVYIFMKRHVYMPLVTRGWNPTLAGTVVFAVSAVLHEILVGVPTHNLIGVASIAMMF
FT                   QLPLILLTAPFERFKSPLGKAIGNSFFWVTFCVVGQPLGALLYFFAWQAKYGSVSQTHP
FT                   "
FT   gene            1061116..1061750
FT                   /locus_tag="ANIA_06158"
FT                   /old_locus_tag="AN6158.4"
FT                   /product="glutathione S-transferase, putative
FT                   (AFU_orthologue; AFUA_2G08370)"
FT   mRNA            join(1061116..1061147,1061251..1061386,1061427..1061750)
FT                   /locus_tag="ANIA_06158"
FT                   /old_locus_tag="AN6158.4"
FT                   /note="transcript_id=CADANIAT00006852"
FT   CDS_pept        join(1061116..1061147,1061251..1061386,1061427..1061750)
FT                   /locus_tag="ANIA_06158"
FT                   /old_locus_tag="AN6158.4"
FT                   /product="glutathione S-transferase, putative
FT                   (AFU_orthologue; AFUA_2G08370)"
FT                   /note="transcript_id=CADANIAT00006852"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006852"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006852"
FT                   /db_xref="GOA:Q5AZX2"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZX2"
FT                   /protein_id="CBF70068.1"
FT                   /translation="MVEISIPANYGYAIAVSLGAIPVLGFIHGVLVGSFRKAAGVPYPH
FT                   AYASIEQCKANIVFQERVLNDVCEQPKAYKFNCAQRAHGNFLENAPQTMLSILVAGVKY
FT                   PEAAAGLGAAWVVLRTLYMLGYIYSDKPNGTGRYNGSLYLLAQAGLWGLSAFGVAKDLM
FT                   "
FT   gene            1061985..1062868
FT                   /gene="pyrG"
FT                   /locus_tag="ANIA_06157"
FT                   /old_locus_tag="AN6157.4"
FT                   /product="Orotidine 5'-phosphate decarboxylase (EC
FT                   4.1.1.23)(OMP decarboxylase)(OMPdecase)(OMPDCase)(Uridine
FT                   5'-monophosphate synthase)(UMP synthase)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P10652]"
FT   mRNA            join(1061985..1062141,1062201..1062868)
FT                   /gene="pyrG"
FT                   /locus_tag="ANIA_06157"
FT                   /old_locus_tag="AN6157.4"
FT                   /note="transcript_id=CADANIAT00006853"
FT   CDS_pept        join(1061985..1062141,1062201..1062868)
FT                   /gene="pyrG"
FT                   /locus_tag="ANIA_06157"
FT                   /old_locus_tag="AN6157.4"
FT                   /product="Orotidine 5'-phosphate decarboxylase (EC
FT                   4.1.1.23)(OMP decarboxylase)(OMPdecase)(OMPDCase)(Uridine
FT                   5'-monophosphate synthase)(UMP synthase)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P10652]"
FT                   /note="transcript_id=CADANIAT00006853"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006853"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006853"
FT                   /db_xref="GOA:P10652"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10652"
FT                   /protein_id="CBF70070.1"
FT                   /translation="MSSKSHLPYAIRATNHPNPLTSKLFSIAEEKKTNVTVSADVTTSA
FT                   ELLDLADRLGPYIAVLKTHIDILTDLTPSTLSSLQSLATKHNFLIFEDRKFIDIGNTVQ
FT                   KQYHGGALRISEWAHIINCAILPGEGIVEALAQTTKSPDFKDANQRGLLILAEMTSKGS
FT                   LATGEYTARSVEYARKYKGFVMGFVSTRALSEVLPEQKEESEDFVVFTTGVNLSDKGDK
FT                   LGQQYQTPGSAVGRGADFIIAGRGIYKADDPVEAVQRYREEGWKAYEKRVGL"
FT   gene            1064266..1065901
FT                   /locus_tag="ANIA_06156"
FT                   /old_locus_tag="AN6156.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1064266..1064276,1064509..1065901)
FT                   /locus_tag="ANIA_06156"
FT                   /old_locus_tag="AN6156.4"
FT                   /note="transcript_id=CADANIAT00006854"
FT   CDS_pept        join(1064266..1064276,1064509..1065901)
FT                   /locus_tag="ANIA_06156"
FT                   /old_locus_tag="AN6156.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006854"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006854"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006854"
FT                   /db_xref="GOA:Q5AZX4"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZX4"
FT                   /protein_id="CBF70072.1"
FT                   /translation="MDSPQQYQYPDSGCNPSSATRKGIGQWQDLEAILYEWHHILDWKG
FT                   SYITGDILVEKARQIWSCLPQYRDQPPPAFSSGWLHQFKQRYNIKQRTYHGEAGSVLEE
FT                   AEEKMKAMRTFAGQYNEDDIYNMDETGLFWRMPPSWSLSSVNTPGIRKDKSRISIICCV
FT                   NASGTDRLPIWVIGKERTPRALRNINISAIGIRWQWNKNAWMDQIIMREWLLEFYQYIG
FT                   QRSILLTMDNLPAHLSGLELAPPPPNVRICWLPKNSTSRFQPLDQGIIQNLKIYYRRQW
FT                   LRYMLSHYERNLDPLQSVTILDCIRWLVRAWHHDVQSSTILACFYKSILVQDPIQLPIE
FT                   APDLRPLYMQVQQSGRISDCMDISFFLNPAEESLEISNSSNEISSDILLEQLIAEASGN
FT                   ADIYPNDLDDVSGEPARLPKPQDALDAVRLLISYMEGQDTAKTPILRSLERLERNIEGE
FT                   IITARAQAP"
FT   gene            1067149..1068006
FT                   /locus_tag="ANIA_06155"
FT                   /old_locus_tag="AN6155.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1067149..1067521,1067789..1068006)
FT                   /locus_tag="ANIA_06155"
FT                   /old_locus_tag="AN6155.4"
FT                   /note="transcript_id=CADANIAT00006855"
FT   CDS_pept        join(1067149..1067521,1067789..1068006)
FT                   /locus_tag="ANIA_06155"
FT                   /old_locus_tag="AN6155.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006855"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006855"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006855"
FT                   /db_xref="GOA:Q5AZX5"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZX5"
FT                   /protein_id="CBF70074.1"
FT                   /translation="MAALLYFLGIVASLVAAAWVLRRTTYSPESQVQLEVPTNPSPISK
FT                   KLAEALPHIVLLHRNKAFFKSINSYWAQQEREVMQACIVQPREASEVAKVIGILKREYD
FT                   EQEASLTSRSGDVLFAVRGGGGLSFFTPCFGLACSNVLAYEVVLASGKIVTATAQPYPN
FT                   LWRALKGGSNNFGVVTRFTLRCFPSTKIWGGFF"
FT   gene            complement(1069224..1071418)
FT                   /locus_tag="ANIA_06154"
FT                   /old_locus_tag="AN6154.4"
FT                   /product="C6 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G01940)"
FT   mRNA            complement(join(1069224..1069383,1069559..1069620,
FT                   1069707..1071318,1071357..1071418))
FT                   /locus_tag="ANIA_06154"
FT                   /old_locus_tag="AN6154.4"
FT                   /note="transcript_id=CADANIAT00006856"
FT   CDS_pept        complement(join(1069224..1069383,1069559..1069620,
FT                   1069707..1071318,1071357..1071418))
FT                   /locus_tag="ANIA_06154"
FT                   /old_locus_tag="AN6154.4"
FT                   /product="C6 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G01940)"
FT                   /note="transcript_id=CADANIAT00006856"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006856"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006856"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZX6"
FT                   /protein_id="CBF70076.1"
FT                   /translation="MLSGSPPELEPPPRLGLMLGLFTNRSGQQRHRAAYRTSSLYPSNL
FT                   PWSHQIEALQNQKVVQEYILRSLTASQLVPANRLTGFSTPPKLAEENTRPSFSAQPVRI
FT                   PNNRVSQFVPHPSNCHPSTAAQILKKKQDPSMRRCTSSRRYASKPTLAPRLPADNTLAP
FT                   NLATQALDLQCRVLLEYLFKALTPHTLSTYKPRVELTLIDYIQQYPNPLPAQLLWATRC
FT                   LATLHSSVDSTPQPGTSALVNSRRMYQQAIRHLLISLYCPRSARSDETLTAAMLLCVYE
FT                   MIDRTNPEAWMIHSRGITNLLRIRGPKAHRSGIGQTLLLCLRPILVAQALTRAEPCLLG
FT                   EPAWRKLGNEMMRSQKGAEHFLNTWTECSFGEIAMCPGLLARTQAILSDPGFSLEDEAI
FT                   TKRKRLLTQITSIRTALRTLNLQIELEFGKYDADEKSPCGLRRLSECIPPDSAERFVLY
FT                   LHRGIQVGAAMLDQLVTLLVSDDKRRCQQETSASAALKRYYDTQDSTGVGAKTIPRTRL
FT                   DATHLPTQTESLAIAEDNGRRETSCLAHQLDILCMSQGMIQHLLGSIQQKIIIRLFEHL
FT                   DLLNKIDIRYFAWTGLDYDGAEVRVDFLHQPTPSATLQRSYGSFRMTQELRLLLQ"
FT   gene            1072371..1073161
FT                   /locus_tag="ANIA_06153"
FT                   /old_locus_tag="AN6153.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1072371..1072674,1072724..1072842,1073117..1073161)
FT                   /locus_tag="ANIA_06153"
FT                   /old_locus_tag="AN6153.4"
FT                   /note="transcript_id=CADANIAT00006857"
FT   CDS_pept        join(1072371..1072674,1072724..1072842,1073117..1073161)
FT                   /locus_tag="ANIA_06153"
FT                   /old_locus_tag="AN6153.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006857"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006857"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006857"
FT                   /db_xref="GOA:Q5AZX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZX7"
FT                   /protein_id="CBF70078.1"
FT                   /translation="MAIVEIVLYLQVTAASRGRIIVLVLQNALDASLLVSMIYLTRLVR
FT                   TLKNANTASPGIMTTTVQTTQPVAPRPPELSAQTHPQTSVAGAVHPVPVHEVPAYNTYA
FT                   HPNLTPQQRAELEALPRSQSPGQWIFVPNGTFPQDGQVQAGSDIQSEEAEL"
FT   gene            1076215..1080203
FT                   /locus_tag="ANIA_06152"
FT                   /old_locus_tag="AN6152.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1076215..1076748,1076804..1077053,1077159..1077584,
FT                   1077679..1077971,1078059..1078167,1078218..1078500,
FT                   1078777..1078855,1079236..1079814,1079852..1080016,
FT                   1080153..1080203)
FT                   /locus_tag="ANIA_06152"
FT                   /old_locus_tag="AN6152.4"
FT                   /note="transcript_id=CADANIAT00006858"
FT   CDS_pept        join(1076215..1076748,1076804..1077053,1077159..1077584,
FT                   1077679..1077971,1078059..1078167,1078218..1078500,
FT                   1078777..1078855,1079236..1079814,1079852..1080016,
FT                   1080153..1080203)
FT                   /locus_tag="ANIA_06152"
FT                   /old_locus_tag="AN6152.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006858"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006858"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006858"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZX8"
FT                   /protein_id="CBF70080.1"
FT                   /translation="MPDLADLPAELLDEILFLAFGTTPRYNNRYDEGVLDIKGLSRLLL
FT                   VNRKHHQAFLPRVYSHWTYIGTLHSYSGLWKFLRTIIENPSLALIVEVLNIGNWGVCPS
FT                   YLDRNHELQDQDEQVQFALNDKETVKTAIRRAGLQGDIESQIYNAIFADGCEYQSRYRR
FT                   PLVALLLTCLPSISKQWPATGRLWCTVDLTTQPGGIHVLSEVPGYHDRDPNPLDGYIDD
FT                   PSLKLDNIWPVFYLDRLHIVRLYDFDPEGFSRLVQQKIQTALKSLSFPWDNDKAKAKEN
FT                   VWQTFNNEFWAAILKYKRTLEYLDVFHDFPPERRKYRLADYFGPLTEFTQLRYLSSWLR
FT                   CSLAAILRSVAPLRLKEALLASIESLVFAAEDAGRTITDLPRQVEEVVSDFPHLKTLEL
FT                   QMVGCICTLTINLQYCPLPQGARCLGRWKEAYSMRIDAGFRQETMYQRAARKAAGRQET
FT                   SSPEPPQRQYRPLKTHVLPFQDHGKSPSFMVSESEEHSLLPPLIAAEGFDDNHWRLDVY
FT                   FLSNATNEGRFAHYQAEKAVRLPPPTTPRLPGMIEIYDDDYHPDRSWRDGALHMCHICY
FT                   GPGFELGQPLDESWYGIDPDPDQSLSYLIWEHSRWDGWQGTLGVYQRATDREWITWSPG
FT                   ACKSWVFTRDYYATSIQKDPVDPRARLVKQFLNLDQLNLDWYLTYGTTDPDAQPACVPT
FT                   REEISTILRPWQSDNMHRRAWRVWQVYINAGGNNPLLLRTWYDPADDERVNSWATLSEE
FT                   FPDDADRAILDDRALFDFGAGPWQRVLEILPGIAIPLVKDTPPGYVRQKDWRADIDDYT
FT                   FYSRFTEGLNAVERSNPSWRNDLNILVKKNAAARCFLHLTFETDNFLLAYLDAKGRVTM
FT                   QGQILVDEDRLTRVSLDWFERRPPIEVFEGHAWCGLGNGFYAPDSIEQGVL"
FT   gene            complement(1080780..1081604)
FT                   /locus_tag="ANIA_06151"
FT                   /old_locus_tag="AN6151.4"
FT                   /product="carboxyphosphonoenolpyruvate phosphonomutase-like
FT                   protein (AFU_orthologue; AFUA_5G07230)"
FT   mRNA            complement(1080780..1081604)
FT                   /locus_tag="ANIA_06151"
FT                   /old_locus_tag="AN6151.4"
FT                   /note="transcript_id=CADANIAT00006859"
FT   CDS_pept        complement(1080780..1081604)
FT                   /locus_tag="ANIA_06151"
FT                   /old_locus_tag="AN6151.4"
FT                   /product="carboxyphosphonoenolpyruvate phosphonomutase-like
FT                   protein (AFU_orthologue; AFUA_5G07230)"
FT                   /note="transcript_id=CADANIAT00006859"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006859"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006859"
FT                   /db_xref="GOA:Q5AZX9"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZX9"
FT                   /protein_id="CBF70082.1"
FT                   /translation="MPIRTEHNNQAIYFRSLHDPKNPLILTNVYDAATASLIANHPSTK
FT                   AIATGSYAIATSQGIPDDALSFPQNLAAIRSIASVLKRNEVLSHQDQTDISLRFPLTVD
FT                   IQDGYNDVALTVKEIIKLGVVGCNIEDLDSNTGQLRPLLDAVHRIKVALQAAKESGVPD
FT                   FVVNARTDVLGSLDKGTIEDAIERGKAYLDAGACTVFVWGGAGGRGVSKDEVERLVKAF
FT                   EGRLNVKLVLREGFLTVRELKKLGLARISLGPELYRAAMNAFQEKADAVLRD"
FT   gene            complement(1085046..1089779)
FT                   /locus_tag="ANIA_06150"
FT                   /old_locus_tag="AN6150.4"
FT                   /product="GTP binding protein (Bud4), putative
FT                   (AFU_orthologue; AFUA_2G08470)"
FT   mRNA            complement(join(1085046..1086083,1086139..1086842,
FT                   1086898..1087300,1087433..1089637,1089690..1089779))
FT                   /locus_tag="ANIA_06150"
FT                   /old_locus_tag="AN6150.4"
FT                   /note="transcript_id=CADANIAT00006860"
FT   CDS_pept        complement(join(1085481..1086083,1086139..1086842,
FT                   1086898..1087300,1087433..1089637,1089690..1089779))
FT                   /locus_tag="ANIA_06150"
FT                   /old_locus_tag="AN6150.4"
FT                   /product="GTP binding protein (Bud4), putative
FT                   (AFU_orthologue; AFUA_2G08470)"
FT                   /note="transcript_id=CADANIAT00006860"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006860"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006860"
FT                   /db_xref="GOA:C8V2A5"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR012966"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2A5"
FT                   /protein_id="CBF70084.1"
FT                   /translation="MGNGTGHRPLSEVSPMAHRRNSPVWNQSNRSTKSIDSSPYESPSS
FT                   TRRFWQGRESGSPFQKNSENQAPYDPDVTFTTSKRPSLENLKRASRVKGNSMFRDYNHE
FT                   YDPTSVYVPQRPLAINRGSHEKQSQVVATARPPSPDKTQMGPRPPSPSKDQAPPAKSSL
FT                   SRASRFGTKDMTFDPENEIWSDADGTRYTKSVTFDAAPPQVNEYEMTTPDPSSVASGSR
FT                   DGSYDSEEDEGDISFDRGSLDRDDSFDASLEDLEKTPVVMPEDWRFMSPDTANDELAEK
FT                   NEDPFTSEGSESPEPRSVSTQQVPARRSRVESLDSNGERRPLPPLPAIQGLSFSPRASD
FT                   KLAAAFELASGNQRVLPAPPAAATYSKSDITGLSHSSMSLEDRLRLMMIQREERENANG
FT                   KQETKPENKEDESKAETAEKSKGQEPAEGPANPTEADEADVFSPPRISRDSILRDLRRG
FT                   DDYLDVSYENSSQGSASPRQYSHYDPDIPIPSLESDHDNSYEDDDDETSSVIIKPELED
FT                   DSNNLYDIPDYYGTVPSKDSSYKDLKDQEDGDNKSHHSNHSMEDVFCKSNGSVPSEATP
FT                   VPADRAEEGLNDKTPASPAEHQDNEVAAPKMTAMLESLRRPVTPENAEQISPPSTPDSV
FT                   IRHPVDDEISDLEDSVDESVPEPIATVKAHGSSLKIRPSLTRADVEQMAATRRKISGQI
FT                   PPTTQATQEPEESEQLEPDSQEKTLQPEPSAAAAPRKPSFMKLDIPFSIQEDESLGFGL
FT                   DKEFDRVIESQKRGYLMRHNTKVIVASSRPEEEPVPSSNGESSGDMRSTKAGASPQRKV
FT                   SQQTWTTVPWNSGARRASIRTPSGAIRKKPVNGPVPPLPGQPSIAQDPPTPVEEIDPTF
FT                   NALEDGEERGRLFVKVVGLKYLDLPLPKGERTYFSLTLDNGLHCVTTAWLELGKSAPIG
FT                   QEFELIVQNDLEFQLTLQMKMDEEKFRIQEPAPSASPSRQKHSAFSKMFASPRKRKELD
FT                   MKQQLASQQHKKQDPNAPIWERLRTLVASDGSFARAYTALSDHEKHAYGRPYTVDVACF
FT                   NEWAVDEQPSSVKSKKSTASGMSQRRPPYKIGKLELQLLFVPKPKGAKDEDMPKSMNAC
FT                   IREMREAETASTRSWEGFLSQQGGDCPYWRRRFFKLQGSKLTAYHETTRQPRATINLAK
FT                   AVKLIDDRSTLTQKETTARGGKRRKSAFAEEEEGYMFVEEGFRIRFGNGEVIDFYADSA
FT                   ADKEGWMKVLSETVGKGPTGANQAKPWTELVLKRERSMKATRRETADRFSQFGAAPPPP
FT                   VKKDVPKPPPAQAPTSQAAPSQRPRHKHTQSQPEVRSAESRRQKARSLIF"
FT   gene            1090693..1092722
FT                   /locus_tag="ANIA_06149"
FT                   /old_locus_tag="AN6149.4"
FT                   /product="ATP-dependent RNA helicase mrh4, mitochondrial
FT                   Precursor (EC 3.6.1.-)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZY1]"
FT   mRNA            join(1090693..1092562,1092700..1092722)
FT                   /locus_tag="ANIA_06149"
FT                   /old_locus_tag="AN6149.4"
FT                   /note="transcript_id=CADANIAT00006861"
FT   CDS_pept        join(1090693..1092562,1092700..1092722)
FT                   /locus_tag="ANIA_06149"
FT                   /old_locus_tag="AN6149.4"
FT                   /product="ATP-dependent RNA helicase mrh4, mitochondrial
FT                   Precursor (EC 3.6.1.-)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZY1]"
FT                   /note="transcript_id=CADANIAT00006861"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006861"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006861"
FT                   /db_xref="GOA:Q5AZY1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZY1"
FT                   /protein_id="CBF70085.1"
FT                   /translation="MNRLGGLSLPLRPVCLFCRAQTSLALSPLQGGQAVRSIATGRLRR
FT                   RARMTLSKDVAKSSLKPKRTDRGKLGPFPNMNQTRARVREDPRSRSPAALKRSGETEEK
FT                   PAMNTESPLYKALKMQTALAPISYGKRTAIKAKIAEITSFDAFTLLPIVRNSIFSQALP
FT                   GIADAVPTPIQRVAIPRLLEDAPAKKQAKKVDDDEPQYEQYLLAAETGSGKTLAYLIPV
FT                   IDAIKRQEIQEKEMEKKEEERKVREREENKKNQAFDLEPEIPPPSNAGRPRAIILVPTA
FT                   ELVAQVGAKLKAFAHTVKFRSGIISSNLTPRRIKSTLFNPAGIDILVSTPHLLASIAKT
FT                   DPYVLSRVSHLVLDEADSLMDRSFLPISTEVISKAAPSLQKLIFCSATIPRSLDSQLRK
FT                   LYPDIWRLTTPNLHAIPRRVQLGVVDIQKDPYRGNRNLACADVIWSIGKSGAGSDEAGS
FT                   PWSEPKTKKILVFVNEREEADEVAQFLKSKGIDAHSFNRDSGTRKQEEILAEFTEPAAV
FT                   PTAEEILLARKQQQRENINIPFVLPERTNRDTERRLDGVKVLVTTDIASRGIDTLALKT
FT                   VILYHVPHTTIDFIHRLGRLGRMGKRGRAVVLVGKKDRKDVVKEVREVWFGLDS"
FT   gene            complement(1093759..1095192)
FT                   /locus_tag="ANIA_06148"
FT                   /old_locus_tag="AN6148.4"
FT                   /product="carboxylesterase, putative (AFU_orthologue;
FT                   AFUA_2G08500)"
FT   mRNA            complement(join(1093759..1094714,1094874..1095192))
FT                   /locus_tag="ANIA_06148"
FT                   /old_locus_tag="AN6148.4"
FT                   /note="transcript_id=CADANIAT00006862"
FT   CDS_pept        complement(join(1093759..1094714,1094874..1095192))
FT                   /locus_tag="ANIA_06148"
FT                   /old_locus_tag="AN6148.4"
FT                   /product="carboxylesterase, putative (AFU_orthologue;
FT                   AFUA_2G08500)"
FT                   /note="transcript_id=CADANIAT00006862"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006862"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006862"
FT                   /db_xref="GOA:Q5AZY2"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZY2"
FT                   /protein_id="CBF70087.1"
FT                   /translation="MGIPHYFSALSALTFLLTTVIGGTNAATNSDPLIHLTYGSFQGRY
FT                   DSTYNISYFRKIPFAAPPTGENRFCAPQPPLPVRDGIYDTDQSFDMCPQRTVNGSEDCL
FT                   YLVIYPNYRVNAFGFLPGKAVKDSPTSDLNPGLLDQEYALKWIQDHIAHFGGDPRNVTI
FT                   WGQSAGGGSVVAQVAANGRRGRKRLFSKALASSPFWPKTYRYDDYEAEVIYDSLVNLTG
FT                   CAGENDSLVCLKRVDVQAIRDANQIISASHKYTTSSYTWAPVIDDEFLLHPLTEATSHS
FT                   LVETDYIFATYNTHEGENFIPPGFAYENTNATSDSFNSSSTSFRSWLSGFLPGLSPSQI
FT                   LTLEHRYYPETGQTETMDLYNSTYVRAGLVYRDVVLSCPGYWLASAARQKGYLAEYTIP
FT                   PAQHADDTAYVCLLLAPFLYSIILN"
FT   gene            complement(1095735..1097720)
FT                   /locus_tag="ANIA_06147"
FT                   /old_locus_tag="AN6147.4"
FT                   /product="Histone-lysine N-methyltransferase set9 (EC
FT                   2.1.1.43)(SET domain protein 9)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZY3]"
FT   mRNA            complement(join(1095735..1097549,1097610..1097720))
FT                   /locus_tag="ANIA_06147"
FT                   /old_locus_tag="AN6147.4"
FT                   /note="transcript_id=CADANIAT00006863"
FT   CDS_pept        complement(join(1095735..1097549,1097610..1097720))
FT                   /locus_tag="ANIA_06147"
FT                   /old_locus_tag="AN6147.4"
FT                   /product="Histone-lysine N-methyltransferase set9 (EC
FT                   2.1.1.43)(SET domain protein 9)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AZY3]"
FT                   /note="transcript_id=CADANIAT00006863"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006863"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006863"
FT                   /db_xref="GOA:Q5AZY3"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR025783"
FT                   /db_xref="InterPro:IPR039977"
FT                   /db_xref="InterPro:IPR041938"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AZY3"
FT                   /protein_id="CBF70089.1"
FT                   /translation="MPSSKARSSPSVDRRERLTLAKLASYDDVATDALVDCAYFWTKTR
FT                   KNRTKYIPVRGLAEDTVAHILLHDVIVAKDVSAAERKILDLIGMKRYLAKLPNDREKDW
FT                   FRKHLRKYIQMYLPDCPFEVTTTNRYTITEHEAAICARKFIPQGQEIKYLSGTLVPMTK
FT                   EEERDLDLKRKDFSIVMSSRRKTPSFFLGPARFANHDCSANGRLVTRGSEGMQVVATRD
FT                   IYIGEEITVSYGEDYFGIDNCECLCLSCERVPRNGWSQNLAPGPQSKPSTPEPKASEDH
FT                   LTPRKRKAQSDIDSDSSPSSTPRKRGKFTPRGSKLRSQLSLTEDIAISIESEPRVPSSN
FT                   LALSAQEAGDSGKSSSAGDNVESSGTDSESLTSITPQESQRSSASTAATSVFDEAVSLN
FT                   TRPTKSAVTTAAPAESSIAAEAPLSTTIPETDIKLEVEPSCEPTTTVTAQLDTTVRADS
FT                   CVSDISSSTKLEDGSEALEHVKKPRKPRTKRVYLTIEPESKLNRVPGDYTKTPKLLAHS
FT                   YDRWVDCHTCNAWFVQQNSYLTRRECPRCERHSMLYGFRWPKTEKEGPNDDEERVMDHR
FT                   TIHRFLYPEEEALVSRRGRGVSFGLTPTPELSDMRSETPDSEALDERGNTRVTRRRTRA
FT                   IRVTTV"
FT   gene            1098199..1098853
FT                   /locus_tag="ANIA_06146"
FT                   /old_locus_tag="AN6146.4"
FT                   /product="50S ribosomal protein L14 (AFU_orthologue;
FT                   AFUA_2G08520)"
FT   mRNA            join(1098199..1098233,1098287..1098371,1098432..1098656,
FT                   1098710..1098853)
FT                   /locus_tag="ANIA_06146"
FT                   /old_locus_tag="AN6146.4"
FT                   /note="transcript_id=CADANIAT00006864"
FT   CDS_pept        join(1098219..1098233,1098287..1098371,1098432..1098656,
FT                   1098710..1098780)
FT                   /locus_tag="ANIA_06146"
FT                   /old_locus_tag="AN6146.4"
FT                   /product="50S ribosomal protein L14 (AFU_orthologue;
FT                   AFUA_2G08520)"
FT                   /note="transcript_id=CADANIAT00006864"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006864"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006864"
FT                   /db_xref="GOA:C8V2A9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2A9"
FT                   /protein_id="CBF70091.1"
FT                   /translation="MIQLKTLLNCIDNSGAAVVECVNVLKKKRAATVGDRIVIVVQKQR
FT                   NFGPEGTSSTGIANKVRRGDIRHAVVVRVKKEMQRPDGTLVKFDDNACVLVNKSGDPIG
FT                   TRMNGVVATELRGRQWSKILSLAPMHV"
FT   gene            1099905..1100941
FT                   /locus_tag="ANIA_06145"
FT                   /old_locus_tag="AN6145.4"
FT                   /product="Peptidyl-prolyl cis/trans isomerase
FT                   [Source:UniProtKB/TrEMBL;Acc:O42735]"
FT   mRNA            join(1099905..1099961,1100033..1100433,1100487..1100603,
FT                   1100657..1100941)
FT                   /locus_tag="ANIA_06145"
FT                   /old_locus_tag="AN6145.4"
FT                   /note="transcript_id=CADANIAT00006865"
FT   CDS_pept        join(1099959..1099961,1100033..1100433,1100487..1100603,
FT                   1100657..1100666)
FT                   /locus_tag="ANIA_06145"
FT                   /old_locus_tag="AN6145.4"
FT                   /product="Peptidyl-prolyl cis/trans isomerase
FT                   [Source:UniProtKB/TrEMBL;Acc:O42735]"
FT                   /note="transcript_id=CADANIAT00006865"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006865"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006865"
FT                   /db_xref="GOA:C8V2B0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2B0"
FT                   /protein_id="CBF70093.1"
FT                   /translation="MVNTGLPAGWEVRHSNSKNLPYYFNPATRESRWEPPADTDMETLK
FT                   MYMATYHSGAATYHEAPSQEGKIRCSHLLVKHRDSRRPSSWREAEITRTKEEAREILRG
FT                   HQERIMRGEIRLGDLAMSESDCSSARKKGDLGFFGRGEMQKEFEEAAFALQPGQVSDIV
FT                   ESGSGLHLIERLQ"
FT   gene            complement(1101735..1102525)
FT                   /locus_tag="ANIA_06144"
FT                   /old_locus_tag="AN6144.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1101735..1101738,1101890..1102024,
FT                   1102107..1102525))
FT                   /locus_tag="ANIA_06144"
FT                   /old_locus_tag="AN6144.4"
FT                   /note="transcript_id=CADANIAT00006866"
FT   CDS_pept        complement(join(1101735..1101738,1101890..1102024,
FT                   1102107..1102525))
FT                   /locus_tag="ANIA_06144"
FT                   /old_locus_tag="AN6144.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006866"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006866"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006866"
FT                   /db_xref="GOA:Q5AZY6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZY6"
FT                   /protein_id="CBF70094.1"
FT                   /translation="MCLFWITKYLCSCLYDEFYYPCSWASRNPETNPDPALRRASYPQN
FT                   CHVRSVEEIIDCSVLCELCFEKLHDWVRKDCDIKKTLARNGTSPLVEQLGMLILLENEK
FT                   LEQWKIFGKDSYRYMTVGIEELEKAERGVEMGIGVRRARKGNGRDAWKRATHYTQEETE
FT                   KRELAASATGMGLDLNFWGLLE"
FT   gene            complement(1103963..1106790)
FT                   /locus_tag="ANIA_06143"
FT                   /old_locus_tag="AN6143.4"
FT                   /product="Nuclear pore complex protein An-Nup82 (Eurofung)"
FT   mRNA            complement(join(1103963..1104020,1104070..1104239,
FT                   1104293..1106392,1106448..1106790))
FT                   /locus_tag="ANIA_06143"
FT                   /old_locus_tag="AN6143.4"
FT                   /note="transcript_id=CADANIAT00006867"
FT   CDS_pept        complement(join(1103963..1104020,1104070..1104239,
FT                   1104293..1106392,1106448..1106732))
FT                   /locus_tag="ANIA_06143"
FT                   /old_locus_tag="AN6143.4"
FT                   /product="Nuclear pore complex protein An-Nup82 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006867"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006867"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006867"
FT                   /db_xref="GOA:Q5AZY7"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037700"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZY7"
FT                   /protein_id="CBF70096.1"
FT                   /translation="MPKVISYTPPWLSRPFPGAALFSSPAPKDPASSKSTKDTPYLGPS
FT                   RTLARRGNEVFTVVDNQIRWSSLTRLKDDWQQRARSKSQKPDADAGAPYRVLMVPVYDQ
FT                   IRQIIPSPNGAFLAIVADHTVFIAVLPDSAHLATADSSPIRVKTYQLGPTTHVIPESPV
FT                   VSALWHPLGVYSNLGGCLVTVTEDAVVRVWELDRNNHWSFDRPTLAVDLRKLIDGTSSD
FT                   QDFAPSGFGKNKGFSSDYVDMEVASARFGGVGSEKEDAWAAMTLWIAMKPGDLYALCPL
FT                   LPSKWRAPSAAIPSLSAAIVPKLSALEEDPLDHEDQLAACRQQWEWLAEIDNQEPLQII
FT                   PGSATEPESEILMRPSNLSAIPKLQGPFRVDIGDDADDLDLCDMLVIAAKADTDALMMG
FT                   EEDELTLDSGGDKLSATVICLSSLSGRVYICLEIVGVEGQWLPKARKNAFRVPESESSD
FT                   LLLVEVINTTKEEHRTLPTWPMFTPDAHSRYSFFVTTSHGVVFISLSSWIQRLEDELQS
FT                   EDTSGSGFRLQVLCQGNASVLESIIQVDDAGTSSSQPFHLPASLVYYDYDLGYLLLTSH
FT                   ASNPYAAILEKPTFFPTFSLESDVQPTDSPTIPPHRPPYQVPSILYSDSPLEFFVDKHV
FT                   PHRYRSSLKEPVLLSPATLDLVAAAHRILSAHTNALERAASDLFRRCERLQGELRDQLG
FT                   QIADVADRIKGVSSEIGEDGQRKEGSRSTAALNARLKAAKDRQSELVWRYEAIRNKVLK
FT                   SGGRPLSEKESSWIAEVEALSQSFDKERKEESAQHIAKRLDAVKDIASELITEAKSVAA
FT                   RIFTTTEPSTPTSPTSAQPRVPQRLQRAKIADAMKMVERESAVIESITARLARLNTLV"
FT   gene            1107028..1107787
FT                   /locus_tag="ANIA_06142"
FT                   /old_locus_tag="AN6142.4"
FT                   /product="small subunit of nuclear cap-binding protein
FT                   complex (AFU_orthologue; AFUA_2G08570)"
FT   mRNA            join(1107028..1107096,1107157..1107251,1107339..1107599,
FT                   1107655..1107787)
FT                   /locus_tag="ANIA_06142"
FT                   /old_locus_tag="AN6142.4"
FT                   /note="transcript_id=CADANIAT00006868"
FT   CDS_pept        join(1107028..1107096,1107157..1107251,1107339..1107599,
FT                   1107655..1107787)
FT                   /locus_tag="ANIA_06142"
FT                   /old_locus_tag="AN6142.4"
FT                   /product="small subunit of nuclear cap-binding protein
FT                   complex (AFU_orthologue; AFUA_2G08570)"
FT                   /note="transcript_id=CADANIAT00006868"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006868"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006868"
FT                   /db_xref="GOA:C8V2B3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR027157"
FT                   /db_xref="InterPro:IPR034148"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2B3"
FT                   /protein_id="CBF70098.1"
FT                   /translation="MSIPERRNTVERLDRPSAYYLSKNKRRKYSSDESEEQKDPMEGLR
FT                   DATTLYVGNLSTSSSPSSVSQPHNPDLLLTRFRCGEIKRLVMGLDRYNKTPCGFCFVEY
FT                   YTHQDALDCLKYIGGTKLDERIIRTDLDPGFEEGRQYGRGKSGGQVRDEYREEYDPGRG
FT                   GYGRAYADDQRRREEEEYGAGR"
FT   gene            complement(1107869..1108856)
FT                   /locus_tag="ANIA_06141"
FT                   /old_locus_tag="AN6141.4"
FT                   /product="Putative uncharacterized proteinPyridoxine ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q96X05]"
FT   mRNA            complement(join(1107869..1108541,1108609..1108856))
FT                   /locus_tag="ANIA_06141"
FT                   /old_locus_tag="AN6141.4"
FT                   /note="transcript_id=CADANIAT00006869"
FT   CDS_pept        complement(join(1107974..1108541,1108609..1108856))
FT                   /locus_tag="ANIA_06141"
FT                   /old_locus_tag="AN6141.4"
FT                   /product="Putative uncharacterized proteinPyridoxine ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q96X05]"
FT                   /note="transcript_id=CADANIAT00006869"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006869"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006869"
FT                   /db_xref="GOA:G5EB85"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB85"
FT                   /protein_id="CBF70100.1"
FT                   /translation="MIKITVGVLALQGAFLEHLELLKKAAASLGSQQSSPQWEFLEIRT
FT                   PQELKRCDALVLPGGESTAISLVAARSNLLEPLRDFVKVHRKPTWGTCAGLILLAESAN
FT                   RTKKGGQELIGGLDVRVNRNHFGRQTESFQAPLDLPFLSTSGTPQQPFPAVFIRAPVVE
FT                   KILPHHDGIQVDEAKRVETVVAPSRQAESEASRRAMSRDVEVLASLPGRAAHLAVSGTP
FT                   IRADEETGDIVAVRQGNVFGTSFHPELTGDERIHAWWLRQVEDSVKRLQ"
FT   gene            1109260..1110294
FT                   /locus_tag="ANIA_06140"
FT                   /old_locus_tag="AN6140.4"
FT                   /product="NpgA proteinPutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9UVK7]"
FT   mRNA            1109260..1110294
FT                   /locus_tag="ANIA_06140"
FT                   /old_locus_tag="AN6140.4"
FT                   /note="transcript_id=CADANIAT00006870"
FT   CDS_pept        1109260..1110294
FT                   /locus_tag="ANIA_06140"
FT                   /old_locus_tag="AN6140.4"
FT                   /product="NpgA proteinPutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9UVK7]"
FT                   /note="transcript_id=CADANIAT00006870"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006870"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006870"
FT                   /db_xref="GOA:G5EB87"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:G5EB87"
FT                   /protein_id="CBF70101.1"
FT                   /translation="MVQDTSSASTSPILTRWYIDTRPLTASTAALPLLETLQPADQISV
FT                   QKYYHLKDKHMSLASNLLKYLFVHRNCRIPWSSIVISRTPDPHRRPCYIPPSGSQEDSF
FT                   KDGYTGINVEFNVSHQASMVAIAGTAFTPNSGGDSKLKPEVGIDITCVNERQGRNGEER
FT                   SLESLRQYIDIFSEVFSTAEMANIRRLDGVSSSSLSADRLVDYGYRLFYTYWALKEAYI
FT                   KMTGEALLAPWLRELEFSNVVAPAAVAESGDSAGDFGEPYTGVRTTLYKNLVEDVRIEV
FT                   AALGGDYLFATAARGGGIGASSRPGGGPDGSGIRSQDPWRPFKKLDIERDIQPCATGVC
FT                   NCLS"
FT   gene            complement(1110809..1111733)
FT                   /locus_tag="ANIA_06139"
FT                   /old_locus_tag="AN6139.4"
FT                   /product="AtaApPutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9Y7C5]"
FT   mRNA            complement(join(1110809..1110972,1111022..1111733))
FT                   /locus_tag="ANIA_06139"
FT                   /old_locus_tag="AN6139.4"
FT                   /note="transcript_id=CADANIAT00006871"
FT   CDS_pept        complement(join(1110809..1110972,1111022..1111733))
FT                   /locus_tag="ANIA_06139"
FT                   /old_locus_tag="AN6139.4"
FT                   /product="AtaApPutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9Y7C5]"
FT                   /note="transcript_id=CADANIAT00006871"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006871"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006871"
FT                   /db_xref="GOA:G5EAW9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:G5EAW9"
FT                   /protein_id="CBF70103.1"
FT                   /translation="MSLLYYIASGASTYIAFTASLFLVGQKVPRASFVARCLASYGSLL
FT                   VCAMYGVVASIVLRVVGYGRISQWATARSFKWVMRFTTGVRFDIVEGKEYLSTRPAVII
FT                   GNHQSELDVLMLGEIFPPYCSVTAKKSLRYVPFLGWFMALSRTVFIDRANRQTAVKAFD
FT                   SAAEEMRSHRQSVFIFAEGTRSYSEKPELLPFKKGAFHLAVKAGVPIVPVVVENYSHIL
FT                   APKKFRFEAGSIKVKVLPPISTDGLTAADVDGLTTSTRESMLNTLLELSNAGPADLPSS
FT                   SKGQSTAVDL"
FT   gene            complement(1112553..1115772)
FT                   /locus_tag="ANIA_06138"
FT                   /old_locus_tag="AN6138.4"
FT                   /product="Protein bimA
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P17885]"
FT   mRNA            complement(join(1112553..1112871,1112924..1114761,
FT                   1114817..1114990,1115078..1115772))
FT                   /locus_tag="ANIA_06138"
FT                   /old_locus_tag="AN6138.4"
FT                   /note="transcript_id=CADANIAT00006872"
FT   CDS_pept        complement(join(1113344..1114761,1114817..1114990,
FT                   1115078..1115414))
FT                   /locus_tag="ANIA_06138"
FT                   /old_locus_tag="AN6138.4"
FT                   /product="Protein bimA
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P17885]"
FT                   /note="transcript_id=CADANIAT00006872"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006872"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006872"
FT                   /db_xref="GOA:P17885"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17885"
FT                   /protein_id="CBF70105.1"
FT                   /translation="MTPSTSHISSQLRQLIYYHLDNNLARNALFLAGRLHAYEPRTSEA
FT                   SYLLALCYLQNGQVKAAWETSKHFGSRGAHLGCSYVYAQACLDLGKYTDGINALERSKG
FT                   QWTSRNHWNKHSETRRQHLPDAAAVLCLQGKLWQAHKEHNKAVECYAAALKLNPFMWDA
FT                   FLNLCETGVDLRVSNIYKMSPELYSMVSSAALEDVESQVLPPDGPLQTQVNPNPSLDPF
FT                   TAGTTRSDSTSTHGSSALWEKLNGSTVSVASSGTGPHLPREGMETPGGQSSESDDPRVT
FT                   NGNGTDVFEPPLAPAKKNRTIQTIGGDHPMDPPPKMRPTGIRPRTRTKFESDEGHTERD
FT                   AGMGHRLGDRKRTVSGQVAHPSVPHSTDQGVGQRRSVRLFNQIKPSTNKISSTALGVKE
FT                   GREVKKVRTTGNKARTTTSSNVGRVVSGNNRRHAGEIHDGDSKEYRGTSSTSNGSQNAS
FT                   SKLAISERTKSVEALAWILDLFFKIASGYFCLSRYKCSDAIQIFSSLSQGQRETPWVLA
FT                   QIGRAYYEQAMYTEAEKYFVRVKAMAPSRLEDMEIYSTVLWHLKNDVELAYLAHELMDV
FT                   DRLSPEAWCAVGNSFSHQRDHDQALKCFKRATQLDPHFAYGFTLQGHEYVANEEYDKAL
FT                   DAYRSGL"
FT   gene            complement(1116971..1119892)
FT                   /locus_tag="ANIA_06137"
FT                   /old_locus_tag="AN6137.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1116971..1118839,1118890..1119606,
FT                   1119666..1119892))
FT                   /locus_tag="ANIA_06137"
FT                   /old_locus_tag="AN6137.4"
FT                   /note="transcript_id=CADANIAT00006873"
FT   CDS_pept        complement(join(1117327..1118839,1118890..1119606,
FT                   1119666..1119781))
FT                   /locus_tag="ANIA_06137"
FT                   /old_locus_tag="AN6137.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006873"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006873"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006873"
FT                   /db_xref="GOA:Q5AZZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZZ3"
FT                   /protein_id="CBF70107.1"
FT                   /translation="MGSSNGKAVESSDRVVVTPGRSKPRSTSRVRWTVGLLVRLTIWYF
FT                   LLTPFFRCPSNVAELTDSSPRICKPYLVARSYVEPHVIPHYNAHAAPYVDAARPYIRII
FT                   NEKVYTPASNIAKQGYETYGAPALDRAQAYGQQQWDANIVPHVQVAKGKATDWYEAQVA
FT                   PHVDHVVAILSPYYNKVHRAYWTAVDGYFLPFAAKYQPYIGKTYTSGQEILTTTILPHA
FT                   HNAWYLTVHFVNHSLWPRIYSLYSENVEPQLVKIGQRLASYREGNRLRGVADEVESSAV
FT                   YSTVSSSSSVKSRSPTANYVPESTPTPSLSPSELAAQIRDKISSDLVTWKERFASASEK
FT                   GVENLESRVVEIVDTYLADGAQSEGEKLVMALETVVEEQTAAIKSRINALTESLPSTDA
FT                   PAEEETAVEELLKGVRNSAVIIRDRAHTLREWHVSFEEELIRKVSVAVNSTLAVLDDVR
FT                   DLGLQEIGMRWALMDGVTYKDWEDYHSLKEEFEDWKAKFREVGLQHARIEAVKEAADGI
FT                   LSRGMDVAEAAAKELARLKEVGRWKIAAREVSDDFDTRLEPPPPLSKPAVEDEDIPVVQ
FT                   EEDQDFIEAEENPPEVNYTVAESDTETDSESSELFEGEEDDSDSVSEFTVFSEESIDGD
FT                   NGLDGEALKPEHAAAPEFNNTFGAAAAAVLLEKAAADLDNADHDEVVDAEATKISEALS
FT                   QSLGIENPDTEPTPSQAPIRRKQSMEDLLSHILADTDPAFADKILKRLNAIYETPQPSP
FT                   NTQASVEDSEEPTQPANAAEDQSAQGNL"
FT   gene            1122197..1126965
FT                   /locus_tag="ANIA_06136"
FT                   /old_locus_tag="AN6136.4"
FT                   /product="RING finger membrane protein (AFU_orthologue;
FT                   AFUA_2G08650)"
FT   mRNA            join(1122197..1125380,1125428..1126965)
FT                   /locus_tag="ANIA_06136"
FT                   /old_locus_tag="AN6136.4"
FT                   /note="transcript_id=CADANIAT00006874"
FT   CDS_pept        join(1122197..1125380,1125428..1126965)
FT                   /locus_tag="ANIA_06136"
FT                   /old_locus_tag="AN6136.4"
FT                   /product="RING finger membrane protein (AFU_orthologue;
FT                   AFUA_2G08650)"
FT                   /note="transcript_id=CADANIAT00006874"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006874"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006874"
FT                   /db_xref="GOA:Q5AZZ4"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZZ4"
FT                   /protein_id="CBF70108.1"
FT                   /translation="MDFSGRLRSEHLSSANNHDIMNVSAYDTWKGKERELEEPDTCRIC
FT                   RGEGTEQDELYYPCKCSGSIRFVHQPCLVQWLAHSQKKHCELCKTPFHFTKVYDPNMPD
FT                   SLPTLLFIKQLSIHCFRTIVTWLRWVLVAFVWLGWLPWSMRAIWRALFWLADGRWSSAD
FT                   PTHQGYDRHNVTASLHNATLVASSVVAEPSSVAGQPSLEPTSSMIGFSASEPILLNLMK
FT                   KALSTLFFPAMSSSFGSTDSINVTATPLKRRPSWLSDVKFLNSLTPSPTINNILIDTLE
FT                   GQLITLLVVVSFILIFLIREWVVQQQPLDNIAEGEREAADQLIANNRPQVEARDPEPEA
FT                   EHFENIPEEEIPQNGQGVIRQEELADDRNTTSEQPAREPLDFEAPLSIRDLLAGVAGGP
FT                   VTPPIRHNSDGNDGFILDIANSQRGPQIDQPQYGINMDLYRDIYRRSNGDLDEMSRIIR
FT                   EEGRFEELVRNVTTNNRPEQTINGYPRFIVSDSTNMNAETVDDARLAPPRVSFSPRLPH
FT                   QGDADSADSNMPNAYASTWPSSSAPLNQDQSQQASASAISDSETEDSRTEPSSSSGLVA
FT                   DNGGGGAVANSEFGEESPNPSATSQAMAEPETSLTRRVVDWFWADLDPDDPNQGHQPDA
FT                   EEDLIDDPAVEEHLEHPENDRNVEVDAILPGIDQNDVDAVEEADDLEGILELIGMQGPI
FT                   FGLLQNGVFCALLISFTVAAGIWLPYLAGKIALVLLAHPIQFVLGVPMTAVSVFADVVL
FT                   DTLIGSLGYIMYWVSMICKLVFSPLAAIVPLGEWTRPITSASLSLIDASSQRLGSVINT
FT                   FFVFHEADVPMFSVLSHLALKIHEARIASLFRLAFLLGKLILHDLPLHMGSFSKAFFLG
FT                   QNSSTLGNLLALARDQVNDASHDIYTRFFMPPSAWVSPNVIGLSANDGAIDYSLAVWDT
FT                   KDRTIAILMGYLLASTVGLGYLKVARFISGADQGQRVEGMVAEGLHQAGGVMKVILIIG
FT                   IEMIVFPLYCGALLDVALLPLFEGATVAARVEFTSEYPLTSLFVHWFIGTCYMFHFALF
FT                   VSMCRKTMRSGVLYFIRDPDDPTFHPVRDVLERNITTQLRKIAFSALVYGALVIICLGG
FT                   VVWGIYYGFDGVLPAHWSSKDPVLEFPIDLLFYNVGIPLVLKELKPSDGLHSLYRWWFR
FT                   KCARFLRLSDFFFGERHPDEEGVSSLSGNNASPDRPATDEDEKSAFTNKTEPQGKRDGK
FT                   FVRAPASDQVRIPKGSPVFLEVTEANERVDGKPDNDQGLHGRLNNQFTKVYIPPFFRTR
FT                   VAAFIFFIWVFAAATGVGTTIVPLLIGRRIMSFYVPGRPVNDVYALSVGMGFACFVAYF
FT                   LLSCRTGFRLVRGRLGPYLRSPGEATRVMANALTSGLSILYVIAAFFIFLPSLFALAIE
FT                   LYLLVPVYTYLGHENDLVVHFVQDWTLGVLYVQMAVKLALWHTRSRPAAVLRGIFRDGW
FT                   LKPNIKLATRALLFPMTLLALVAVTLPLCLGFASNLILFSFRPELQSKVYRYAYPVTLA
FT                   MGLLAWFAYLVYRQVEVWKVSIRDEFFLIGERLHNFREKRAREVGVPRRVITG"
FT   gene            1128206..1128685
FT                   /locus_tag="ANIA_06135"
FT                   /old_locus_tag="AN6135.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1128206..1128444,1128480..1128530,1128562..1128685)
FT                   /locus_tag="ANIA_06135"
FT                   /old_locus_tag="AN6135.4"
FT                   /note="transcript_id=CADANIAT00006875"
FT   CDS_pept        join(1128206..1128444,1128480..1128530,1128562..1128685)
FT                   /locus_tag="ANIA_06135"
FT                   /old_locus_tag="AN6135.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006875"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006875"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006875"
FT                   /db_xref="GOA:Q5AZZ5"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZZ5"
FT                   /protein_id="CBF70110.1"
FT                   /translation="MCFASMTKGVFALAIQSFVTADSMGVFPELKHFMGKHNPGTLEIV
FT                   NKGIVEVPPKAWRWINEMQQIGAMMKDEGGFSRELRGFKGINPVLTHGCLIIVIAEDTV
FT                   LGSEQIGHRKRGTTVEDVVAAVREGMATKEKVE"
FT   gene            1130021..1135183
FT                   /locus_tag="ANIA_06134"
FT                   /old_locus_tag="AN6134.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            1130021..1135183
FT                   /locus_tag="ANIA_06134"
FT                   /old_locus_tag="AN6134.4"
FT                   /note="transcript_id=CADANIAT00006876"
FT   CDS_pept        1130021..1135183
FT                   /locus_tag="ANIA_06134"
FT                   /old_locus_tag="AN6134.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006876"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006876"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006876"
FT                   /db_xref="GOA:Q5AZZ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZZ6"
FT                   /protein_id="CBF70112.1"
FT                   /translation="MWLPMLWYACSLIASAAHAVAQVISPDNAAAESVSASTVITSYVL
FT                   SPVLITSYVPTSERSDGWAGFSPSLTFPASTGGVSTSLSSSIVLIPSVSNSLGPSSSVA
FT                   VSLGPNLLVSTLSVMGPVVPSSLGFPGSSILVSSSSESILSESSPSIPRTSTVAISIPS
FT                   ASIVPSTSSNAVPSTEGSSSSSTNAVPSTSTGEISSANTLVIPSGSSSVTPSNSPGVIS
FT                   STSTSNAPGSGAVFSSNTSTALIPTSTPSVTLSPVDPSVTLATGISTSTTSVPDSTSSS
FT                   SVTSTTRVPQSPPTDVRTSTTLVVTVTEEPHITVANPVTITTADDAGPTVVDFPITTND
FT                   RSRDPLITAAPVSETTIAPPLPRTVLASSMSGISDDFASVLPIIDAWVEKPSPSLQTQA
FT                   VKGIDGVEDDIEHFIKVLGGELPPSCDSLRKRGLIDGALNIAKDIAGAAGDVAGKLLRQ
FT                   LGCIGKITSHLKDAIEKQDIDGVKKMMHDLIAPENIADTPVLDPTSKPPGPDNNDDDNH
FT                   NEDRNEHHSNDDFGDKDNGNNAEDDSDDTDDESDEDNGNSSTSTSQTTTTTSCTSEGTV
FT                   YHVTVLCEPTPVTFGDSTTSTTACYPTTTITTSGCSVTATTTTVTSTPTSLELCMPGTC
FT                   GSACSYGHGGWMTLSTLDCVKVPTVAVSALPTESQISHRRVPPVIPPAIHRRAFSFVKR
FT                   DDDNDFIDEDGPNDDVEPVDYDDDEPMDNNDFFDDDEPLAEQVPSDLPAIGEMQHEDLY
FT                   RVYKFLTANDKWTVVMDDTAVSGEWWPYEPYGEKPARIAIGMPGLYGCTAIFIVSNKGV
FT                   YTAHFWEWPVFWSDQQGLQETTDEHFKKYTVDALLQGGNEFPDVQITLPDLMGTDERPG
FT                   PLHPFNLPKVYVITPWSEEGSALVQYPERTHWLGSQITAFLYQIYEGEVPDGANYEVYG
FT                   YLRTSKYSIYSDDDHIGKVLLDASPYYRFDVPDLQRYHRVGRYRLWVMGVSVKDALFYA
FT                   EWNSLRPTIDQVQRRDVPLDNHRLCPIPIPSLTSSPIPTPAPTQLCEPGDCGDVCSAGG
FT                   GAWVTLSPVDCGNIPTTTVTALPTESQTYNSVIDLSIRRREYELLRREDDNVKPLPNTQ
FT                   QEHLIDIYRRLTSETAWFNFPRVSTAGMWFAFPEKASTVLGIKGLYGCTSVIIVSSKGV
FT                   YISHIWEKPTFINRDEEGRIYETDEEYFKKYSFDALTQGGEEFDNVEPISSLVGTLANP
FT                   GPLHPKNTPRVFVVTHTTEDGKRLEYEYRVSLLAELFTAFLYQSSAWGIPQGADGQTVG
FT                   YQPGPRDLAEGDNAHWGKVILEVSPIDHVLQAGNQHVAVGRYRLWVSGTRVDDTEFWTF
FT                   PHVPAQVQQRDVSYNEVCPMITSSSTASPNPSTFITTTSVRPVNPPGQPPGFTLPTYVP
FT                   PKPTNNAEGTLSANMDLVSERICFEEDDFVPAKLDQANVEDVAELCRDGQGPINDNTML
FT                   GPDDERIEYSLASGNSPHEEPWYVVDVEWVKGCEGPAQNVHHPMVGRNCHQLIVDNFSM
FT                   KNCKTKYGYGGSIVIGCLRYTSQLRGGGIKGVQVSRPEDLDSSGSSSSTESGAAEPLPS
FT                   AKSLVKETVCLLDSDPINIKNDSLVDELIEKCEGDGISKHDMSLGPSDKIEWIVGGLPK
FT                   STEIYYSIVSWEKGCEGPNQNPVTPMVGLTCKDITKKHFELGCIRPGNVGVGGTTVVGC
FT                   LRYQSYMGGYPLGELHEGAMPEA"
FT   gene            1135631..1137223
FT                   /locus_tag="ANIA_06133"
FT                   /old_locus_tag="AN6133.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            1135631..1137223
FT                   /locus_tag="ANIA_06133"
FT                   /old_locus_tag="AN6133.4"
FT                   /note="transcript_id=CADANIAT00006877"
FT   CDS_pept        1135631..1137223
FT                   /locus_tag="ANIA_06133"
FT                   /old_locus_tag="AN6133.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006877"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006877"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006877"
FT                   /db_xref="GOA:Q5AZZ7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZZ7"
FT                   /protein_id="CBF70114.1"
FT                   /translation="MSSNPEIDVLVIGSGNAGLCSAISAAESGAGRVLLIDSCPEHWAG
FT                   GNSYFTAGAFRTVHAGLTDILPLVDNVDQEKASKTDVEPYTPADFLGDITRICVGRSDP
FT                   HLSKTLVGDSNDAVKWLAEHGVRFQLSFNRQAYEIDGRFRFWGGMCLKTQNGGKGLIED
FT                   ERHAAEKLGVEILFNTAAKRLILDPSTGGIRSVIVQNTSTSISSGSTPGLELGEREIFT
FT                   KSVILAAGGFEANPRMRAQFLGPGWDFAHVRGTPYNNGVCLEMAIRDASAKQAGNWSGC
FT                   HSVAWDANAPADSGDREISNEFTKSGYPLGLMINAEGKRFVDEGVDMRNYTYAVFGKAI
FT                   LAQPGHVAFQVWDADMVPWLRAEEYREEIVERITGDTLEELADQCAKRGLRNPNQFLDT
FT                   IREYNKAVAAFRDENPNHKWDPAIKDGLSTQSSRRKLALPKSNWATPLTRGPYLAVKVT
FT                   CGVTFTFGGLAVDYETGGVISSATDSPVPGLYCAGEMLGGLFWDNYPGGSGLTSGAVFG
FT                   RRAGRAAAAHARK"
FT   gene            1138269..1142408
FT                   /locus_tag="ANIA_06132"
FT                   /old_locus_tag="AN6132.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1138269..1141783,1141852..1142408)
FT                   /locus_tag="ANIA_06132"
FT                   /old_locus_tag="AN6132.4"
FT                   /note="transcript_id=CADANIAT00006878"
FT   CDS_pept        join(1138372..1141783,1141852..1142258)
FT                   /locus_tag="ANIA_06132"
FT                   /old_locus_tag="AN6132.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006878"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006878"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006878"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AZZ8"
FT                   /protein_id="CBF70116.1"
FT                   /translation="MSVLPHHGGSYLQRRLTKMYTDTKTSCESVTTASNAADDPELVSI
FT                   HRNFKTQRDRLLAWGLDWSDASAAQPNDIDESLTQAGFSDVVESVMSSIQDILSEAERL
FT                   QNKGASDLPPKGGKAESPAADGLGGFSNKTNWTSAEIARSKTLLTELTACIDVLYDLSG
FT                   SRRDMTANAQPSGKSRTRSYPSPQVGSPGGDLGRGNLQNSKSSHGASFDSTQRHQSPQS
FT                   PKSKEAFEYSSFTNLHAITQSPVFEQPKFNKAFSKASVEPKRYLIDRSALQLTGASHDN
FT                   NPPPYEMVAASTNSRVLGRMKTSALPFRHNLKDATVSILVEYTPMVLDSSSEPPYPGDA
FT                   RLDNVHQTLDQLVQNARVSHLGLLNFLGYYIDRPNSRYAFVYQMPIDYFPFLQNPTDLL
FT                   NDLKPKPLVSLLQMGDDFPVPSLETRFRLAYDLLMAVLQLRSQNLVHGNINSHNVLIFQ
FT                   GLANSNQNQVGVTENLRRPYLTSFAQFSGNNPSPEPLSSNMYRHPDDKRLIEDDAAWAY
FT                   DLYSLGLVLMEIGLWTPISRLWKFKYNNSMFKQRVESMYLRKLGPKCGSAYIHVVQLCL
FT                   DAPNFHLSTQPFDDLNLRIPQTFHYPVLDLSAPESTFAFSMNFVYTLCKITWSCCRIDI
FT                   FSAPAAEELDDCLPLALVPGSEADAAKQAAREYKGPEQVTRFSQPVAVALTPETKLMKI
FT                   GLEEKRLRKRTFKKLTTVEIPQEHLDEWNFRMLPKLRKLLQKVLKDSSESCGVTLMMTG
FT                   DGLENAKTTICVTCASVKKVRAALKKYFPLDDKEDWDLLVLRGDIERSKVPRKKRRRPA
FT                   KTGPLSTIEAPPPPQDPNPCFQPRPLCGASMGAFMNEEHLPPVSYGGAILVDGVPYGMT
FT                   VHHMLEAPSDQEDADDIHEALEDALLRSAGNWTRDLASQNSQLMSAWNDDSSAHSLEFE
FT                   VSDDEDGDDYYDDFALSEGYSSDEGDDDFAYDDDDRASIGDTAGIEPGEEPPVFVTQPA
FT                   IDDVREDFFPSPEDRDDEHLASHTFGYVYASSGVRRWTRQGIKHEIDWALIKINQDRLD
FT                   ARNIVYDKPSYSLVASARRRPGEPMPLQQRNPILLNDIARFEELGGLNVHCCGRTSGLQ
FT                   TGQISKALTMVKLHGRHTFSTSFGVDGNFGVPGDSGAWVFEKSTGRVCGAVLAWSEALR
FT                   IAYIAPMEVLLEDIARTLHATHVTLPDGPNESVTFPMQHPSVPPNPRYLGPPPLPDQLH
FT                   VDLNRQLHLDDQSVGAVNTSRGLREPYRNLPPILTPGPGRSLERQLA"
FT   gene            complement(1146911..1148856)
FT                   /locus_tag="ANIA_10776"
FT                   /old_locus_tag="AN10776.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            complement(join(1146911..1147395,1147464..1148010,
FT                   1148049..1148110,1148172..1148548,1148624..1148687,
FT                   1148763..1148856))
FT                   /locus_tag="ANIA_10776"
FT                   /old_locus_tag="AN10776.4"
FT                   /note="transcript_id=CADANIAT00006879"
FT   CDS_pept        complement(join(1146911..1147395,1147464..1148010,
FT                   1148049..1148110,1148172..1148548,1148624..1148687,
FT                   1148763..1148856))
FT                   /locus_tag="ANIA_10776"
FT                   /old_locus_tag="AN10776.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006879"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006879"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006879"
FT                   /db_xref="GOA:C8V2C4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2C4"
FT                   /protein_id="CBF70118.1"
FT                   /translation="MNSLPLLLAAAFVGFLYVFLTKGRREKGLPSGPPTLPILGNLHQI
FT                   PVKGSYLKFTEWASQYGGLYSLKLGTGTAIVITDPRLVKEVIDRKSSKYSNRPDSFVAH
FT                   TITGGSHLLVMQYGPLWRTMRKLVHQHFMETAVEKSHIHVQNAEAVQMLRDFCVRPDQH
FT                   MLHPKRYSNSIIMSLVYGVRTPSVHTAHMTQLYEMMGCRLTMRPSSFQERWSKVMEPGN
FT                   TPPVDIYSFLHYIPQKVFGNWLSRAKGVRDEMCQLYGQYLDLVDSRRKKVGSTGSFMDT
FT                   VLDQNEKLGLTRHQLYFLGGVLMEGGSDTSSSIILAFIHAMTKWPQVLKKAQAEIDSVV
FT                   GEDRTPVWSDYGSLPYVAATVKEAMRWRPAVPLAFPHAAAEDDWVDGHFIPKGSTVIIS
FT                   GWGMHHNEARFGNPSVFDPDHYKGQTALAPELANASDYTARDHYGYGTGRRICPGIHVA
FT                   ERNLFLAISKLIWAFSIEPGVDESGKLIEPDLHPTTGYSEGFLVCANDFPCRIMPRSER
FT                   RRETIMKEYQRAQEEVFSRFENISS"
FT   gene            complement(1149421..1150769)
FT                   /locus_tag="ANIA_10787"
FT                   /old_locus_tag="AN10787.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1149421..1149583,1149668..1149912,
FT                   1150009..1150221,1150308..1150769))
FT                   /locus_tag="ANIA_10787"
FT                   /old_locus_tag="AN10787.4"
FT                   /note="transcript_id=CADANIAT00006880"
FT   CDS_pept        complement(join(1149421..1149583,1149668..1149912,
FT                   1150009..1150221,1150308..1150769))
FT                   /locus_tag="ANIA_10787"
FT                   /old_locus_tag="AN10787.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006880"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006880"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006880"
FT                   /db_xref="GOA:C8V2C5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2C5"
FT                   /protein_id="CBF70120.1"
FT                   /translation="MTPATKPIRLVRLAHVCYTHVDLAAASRFLIDFGFQELTQTVSPS
FT                   TGQRTIYYRGTTTQQPFVYCAREGPEDAFGGAAFVVESREDFDYAAETLPGPAGIVDLE
FT                   AEGVPGGGLSLTFHDPVDGFPFHLVWGQRGREEEGEKQGEDGLPVLQYNFPTEKHRPGN
FT                   SSQRFKPGMSSLASPGINYCIQTNLRSGPAPVHKLGHFGMCVTDFARAYEFYTTRFNFK
FT                   ASDLIHDEAGKDVTAFLHLDRGRELVDHHCFFIFEGPKWHVHHSSFETHDFDTQLLGHH
FT                   WLREKGYTNCWGVGRHIMGSQIFDYWFDPSRFILEHYVDGDLVDETYPTHRSLASPDNL
FT                   HVWGGSFLFFHVRTRYWSWC"
FT   gene            1151182..1153047
FT                   /locus_tag="ANIA_06130"
FT                   /old_locus_tag="AN6130.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1151182..1151341,1151415..1151495,1151604..1151734,
FT                   1151796..1152923,1152979..1153047)
FT                   /locus_tag="ANIA_06130"
FT                   /old_locus_tag="AN6130.4"
FT                   /note="transcript_id=CADANIAT00006881"
FT   CDS_pept        join(1151182..1151341,1151415..1151495,1151604..1151734,
FT                   1151796..1152923,1152979..1153047)
FT                   /locus_tag="ANIA_06130"
FT                   /old_locus_tag="AN6130.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006881"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006881"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006881"
FT                   /db_xref="GOA:Q5B000"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B000"
FT                   /protein_id="CBF70122.1"
FT                   /translation="MAPSFLTNSGASEALTNANTMSGASVDEIVETEFLIAGAGPAGAA
FT                   LACFLTSYGLKGIMVSAAPGTANTPRAHITNMAALGLDREMLKVACDGEQHMVHTRWCH
FT                   SMAGEEYARIYSWGNDPRRKGDYERASPCSPVDLPQTLLEPILVRHATWHGFTTRFDTT
FT                   LLSFVRDEKQRITATVRDNLSRREYQIRTRYLFGADGARSQIVKQLDLPLAVKPGQGLA
FT                   INVLVRADLSHLVAHRKGNLHWVMQPDRDHPSFGWMAIIRMVKPWDEWMFILFPTRDYD
FT                   PASANPSKEEYLQRVRQLIGDETPAEILNISKWYINEIVAETYSDGNNVFCLGDAVHRH
FT                   PPLNGLGSNTCIQDAFNLAWKVAYVHRGIAGAQLLSTYSAERQPVGHGIVTRANQAFRD
FT                   HQQIWAALGMLGASLEERQRALQELAEPTIAGRERRQTLQKAVAHTAHEFHGLGVEMNQ
FT                   RYEGPGIYDADEADPFALPGRAAEDPVLYYEPNTYPGCRLPHGTALSHYSPVLEVSRGN
FT                   RRRRA"
FT   misc_feature    1153780..1159431
FT                   /note="contig 1.207 1229..6880(-1)"
FT   misc_feature    1159432..1455595
FT                   /note="contig 1.104 1606..297769(-1)"
FT   gene            1160217..1162490
FT                   /locus_tag="ANIA_06129"
FT                   /old_locus_tag="AN6129.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(1160217..1160420,1160470..1161131,1161197..1161296,
FT                   1161349..1161603,1161757..1162278,1162449..1162490)
FT                   /locus_tag="ANIA_06129"
FT                   /old_locus_tag="AN6129.4"
FT                   /note="transcript_id=CADANIAT00006882"
FT   CDS_pept        join(1160217..1160420,1160470..1161131,1161197..1161296,
FT                   1161349..1161603,1161757..1162278,1162449..1162490)
FT                   /locus_tag="ANIA_06129"
FT                   /old_locus_tag="AN6129.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006882"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006882"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006882"
FT                   /db_xref="GOA:C8V2C7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2C7"
FT                   /protein_id="CBF70124.1"
FT                   /translation="MSSQNRTLTGCGTCRNRHVKCDEARPTCENCQQQGLECLGYERQL
FT                   IWSSHDADRVFAALYFPVYFVTGRKMTRMITAGLEHQSASATLARLENGSANALRLEGA
FT                   IFKGPFGVQVLPNPASANNNQDEPHSDQIEHDLLEWDPLWPAIAGDSATFDGLYDVPGS
FT                   SGNATILDPVLDVMNDRQSLLPPSLGTDLDELIYQPTSLSLAPIVPSLEVSRNKNIPPQ
FT                   AAELLRYFKVNVISLSFPLKNRRQCPWQAVHLPAAISAFAELSIHHTTSHTRMSLFYSL
FT                   LAASCLNKQHLDLALNEEVLGPKRAKYKEILTAVLSMVMLSIFKEESSSAQAFLVDAEH
FT                   LIRIRGLPKQHKSLKVRSLYHIYTFLRIMAESTCGYALQDIFPDRPSSSLLAIEPSPES
FT                   LRSFRLADVIRVANEQELLHRDGPTVDARIAVELKRRASMLEQYILSWEQSPEFKPNDP
FT                   TTITNGLDTAIDQNLTATHFMIKAMHQALILFYYRRVANISALILQDTVRNCLNFLNRY
FT                   DKARVEESRNEPCYTPNTAFLWPGFVAACEALEPDMQSGLLEWLVVTGHRTSLGPFFCS
FT                   CGDCATEIQSGNFPLKQL"
FT   gene            1164605..1166146
FT                   /locus_tag="ANIA_06128"
FT                   /old_locus_tag="AN6128.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1164605..1165263,1165351..1166146)
FT                   /locus_tag="ANIA_06128"
FT                   /old_locus_tag="AN6128.4"
FT                   /note="transcript_id=CADANIAT00006883"
FT   CDS_pept        join(1164605..1165263,1165351..1166146)
FT                   /locus_tag="ANIA_06128"
FT                   /old_locus_tag="AN6128.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006883"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006883"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006883"
FT                   /db_xref="GOA:Q5B002"
FT                   /db_xref="InterPro:IPR029675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B002"
FT                   /protein_id="CBF70126.1"
FT                   /translation="MYPSTHSPLLVESLLPVEMPLPLPLSAVAKRAPAQLTHILKLRAS
FT                   RIFLSSLLLWLLLYAYCRTRFWRDPHSAFFQEAHVYDLDYSLYREREGTHFLARHNAPT
FT                   TRPGEEFHYHYTKNNSEGGSETPAVCVAIVTVRREQDTYFDASVGSLLEGLTEHERKPL
FT                   HLSVLFADIDPAVHPSWGQKWVERLVDQVGGYNVSAEQLEDLRKWEAERNFYRKGVFDY
FT                   IYALRTCQGVNAPYTLIFEDDIILATGWFARTLKSLAEISRREAGANQGHSHAAKNQKP
FT                   WLYLRLFYTETALGWSSADFAYEHMPLIFLTLTALSFTALYFLQRSRRFQPLHLDTPSI
FT                   LVISLLCIPAFTALAYMVGKYNLMPLRGVVQMNKFGCCTQGLLFPAQQVDRLIGFLEDR
FT                   GHGQTDSLIEEYADLNGLNRYAVALPLLQHVGLKSSRDNTDVNTQSTWAFWFETNKPEA
FT                   LRREHAELLGDADVQQMLELPCPRLP"
FT   gene            complement(1166202..1167014)
FT                   /locus_tag="ANIA_06127"
FT                   /old_locus_tag="AN6127.4"
FT                   /product="vacuolar ATP synthase 16 kDa proteolipid subunit,
FT                   putative (AFU_orthologue; AFUA_3G12370)"
FT   mRNA            complement(join(1166202..1166310,1166376..1166479,
FT                   1166545..1166701,1166770..1166834,1166857..1166892,
FT                   1166949..1166961,1167008..1167014))
FT                   /locus_tag="ANIA_06127"
FT                   /old_locus_tag="AN6127.4"
FT                   /note="transcript_id=CADANIAT00006884"
FT   CDS_pept        complement(join(1166237..1166310,1166376..1166479,
FT                   1166545..1166701,1166770..1166834,1166857..1166892,
FT                   1166949..1166961,1167008..1167014))
FT                   /locus_tag="ANIA_06127"
FT                   /old_locus_tag="AN6127.4"
FT                   /product="vacuolar ATP synthase 16 kDa proteolipid subunit,
FT                   putative (AFU_orthologue; AFUA_3G12370)"
FT                   /note="transcript_id=CADANIAT00006884"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006884"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006884"
FT                   /db_xref="GOA:C8V2C9"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2C9"
FT                   /protein_id="CBF70128.1"
FT                   /translation="MPFPAMDHFLESSDAQAPFLRDCKGRCGRLLIGRLAAGLDHIVTI
FT                   VMAGILGIYGLVVSVLIANNLAQTVALYTSLLQLGAGLAVGLCGLAAGFAIGIVGDAGV
FT                   RGTAQQPRLYVGMILVLIFAEVLGLYGLIVALLMNARAGVIDFKCSS"
FT   gene            1168957..1169325
FT                   /locus_tag="ANIA_11501"
FT                   /old_locus_tag="AN11501.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1168957..1169205,1169287..1169325)
FT                   /locus_tag="ANIA_11501"
FT                   /old_locus_tag="AN11501.4"
FT                   /note="transcript_id=CADANIAT00006885"
FT   CDS_pept        join(1168957..1169205,1169287..1169325)
FT                   /locus_tag="ANIA_11501"
FT                   /old_locus_tag="AN11501.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006885"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006885"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006885"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2D0"
FT                   /protein_id="CBF70130.1"
FT                   /translation="MRLATALPAFAAFTLERTSSSISPLTLPLNASNPSNLVPRNQPQS
FT                   STLALEAPIPGYGVEDFTWEMDTTPGGPTVLLNGIPAVNCILSKYVNRYL"
FT   gene            complement(1173473..1180748)
FT                   /locus_tag="ANIA_06126"
FT                   /old_locus_tag="AN6126.4"
FT                   /product="Acetyl-CoA carboxylasePutative uncharacterized
FT                   protein (EC 6.4.1.2); [Source:UniProtKB/TrEMBL;Acc:O60033]"
FT   mRNA            complement(join(1173473..1180267,1180338..1180508,
FT                   1180587..1180748))
FT                   /locus_tag="ANIA_06126"
FT                   /old_locus_tag="AN6126.4"
FT                   /note="transcript_id=CADANIAT00006886"
FT   CDS_pept        complement(join(1173734..1180267,1180338..1180508,
FT                   1180587..1180748))
FT                   /locus_tag="ANIA_06126"
FT                   /old_locus_tag="AN6126.4"
FT                   /product="Acetyl-CoA carboxylasePutative uncharacterized
FT                   protein (EC 6.4.1.2); [Source:UniProtKB/TrEMBL;Acc:O60033]"
FT                   /note="transcript_id=CADANIAT00006886"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006886"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006886"
FT                   /db_xref="GOA:G5EAT9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013537"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:G5EAT9"
FT                   /protein_id="CBF70132.1"
FT                   /translation="MGVPDGTTNGHGGSRAAKHNLPSHFIGGNHLDAAAPSSVKDFVAN
FT                   HEGHSVITSVLIANNGIAAVKEIRSVRKWAYETFGNERAIQFTVMATPEDLAANADYIR
FT                   MADQYVEVPGGTNNNNYANVELIVDVAERMDVHAVWAGWGHASENPRLPESLAASPKKI
FT                   IFIGPPASAMRSLGDKISSTIVAQHAQVPCIPWSGTGVDEVKVDENGIVTVEEEVYNKG
FT                   CTFSPEEGLEKAKQIGFPVMIKASEGGGGKGIRKVEKEEDFINLYNAAANEIPGSPIFI
FT                   MKLAGNARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIANPTTFQAMERA
FT                   AVSLGKLVGYVSAGTVEYLYSHADDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIA
FT                   MGIPLHRIRDIRLLYGVDPNTSAEIDFDFSSEESFKTQRRPQPKGHTTACRITSEDPGE
FT                   GFKPSSGTMHELNFRSSSNVWGYFSVGTAGGIHSFSDSQFGHIFAYGENRSASRKHMVI
FT                   ALKELSIRGDFRTTIEYLIKLLETPAFEENKITTGWLDQLISNKLTAERPDTTIAVLCG
FT                   AVTKAHQASEARLEEYRNGIQKGQVPSKDVLKTVFPVDFIYEGKRYKFTATRAGLDSYH
FT                   LFINGSKCSIGVRALADGGLLVLLNGRSHNVYWKEEAAATRISVDGKTCLLEQENDPTQ
FT                   LRTPSPGKLVKFTVENGEHVRAGQPFAEVEVMKMYMPLIAQEDGIVQLIKQPGATLEAG
FT                   DILGILALDDPSRVKHAQPFTEQLPPIGPPQVVGNKPAQRFFLLHSILENILKGFDNQV
FT                   IMNSTLKELIEVLRDPELPYSEWNAQSSALHSRMPQKLDAQLQNIVDRARSRKAEFPAR
FT                   QLQKTMVRFIEENVNPADAEILKTTLLPLVQVINNYIEGLKAHEYKVFVGLLEQYYAVE
FT                   KLFSGSKARYEDGILALREEHKDDVATIVQIALSHSRIGAKNDLILAILSIYRPNQPGM
FT                   ANVGQYFKSILKKLTEIESRAAAKVTLKAREVLIQCALPSLEERLSQMELILRSSVAES
FT                   QYGETGWAHREPDLGALKEVVDSKYTVFDVLPRFFVHKDAWVTLAALEVYVRRAYRAYS
FT                   IQGIQYHHEGEPAFLSWDFTMGKLGQPEFGSMTAVTHPSTPSTPTTESNPFKRVSSISD
FT                   MSNLLNDSPNGTPRKGVILPVQYLEDAEEYLTKALEVFPRAGTRKPSDHGLIASLEGKR
FT                   RPAPRADSESTELTGVLNIAIRDIEELDDAQIVAQISKLVSSFKDEFLARRIRRVTFIC
FT                   GKDGVYPSYYTFRGPNYEEDESIRHSEPALAFQLELNRLSKFKIKPVFTENRNIHVYEA
FT                   IGKGPENDKALDKRYFVRAVVRPGRLRDDIPTAEYLTSEADRLMNDILDALEVIGNNNS
FT                   DLNHIFINFSPVFNLQPKDVEEALAGFLDRFGLRLWRLRVTGAEIRILCTDPATGMPYP
FT                   LRVIISNTVGYIIQVELYIEKKSEKGEWLLHSIGGTNKLGSNHLRPVSTPYPTKEWLQP
FT                   KRYKAHVMGTQYVYDFPELFREAFQNSWTKAIEKSPSLIERRPPLGECMEYSELVLDDT
FT                   DNLVEISRGPGTNTHGMVGWIVTARTPEYPEGRRFIIVANDITFQIGSFGPLEDKFFHK
FT                   CTELARKLGIPRVYLSANSGARIGMADELIPYFSVAWNDPAKPEAGFKYLYLTPEVKKK
FT                   FDASKQKEVITELIHDEGEERHKITTIIGAKDGLGVECLKGSGLIAGATSRAYEDIFTI
FT                   TLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKLLGREVYTSNLQLGGTQIMY
FT                   RNGVSHMTAANDFDGVEKIVDWLAFVPEKKGSLPPIRPLADPWDRDVSYHPPAKQAYDV
FT                   RWLINGKEDEEGFLPGLFDAGSFEEALGGWARTVVVGRARLGGIPMGVIAVETRSVENV
FT                   TPADPANPDSMEMITQEAGGVWYPNSSFKTAQALRDFNNGEQLPVMILANWRGFSGGQR
FT                   DMYNEVLKYGSYIVDALVKYEQPIFVYIPPFGELRGGSWVVVDPTINPDQMEMYADEEA
FT                   RGGVLEPEGIVNIKFRRDKQLETMARLDPTYGELRRALQDKNLSKEKLSDIKDKMAARE
FT                   EQLLPVYMQIALQFADLHDRAGRMQAKNTIRQALSWKNARRFFYWRVRRRISEEYIIKR
FT                   MLTACPAPVQGEGSGAVAQGVSPAPSDSPRTTHLRTLHSWTPFLENEVENDDRRVAVWY
FT                   EENKELIQEKIEALKSQAIASQISDVLFSNRESGLKGIQQALSFLPVEEKESILKYLGS
FT                   N"
FT   gene            complement(1183802..1186083)
FT                   /locus_tag="ANIA_06125"
FT                   /old_locus_tag="AN6125.4"
FT                   /product="Nuclear distribution protein nudE
FT                   [Source:UniProtKB/Swiss-Prot;Acc:O74689]"
FT   mRNA            complement(join(1183802..1185582,1185644..1186083))
FT                   /locus_tag="ANIA_06125"
FT                   /old_locus_tag="AN6125.4"
FT                   /note="transcript_id=CADANIAT00006887"
FT   CDS_pept        complement(join(1184059..1185582,1185644..1185880))
FT                   /locus_tag="ANIA_06125"
FT                   /old_locus_tag="AN6125.4"
FT                   /product="Nuclear distribution protein nudE
FT                   [Source:UniProtKB/Swiss-Prot;Acc:O74689]"
FT                   /note="transcript_id=CADANIAT00006887"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006887"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006887"
FT                   /db_xref="GOA:O74689"
FT                   /db_xref="InterPro:IPR006964"
FT                   /db_xref="InterPro:IPR033494"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74689"
FT                   /protein_id="CBF70134.1"
FT                   /translation="MPSADEPSSTRTNGTSSRSDQLAYYKKQYEQLESELADFQASSRE
FT                   LEAELEKEIEASEKRERQLKEKVDNLRYEVEEWKSKYKQSKSEASTAQNALQKEITSLR
FT                   DANLTLQLKLRDTEVANDDYERQARHTTSSLEDMESKYNQALEREVLLDMEYKQGEQER
FT                   ESLRIENQRLRDELNDLKIETEIVQERLRNNNRRRRPAPLGRSPSTPHTPEIFDRSPGE
FT                   STVSSPLFSTPPTKLSLTLASATATPPSPPMSETSSSMRKSLTAASGFPLQKASASESF
FT                   GTRSLYGNRPQRFQAHSRATSYAFSNGRSTPSATTTRPSLPKANNTTANRPSGIPKSGS
FT                   LHQIRGLIGKMQKLEERVQSAKSKLPPPSETASRASSRAGSMLDASPGAATIAMRRDTR
FT                   KRLSGSSFSSSVRDGDGAPSYVTSSRPSYGTRTQGDSRPSSRTSFSSSLSHSTHPSVTP
FT                   SNRPESRQSRTKTPLGHYSTNPTTESRRPRSSLSNPAGQSTPINGMTYIDEDEDLAEQF
FT                   NMRATISSTRPTRLPSFSNPAFSTPTGLKKRSTSGMSGIPAPRTLRRGNTMGPPKTKPK
FT                   PVAGDLGETF"
FT   gene            1187412..1188749
FT                   /locus_tag="ANIA_06124"
FT                   /old_locus_tag="AN6124.4"
FT                   /product="isochorismatase family hydrolase, putative
FT                   (AFU_orthologue; AFUA_2G08700)"
FT   mRNA            join(1187412..1187518,1187588..1188012,1188065..1188196,
FT                   1188244..1188749)
FT                   /locus_tag="ANIA_06124"
FT                   /old_locus_tag="AN6124.4"
FT                   /note="transcript_id=CADANIAT00006888"
FT   CDS_pept        join(1187412..1187518,1187588..1188012,1188065..1188196,
FT                   1188244..1188749)
FT                   /locus_tag="ANIA_06124"
FT                   /old_locus_tag="AN6124.4"
FT                   /product="isochorismatase family hydrolase, putative
FT                   (AFU_orthologue; AFUA_2G08700)"
FT                   /note="transcript_id=CADANIAT00006888"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006888"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006888"
FT                   /db_xref="GOA:C8V2D3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2D3"
FT                   /protein_id="CBF70136.1"
FT                   /translation="MADPTDLNLDAPSDLQDIPDMSMQLVPPPEGTYPDKTSLLASVQA
FT                   HAKAHGYNVVVKSSSTPTEKKPGRTAKVWLRCDRGGHYRPRNGLTEETRKRRRTSRLMD
FT                   CPFMLVAAGTPGIWTLTVLNGTHNHGPIVEKPRQVPHHKVRKGQIAAVPYDWPHDATLT
FT                   PYTTALVIIDMQKDFCAPGGYMEFQGYDISPARELIPKLQQLLNTFRSAGFPVYHTREG
FT                   HRPDLSTLSSRETYRSQNNSSGLGIGSPGPLGRLLIRGELGHDTVDELYPLPGEPVIDK
FT                   PGRGAFAYTDFELLLRNKGIKNLVLAGVTTDVCVSTTMREANDRGFDCVILEDGTAASE
FT                   PALHVSTIESVKMEGGIFGAVAKLEDVMHAVENFKAVTVKKLAPQMTSN"
FT   gene            complement(1188911..1189649)
FT                   /locus_tag="ANIA_11500"
FT                   /old_locus_tag="AN11500.4"
FT                   /product="trafficking protein particle complex subunit
FT                   2/Sedlin, putative (Eurofung)"
FT   mRNA            complement(join(1188911..1189337,1189420..1189649))
FT                   /locus_tag="ANIA_11500"
FT                   /old_locus_tag="AN11500.4"
FT                   /note="transcript_id=CADANIAT00006889"
FT   CDS_pept        complement(join(1188911..1189337,1189420..1189616))
FT                   /locus_tag="ANIA_11500"
FT                   /old_locus_tag="AN11500.4"
FT                   /product="trafficking protein particle complex subunit
FT                   2/Sedlin, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006889"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006889"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006889"
FT                   /db_xref="GOA:C8V2D4"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2D4"
FT                   /protein_id="CBF70138.1"
FT                   /translation="MSYYFTILSPTDVPLFNIAFGTSKSGGDGIARFRFPDAAQNTYMT
FT                   QFIIHSSLDMLEEAQWMGGNMYLKHIDTYPPASAYVSAFLTPSGTRFLLLHQPPQPNLP
FT                   PSGAGGGSGGLGSSTMSLGSSAMGMGGSGLFGGSGVGSSGRTSSSSIAANPTAPQTEEA
FT                   VRQFMTEVYEAYVKTVMSPFYRRGMEIRSPVFRSKVSAAGRKWL"
FT   gene            1189859..1191407
FT                   /locus_tag="ANIA_06123"
FT                   /old_locus_tag="AN6123.4"
FT                   /product="hypothetical protein"
FT   mRNA            1189859..1191407
FT                   /locus_tag="ANIA_06123"
FT                   /old_locus_tag="AN6123.4"
FT                   /note="transcript_id=CADANIAT00006890"
FT   CDS_pept        1189859..1191205
FT                   /locus_tag="ANIA_06123"
FT                   /old_locus_tag="AN6123.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006890"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006890"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006890"
FT                   /db_xref="GOA:Q5B007"
FT                   /db_xref="InterPro:IPR018612"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B007"
FT                   /protein_id="CBF70139.1"
FT                   /translation="MPPKTLLSLSKKNPLAGGGQKRKKAVFDSDSDTDERGGATNETEI
FT                   TTIGGIELDSESVTQKKPLQTENESEERPAKRKVVPLGQGAKPKIKPLSKTSIFADEDD
FT                   EKEDGKTETTYGLNNAPAKRDQKQEREREYTNLSALHSMKKHASEAQDLDPSIYSYDAV
FT                   YDSLHAKPEKKNKANADEESVPKYMTSLLRSAEIRKRDQLRARDRMLAKEREAEGDEFD
FT                   DKEKFVTSAYKAQQEELRRVEEEEKKREQEEEERRKKNGGTGMVGFYRDLLARGEEQHD
FT                   AAMKATEEAARKIQENGGEVPTDTTQEDEKTEAQIAAELNARGAHIAVNDDGQVVDKRQ
FT                   LLSAGLNVAPKPKNAAPAAARTTAGAGTGPTSRDHSRQAAGRAGQRARQTEMIAQQLEE
FT                   QERQRQEAEAARQKEIAERSRSHKSATEVLSARERYLARKREREAAKGS"
FT   gene            complement(1191495..1192975)
FT                   /pseudo
FT                   /locus_tag="ANIA_06122"
FT                   /old_locus_tag="AN6122.4"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1191495..1192691,1192744..1192874,
FT                   1192921..1192975))
FT                   /pseudo
FT                   /locus_tag="ANIA_06122"
FT                   /old_locus_tag="AN6122.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00010573"
FT                   /db_xref="PSEUDO:CBF70141.1"
FT   gene            complement(1193788..1197110)
FT                   /locus_tag="ANIA_06121"
FT                   /old_locus_tag="AN6121.4"
FT                   /product="SET domain protein (AFU_orthologue;
FT                   AFUA_2G08775)"
FT   mRNA            complement(join(1193788..1196741,1196921..1197110))
FT                   /locus_tag="ANIA_06121"
FT                   /old_locus_tag="AN6121.4"
FT                   /note="transcript_id=CADANIAT00006891"
FT   CDS_pept        complement(join(1193788..1196741,1196921..1197110))
FT                   /locus_tag="ANIA_06121"
FT                   /old_locus_tag="AN6121.4"
FT                   /product="SET domain protein (AFU_orthologue;
FT                   AFUA_2G08775)"
FT                   /note="transcript_id=CADANIAT00006891"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006891"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006891"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B009"
FT                   /protein_id="CBF70143.1"
FT                   /translation="MTLVNNLIELLYISASMGVNSWSDLLAIELIHLSVLSKNDLLSEL
FT                   VELFLLLTMQKLLGFLESLGATASCFEGNACPNPEQSEPESDPAEPADTNTKADIDRDP
FT                   KAEATQADLEAVVNGTSTSDAGSRFESASVFVLLPEPKHTPASNLEHHPVSGSDFESVS
FT                   SSTSELVAESKPQGLDERESQTNLEPESQIEDPLVVKEKQDAQCQIESENALMLAKGLR
FT                   VESQDQHEEYISSEHQINSQQGLLVESQNQDRQNLVNSEPGSNTDIKSDDRYGHQIHSG
FT                   DQKESPLLVNYEDQVHKEHISAGSELAPVSGSESEPEAGFDSDSVSSPAPTPELVEEDK
FT                   TSVTKHQGPHLGAATGPLILQAKPGALILRQNSDLLGLRITAPRARSPSPLRSFSRSAI
FT                   ECLGIPMPSEMPRPSTSNVPDSLADIPPEYLQLPFVDEHVNSSAPKGNKNWHSVDLPHE
FT                   QLTAANLTRAQDLSNCDLREPVVSDCFEKRWINDKSGFGLVATKHIPAGTVIIADELMI
FT                   LWSGEHKKCKSYGDTNAMLQAKAARMGPEWNNEFLSLAKGQKKKGFAIRKRRLGLEGAI
FT                   WDQHALPTAWEGNVGEVLGLNLAWLNHCCIPNCVLRFRNEYPTNKKGEICYDKKPRLGK
FT                   AVVRACADIKPNVEISIAYMQTEGTARERRAAMNRRFGFLCACRFCATPHPSADKAMCH
FT                   YRRLKRRIEDPNIVSNKPAIAYLHASMLLDHLAAMRVQDFRVADIWVKCAMIAGHHTDL
FT                   ARAWCFLREARELYLVLEGLNGAIYHQVEGWYRDPTSMPGFGGTRRGLSSRMKAFTDFN
FT                   QGIMPKKMLFMLDAKPNEYIAVPRYRPLPRTDNDKGPSYEIIDGPDFAPAELKFDSKNP
FT                   SDMCRTHDNCQTLVDHLDRVREKRRNRGPAREMTDDHDSEPYCDGFKQDFLAAFMAVAR
FT                   ERFGKAAVDAELEKDHDNPEESFNQDVQVFTSCGETCPKPGCTHQQYEVELQNPSCACD
FT                   KEPGEEGQPDNKENEESHIQEPTVGARNPVVKHVGAEKKPQFVNLDDFAYCDAGVEYN"
FT   gene            complement(1197943..1202144)
FT                   /locus_tag="ANIA_06120"
FT                   /old_locus_tag="AN6120.4"
FT                   /product="guanyl-nucleotide exchange factor, putative
FT                   (AFU_orthologue; AFUA_2G08780)"
FT   mRNA            complement(join(1197943..1200380,1200436..1201677,
FT                   1201745..1202144))
FT                   /locus_tag="ANIA_06120"
FT                   /old_locus_tag="AN6120.4"
FT                   /note="transcript_id=CADANIAT00006892"
FT   CDS_pept        complement(join(1197943..1200380,1200436..1201677,
FT                   1201745..1202144))
FT                   /locus_tag="ANIA_06120"
FT                   /old_locus_tag="AN6120.4"
FT                   /product="guanyl-nucleotide exchange factor, putative
FT                   (AFU_orthologue; AFUA_2G08780)"
FT                   /note="transcript_id=CADANIAT00006892"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006892"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006892"
FT                   /db_xref="GOA:Q5B010"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR023394"
FT                   /db_xref="InterPro:IPR035999"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B010"
FT                   /protein_id="CBF70145.1"
FT                   /translation="MHWKGLRLGALYDSESKRNPADPQSRHSEQLARSTLSATNLPPRI
FT                   SESSACSPNLTGLDADGQAESEGSNRAPAPGNSSLKSRVPNALNSSREALNRSGSRFSL
FT                   MRLRHASDPQLSKSYAKAGTEVPPVPNIPPPTIITTAPTSHELDQPVKRKNKFSIFPEP
FT                   RKSMEAHAEQQTVRNEKAKRSQDSTGSQSADTSLTASRVSAEEPGRLSTTSIRSTGRDR
FT                   PNGSYRSSVVDGRFSESSRSDQSAATNNEISRTNSPLGGPASGTKRFRMPRLKRNRVQF
FT                   PLPPKPTADNGQTPGLTQSRSVPDGPTRGSDASDGQDHVSPLPSPSRSSAGLSASRPPI
FT                   IRKDSSNSAHSVHSTPSIRGGRNQGLPKNRARSSTLDSVTNIQDTDPHPSPNQPSSSRT
FT                   SFSTTGRKSFGDIFSISQRLRQNSEPGYFRTNSSPSGTKGTSSPLTKVLSYPKREEGDT
FT                   PATYLARLEENIPKSAVAGVLSQSGEDFYKTALRKFMRGFSFFGDPIDMAIRKLLMEVE
FT                   LPKETQQIDRFLQSFADRYHECNPGIFASTDQAYFIAFSILILHTDVFNKNNKRKMQKG
FT                   DYVKNTRGEGVAEDILECFYENISYTPFIRIEDSNLGTRHLPKPKKALFRVPSAENLSR
FT                   ATREPVDPYALIMDGKLDTLRPSLRDVMNLEDPYCCNPTTGPADIKSLHRAFAQSAILQ
FT                   IVSARSRPDAFMPASMENPADSNPGLVDIKVAKVGLLWRKDPKKKRARSPWQEWGALLT
FT                   LSHLYFFKDVNWVKSLMAQCDAHQKEGRRRAVVFKPPLNDFNPVSMMSTDNAVALLDSS
FT                   YKKHKHAFLFVRPNSLEEVFLANSEADMNDWLAKLNYAAAFRTTGVGTKGMVVTKYDAQ
FT                   RNRMSRRLSFQSEMSRFSSDKEPASPSSGMGAAEELMAARTRLIQQKVREANETLFISQ
FT                   KQLDDILRNARHLQVLTPVHTRAREQLIMAAGRMSAKLKWVRQDIWRTKSHREVLVRDL
FT                   GEENDQAVTAPEPQRLRLEIPASNSLSGNGGDSVWDKQLSPMFAKSPSIAPEKPSSVNQ
FT                   ISSPSSSTGGVRRPSLATSVTSPDILLRTGRPPSVDNYERAKSVSPNPSHVLEREASVL
FT                   SSGSKMDVSSLASKTSKLTLPGSFDDGEERLLREAGLLDASSASRKGSVTADGMDFDLK
FT                   KDDAPEGSQDRMSRVRHSFHRTLRDSSSGHHYPRSRKRESAPSVTAAEDSQGSGDAGGL
FT                   SRKGGSFTVHGKKASIVTFGSDWQNMPPEERLKLRKPTPSEEPRASDTDLVSGGESTRS
FT                   GLRASLDIPVRLSEEKAEDKLDRRSVRSESAVSTVSQEPSSPSTNVHNSLRSVPLPDSS
FT                   TVDENPTPTLPQAIHA"
FT   gene            1203782..1205711
FT                   /locus_tag="ANIA_06119"
FT                   /old_locus_tag="AN6119.4"
FT                   /product="zinc carboxypeptidase, putative (AFU_orthologue;
FT                   AFUA_2G08790)"
FT   mRNA            join(1203782..1204180,1204228..1205711)
FT                   /locus_tag="ANIA_06119"
FT                   /old_locus_tag="AN6119.4"
FT                   /note="transcript_id=CADANIAT00006893"
FT   CDS_pept        join(1203782..1204180,1204228..1205589)
FT                   /locus_tag="ANIA_06119"
FT                   /old_locus_tag="AN6119.4"
FT                   /product="zinc carboxypeptidase, putative (AFU_orthologue;
FT                   AFUA_2G08790)"
FT                   /note="transcript_id=CADANIAT00006893"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006893"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006893"
FT                   /db_xref="GOA:Q5B011"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B011"
FT                   /protein_id="CBF70147.1"
FT                   /translation="MRSFRSLHLLLLAASAITADAVPAGSSITPPPPVEPVSLLSSHSN
FT                   PQRPWTRLRNWVIESIWGIPKSQTSRPTAHDYSAPLQGSTRYGSDVVLRFRVQGLDEAE
FT                   ALTEATNILFLDVWASTTEFVDIRLAKEVIPSLLGLLPDSLQTAYVPLIDNLPEAISAT
FT                   YPARRSLGLNDQFMPSPSTRAPDLFFEDYQPLSVITPWMQLMASMFSSHARMINVGVSY
FT                   EGRQIPALRLGRSSQPGESRPMILIVGGNHAREWISTSTVAYIAYNLMTRYGSSAAVTS
FT                   LLQDYDWVLVPTVNPDGYVYTWDSDRLWRKNRQPTSFRFCPGIDLDRSWSFEWDGNQTQ
FT                   TNPCSENYAGEEPFEGVEAQQLAEWALNETEHNNARFVGFLDFHSYAQQILYPYTYSCS
FT                   SVPPTLESLEELGLGLAKVIRLTTHEIYDVTSACEGVVIPASGDKSAKSLFPVGGSSGG
FT                   SGLDWFYHQLRTRYAYQIKLRDRGSYGFLLPSEYIVPTGTEAFNAVLKLGQFLTEQDYP
FT                   GIRNIDWESEYQVGDETPTQESTAFTDESHEEEGKDVTVDTDDEDDDYYDRWEPLKWED
FT                   QRPLGFRRRR"
FT   gene            complement(1206231..1208202)
FT                   /locus_tag="ANIA_06118"
FT                   /old_locus_tag="AN6118.4"
FT                   /product="Amino acid transporter Fragment
FT                   [Source:UniProtKB/TrEMBL;Acc:B2M1L6]"
FT   mRNA            complement(join(1206231..1207563,1207619..1207786,
FT                   1207950..1208007,1208058..1208202))
FT                   /locus_tag="ANIA_06118"
FT                   /old_locus_tag="AN6118.4"
FT                   /note="transcript_id=CADANIAT00006894"
FT   CDS_pept        complement(join(1206231..1207563,1207619..1207786,
FT                   1207950..1208007,1208058..1208202))
FT                   /locus_tag="ANIA_06118"
FT                   /old_locus_tag="AN6118.4"
FT                   /product="Amino acid transporter Fragment
FT                   [Source:UniProtKB/TrEMBL;Acc:B2M1L6]"
FT                   /note="transcript_id=CADANIAT00006894"
FT                   /db_xref="GOA:C8V2E0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2E0"
FT                   /protein_id="CBF70149.1"
FT                   /translation="MGVEKDDGITAAPQNPVYDASVAEKGVLEVPQENELHRALKARHI
FT                   TMIAIGGAIGTGLIIGTGSALEKAGPGAILISYAFMGFIVYLVMCGLGEMATWLPRSSG
FT                   FTGYAVRFCDPALGFALGYTYWFKYIIVTPNQLTAAALVIQYWLPADKVNPGVWITVFL
FT                   VLIVFINYFGVGFFGEFEFWLSSFKVVVIVGLILLSFILMLGGGPDHDRKGFRYWKDPG
FT                   AFNSYIDMGPDGNGSAAGRFYAFWATLVSATFAYLGTELVGVTVGEAQNPRKTIPRAIK
FT                   LTFYRIIFFYVISVLLVGTLVPYDSSELKQANSASTSSAASPFVLAIQLSGIPALPHIL
FT                   NACILAFVFSAANSDLYIATRTIYGLAKEGKAPKILTKTDRRGVPFVALGLCTLIALIA
FT                   YMNVSSSSKTVFKYFVDLVSQFGLLSWISLLVTHICFVKARKAQEIPKNELAYTAPLGV
FT                   WGSYFALFWCIVVSLTKSFDVFTGDTFNYKTFITSYLGIPLYLILIFGYKFTTRCKRVL
FT                   PHEADLYTDKDAIDREEAAYLARQEAKRAAQGANHKQANWFYKTFVSWLF"
FT   gene            complement(1209936..1210570)
FT                   /locus_tag="ANIA_06117"
FT                   /old_locus_tag="AN6117.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1209936..1210384,1210521..1210570))
FT                   /locus_tag="ANIA_06117"
FT                   /old_locus_tag="AN6117.4"
FT                   /note="transcript_id=CADANIAT00006895"
FT   CDS_pept        complement(join(1210120..1210384,1210521..1210570))
FT                   /locus_tag="ANIA_06117"
FT                   /old_locus_tag="AN6117.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006895"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006895"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006895"
FT                   /db_xref="GOA:Q5B013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B013"
FT                   /protein_id="CBF70151.1"
FT                   /translation="MGHGGSEEEKCALADHSTVEDALRQVSVLRDKYAPWPNPADTTYH
FT                   DHTTNLASYQLVQTAVDGQLFMAPLESVADFSRRARLSAWPCEKNCLISKRYNVQQANA
FT                   "
FT   gene            1213910..1214905
FT                   /locus_tag="ANIA_06116"
FT                   /old_locus_tag="AN6116.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            1213910..1214905
FT                   /locus_tag="ANIA_06116"
FT                   /old_locus_tag="AN6116.4"
FT                   /note="transcript_id=CADANIAT00006896"
FT   CDS_pept        1213910..1214905
FT                   /locus_tag="ANIA_06116"
FT                   /old_locus_tag="AN6116.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006896"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006896"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006896"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B014"
FT                   /protein_id="CBF70153.1"
FT                   /translation="MVAIRLPRPTGIYVPSSPRSVTSDMISSPLSADFTFDSETLTPSI
FT                   IPALEYISHKLQQKLMHVTLLVGRGKPYPTGQPSDLIVIPSTTLEPSVSRTLTRTIAKA
FT                   AARFALGQSWSDALARSHHERHANEYLIERSILQNEVVFSREGLTLLNVDRIYTFKRRL
FT                   CILSASGSSSGSKATAPPESYINSCVRLLHRTIEDFNGRPFSKAFFHRVYEQLDVSDEL
FT                   IAHVADLYKKQYKQDGIVIPPAPKAAIVVVEKKKSPVRTVRIRKPAATQKSGLSPAGTL
FT                   TKRGPKTPLSASDVTPITRNEWNLLFGPGFKKTQPTVTKWTPSPTVLAAA"
FT   gene            1215684..1217375
FT                   /locus_tag="ANIA_06115"
FT                   /old_locus_tag="AN6115.4"
FT                   /product="nickel transport protein, putative
FT                   (AFU_orthologue; AFUA_2G08830)"
FT   mRNA            join(1215684..1215890,1215999..1216079,1216132..1216496,
FT                   1216548..1216693,1216750..1216802,1216881..1217375)
FT                   /locus_tag="ANIA_06115"
FT                   /old_locus_tag="AN6115.4"
FT                   /note="transcript_id=CADANIAT00006897"
FT   CDS_pept        join(1215684..1215890,1215999..1216079,1216132..1216496,
FT                   1216548..1216693,1216750..1216802,1216881..1217366)
FT                   /locus_tag="ANIA_06115"
FT                   /old_locus_tag="AN6115.4"
FT                   /product="nickel transport protein, putative
FT                   (AFU_orthologue; AFUA_2G08830)"
FT                   /note="transcript_id=CADANIAT00006897"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006897"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006897"
FT                   /db_xref="GOA:C8V2I9"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2I9"
FT                   /protein_id="CBF70155.1"
FT                   /translation="MSTRPPADSPFIESDLDDKKWTAKSLIRHAERSHSRLPGIRKVPL
FT                   RSIAVILLVAFVNVVVWVAVAIVLRLRSLVSNAVLSYTLGLRHAFDADHISAIDLMTRR
FT                   LLATGQRPVTVGTFFSLGHSTIVIITSIVVAATAAAVSSRFDKFSTIGGIIGTSVSAAF
FT                   LILLGFMNAYILYKLYKQMQKVLNLPEGQEDEAWKIEGGGVLFRVLKRAFKLIDRPWKM
FT                   YPLGILFGLGFDTSSEIALLGISSIEAAKGTSFWVILIFPILFTAGMCLLDTTDGALML
FT                   ALYLTPDAASTLDDPITTPQNHRDPVAFLYYSIVLTTLTVIVAIIIGIIQLLTLILNVA
FT                   EPTGRFWDGVQTAGDYYDVIGGGICGAFLVFGILSVFVYKPWRRWIGKRYGKDAASAGD
FT                   EEGAYRGEDTGTDAGTSIPRVDTPLNEGGSSVTYGSVHVQPKGNTK"
FT   gene            1217835..1219881
FT                   /locus_tag="ANIA_06114"
FT                   /old_locus_tag="AN6114.4"
FT                   /product="terminal deoxynucleotidyl transferase, putative
FT                   (AFU_orthologue; AFUA_2G08840)"
FT   mRNA            1217835..1219881
FT                   /locus_tag="ANIA_06114"
FT                   /old_locus_tag="AN6114.4"
FT                   /note="transcript_id=CADANIAT00006898"
FT   CDS_pept        1217884..1219881
FT                   /locus_tag="ANIA_06114"
FT                   /old_locus_tag="AN6114.4"
FT                   /product="terminal deoxynucleotidyl transferase, putative
FT                   (AFU_orthologue; AFUA_2G08840)"
FT                   /note="transcript_id=CADANIAT00006898"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006898"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006898"
FT                   /db_xref="GOA:Q5B016"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR018944"
FT                   /db_xref="InterPro:IPR022312"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR028207"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B016"
FT                   /protein_id="CBF70157.1"
FT                   /translation="MSSTSTASLTPSDPGQDLDIEADLLTTESGFSLAKCPPIYVLPTH
FT                   LDLDALHQTEETLIQHGARLTYDVAEATLILGKVRQKKRAALELRSRGVWTEEVESTSS
FT                   HTSGPPAKRRRLESGRNGSAVSEIYLSTEDESEEDGRRLTAHLEHPQLSESKRSERTSV
FT                   SKLLSKDEGVIRVVRLDWLAQCAEAQTLLPLASFVVYHARKIERPATRGDDETANSQAI
FT                   LDRAKQDAAFKAPFPPSTDKHDRVASHRAPPKLYRQTTSENEEAEPLPPPPEWVRDGVM
FT                   YACMRSSFLNTPNNAFINQLVKIRTIRELNLDEIGVRAYSTAIAAIAAYPYEIRRGSQI
FT                   LSLPGCDSKIANLFVEFKASESGTLAAAEALDKDPDLRTLHTFYNIWGVGSKTAREFFY
FT                   ARQWRDLDDIVEHGWHSLSRVQQIGVKYYDEFLLDIPREETEAIGKIICQHANSASVRP
FT                   TAQYDGHGVECIIVGSYRRGKPVSHDVDIILSHRDEAITHNLVVDVVASLESEGWITHT
FT                   LALHLTTSKRDQQTLPYRGDDDDRNHFDSLDKALVVWQTPKDKLGSGTQASSANTNPHR
FT                   RVDIIVSPWRTVGCAVLGWSGDTTFERDLRRYAKKAHGWKFDSSGVRERVTGGQVIDLE
FT                   ARGETWQERERMVMEGLGVGWRPPEERCTR"
FT   gene            complement(1220387..1221870)
FT                   /locus_tag="ANIA_06113"
FT                   /old_locus_tag="AN6113.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1220387..1220865,1220959..1221112,
FT                   1221180..1221489,1221574..1221870))
FT                   /locus_tag="ANIA_06113"
FT                   /old_locus_tag="AN6113.4"
FT                   /note="transcript_id=CADANIAT00006899"
FT   CDS_pept        complement(join(1220451..1220865,1220959..1221112,
FT                   1221180..1221489,1221574..1221870))
FT                   /locus_tag="ANIA_06113"
FT                   /old_locus_tag="AN6113.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006899"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006899"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006899"
FT                   /db_xref="GOA:Q5B017"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B017"
FT                   /protein_id="CBF70159.1"
FT                   /translation="MGANAKAQSWLHKLEEQGMLCAFHEEGTGSLTNQTMPVNVDVDAM
FT                   DPDFIKSLPITPHDMTSNQIHVHGQISEPKNRQLLLDVAREYKDRSWVDVYTRVAVLLC
FT                   KKNINLISGRVLLQILPSYAYDRDKVLSHARLYAKEFESVEITKDRFCIKIPSTGPALS
FT                   VCSTLEAEGIRTLGTAVFSLPQAIAASQAGCLYISPYFNEIRANFNLSLWPNVEDPATQ
FT                   HTMSARLMQMLEMYRKLYKETGKTQPLIKNANFISPKEALAQGEFGVDSATVSAEVLSQ
FT                   LANIPYDVSVRPSGIVDIPKPQYPEHQNSVSSTPKRLQHLATTDPLAAADWDGSIASTD
FT                   VDYLKHNGAELEKAIKADPIASARISDALDVFLKVEGESRELIEGVMKELA"
FT   gene            complement(1222442..1226622)
FT                   /locus_tag="ANIA_06112"
FT                   /old_locus_tag="AN6112.4"
FT                   /product="phospholipid P-type ATPase transporter
FT                   (Eurofung)"
FT   mRNA            complement(join(1222442..1223338,1223384..1223693,
FT                   1223735..1226622))
FT                   /locus_tag="ANIA_06112"
FT                   /old_locus_tag="AN6112.4"
FT                   /note="transcript_id=CADANIAT00006900"
FT   CDS_pept        complement(join(1222490..1223338,1223384..1223693,
FT                   1223735..1226622))
FT                   /locus_tag="ANIA_06112"
FT                   /old_locus_tag="AN6112.4"
FT                   /product="phospholipid P-type ATPase transporter
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006900"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006900"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006900"
FT                   /db_xref="GOA:Q5B018"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B018"
FT                   /protein_id="CBF70161.1"
FT                   /translation="MASGRAPGRHPAAGRDDDLLQLEESTPIYNTGRPPPVNDESLLRQ
FT                   YNIDDSENAQPRPSVSYDNFVGGRVTPHAGAHATGSAPPVHAGVYMNDPYSGQDVSRTY
FT                   SQTSGLDNYQRYSMDEYEGGHGYYDMTGQDPMEGDSRMRERNSILSMGGGLMGRAKHML
FT                   GMKPEYSEMDLPLTEAGARAARADSTVSEDGPPHAKKSSKPSFKFGFGRRTVDSSTLGP
FT                   RIIQLNNPPANAVHKFVDNHVSTAKYNIVTFLPKFLYEQFSKYANLFFLFTAVLQQIPN
FT                   VSPTNRYTTIGPLVIVLLVSAIKELVEDYKRRSSDKSLNYSKTQVLKGSTFHETKWVDV
FT                   AVGDIVRVESEQPFPADLVLLASSEPEGLCYIETANLDGETNLKIKQAIPETSHLVSPA
FT                   DLSRLSGRIRSEQPNSSLYTYEATLTMHAGGGERELPLAPDQLMLRGATLRNTPWIHGV
FT                   VVFTGHETKLMRNATATPIKRTAVERMVNIQILMLVSILVALSVVSSVGDLIIRQTEKD
FT                   KLTYLDYGSTNPGKQFIMDIFTYWVLYSNLVPISLFVTIEIVKYSQAFLINSDLDIYYD
FT                   VTDTPATCRTSSLVEELGQIEYIFSDKTGTLTCNMMEFKECTIGGIQYGEDVAEDRRAT
FT                   VEDGVEVGVHDFKKLRQNLESHPTKDAIHHFLTLLATCHTVIPERSEADPDKIKYQAAS
FT                   PDEGALVEGAARMGYKFSNRKPRSVIITVAGQEYEYELLAVCEFNSTRKRMSTIFRCPD
FT                   GRIRIYIKGADTVILERLHQDNPIVEGTLQHLEEYASDGLRTLCLAMREIPEDEFQQWY
FT                   QIFDKAATTVGGNRAEELDKAAELIEKDFYLLGATAKEDRLQDGVPDTIHTLQTAGIKI
FT                   WVLTGDRQETAINIGMSCKLISEDMTLLIVNEDSAEATRDNLTKKLQAVQSQTEAEQMA
FT                   LIIDGRSLTFALEKDMEKLFLDLAVLCKAVVCCCSRVSPLQKALVVKLVKRHLKSLLLA
FT                   IGDGANDVSMIQAAHVGVGISGVEGLQAARSADVSIAQFRYLRKLLLVHGAWSYHRISR
FT                   VILYSFYKNIALYMTQFWYSFQNAFSGEVIYESWTLSFYNVFFTVLPPFAMGICDQFIS
FT                   ARLLDRYPQLYQLGQKGLFFKRHSFWSWIANGFYHSLLLYIVSQLIFLYDLPQADGKVA
FT                   GHWVWGSALYTAVLATVLGKAALITNIWTKYTFIAIPGSMIIWLAFLPAYGYAAPAIGF
FT                   SEEYYGTIPRLFTSPIFYLMAIVLPCICLLRDYAWKYAKRMYYPQHYHHVQEIQKYNVQ
FT                   DYRPRMEQFQKAIRKVRQVQRMRKQRGYAFSQADEGGQMRVVNAYDTTRGRGRYGEMTS
FT                   SRNLV"
FT   gene            complement(1227282..1228330)
FT                   /locus_tag="ANIA_06111"
FT                   /old_locus_tag="AN6111.4"
FT                   /product="exosome complex endonuclease 2/ribosomal RNA
FT                   processing protein, putative (AFU_orthologue;
FT                   AFUA_2G08860)"
FT   mRNA            complement(join(1227282..1227885,1227936..1228055,
FT                   1228101..1228330))
FT                   /locus_tag="ANIA_06111"
FT                   /old_locus_tag="AN6111.4"
FT                   /note="transcript_id=CADANIAT00006901"
FT   CDS_pept        complement(join(1227282..1227885,1227936..1228055,
FT                   1228101..1228264))
FT                   /locus_tag="ANIA_06111"
FT                   /old_locus_tag="AN6111.4"
FT                   /product="exosome complex endonuclease 2/ribosomal RNA
FT                   processing protein, putative (AFU_orthologue;
FT                   AFUA_2G08860)"
FT                   /note="transcript_id=CADANIAT00006901"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006901"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006901"
FT                   /db_xref="GOA:Q5B019"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR033100"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B019"
FT                   /protein_id="CBF70162.1"
FT                   /translation="MNKEAPLSIAERDFILDALREGVRLDGRGADQLRPLTLSFGEEYG
FT                   HVKVQLGKTSLVVRISAEVAKPHDDRPFDGIFNIAMELTAMGSPAWENGRQGDLETYVT
FT                   NVLDRVIRHSNALDTESLCILKGVSCWTIRADVHITDYDGNLIDASCIGVMAGLQHFRR
FT                   PDAVVKDGQVIVYGLDERVPAPLNITHKPLSVTFHTFDDGKLAILDATRKEEQASEADV
FT                   VIGMNNAGDVCYLSKFQGSPVDALVFITKTSLALEKVKYINGIIDKALQADLAKRSKGG
FT                   LAEQARAENDRPVA"
FT   gene            1228493..1229436
FT                   /locus_tag="ANIA_06110"
FT                   /old_locus_tag="AN6110.4"
FT                   /product="Pre-mRNA-splicing factor cwc15
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B020]"
FT   mRNA            join(1228493..1228502,1228552..1228574,1228622..1228698,
FT                   1228752..1229033,1229080..1229161,1229212..1229436)
FT                   /locus_tag="ANIA_06110"
FT                   /old_locus_tag="AN6110.4"
FT                   /note="transcript_id=CADANIAT00006902"
FT   CDS_pept        join(1228493..1228502,1228552..1228574,1228622..1228698,
FT                   1228752..1229033,1229080..1229161,1229212..1229436)
FT                   /locus_tag="ANIA_06110"
FT                   /old_locus_tag="AN6110.4"
FT                   /product="Pre-mRNA-splicing factor cwc15
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B020]"
FT                   /note="transcript_id=CADANIAT00006902"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006902"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006902"
FT                   /db_xref="GOA:Q5B020"
FT                   /db_xref="InterPro:IPR006973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B020"
FT                   /protein_id="CBF70164.1"
FT                   /translation="MTTAHRPTFDPARGKEALRGPAYHQRLLPAYTHLKVRQSGQGTEG
FT                   EAARRDLRAELLQAEAAHFAKKNGAPVPEASAESTPKRQLEGAPANGGDGELEEDPEAK
FT                   RRRILEETREIDADSEASEEDSSEDESDDEDEAAELMRELEKIKKERLAQKEKEERERA
FT                   AKEEEQREVDIARGNPLLNPSDFNIKRRWDDDVVFKNQARGTEDKRGKEFVNDLLRSDF
FT                   HKKFMSKYVR"
FT   gene            1229777..1230398
FT                   /locus_tag="ANIA_06109"
FT                   /old_locus_tag="AN6109.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1229777..1229810,1229897..1229961,1230045..1230113,
FT                   1230213..1230398)
FT                   /locus_tag="ANIA_06109"
FT                   /old_locus_tag="AN6109.4"
FT                   /note="transcript_id=CADANIAT00006903"
FT   CDS_pept        join(1229777..1229810,1229897..1229961,1230045..1230113,
FT                   1230213..1230398)
FT                   /locus_tag="ANIA_06109"
FT                   /old_locus_tag="AN6109.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006903"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006903"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006903"
FT                   /db_xref="GOA:Q5B021"
FT                   /db_xref="InterPro:IPR009332"
FT                   /db_xref="InterPro:IPR038427"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B021"
FT                   /protein_id="CBF70166.1"
FT                   /translation="MDLQPTSKNMHNRINTDISQLLQRFENIMATATVESTSHTTTAVE
FT                   TYQLDVESTALIRAAEDILSLTRTMKETWLFGKLDTLGEDESETKRREGLEQDAAVIQK
FT                   IIEDAGILKAPKK"
FT   gene            1231120..1231819
FT                   /locus_tag="ANIA_06108"
FT                   /old_locus_tag="AN6108.4"
FT                   /product="DHFR, dihydrofolate reductase, cytosolic form
FT                   (Eurofung)"
FT   mRNA            join(1231120..1231745,1231798..1231819)
FT                   /locus_tag="ANIA_06108"
FT                   /old_locus_tag="AN6108.4"
FT                   /note="transcript_id=CADANIAT00006904"
FT   CDS_pept        join(1231120..1231745,1231798..1231819)
FT                   /locus_tag="ANIA_06108"
FT                   /old_locus_tag="AN6108.4"
FT                   /product="DHFR, dihydrofolate reductase, cytosolic form
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006904"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006904"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006904"
FT                   /db_xref="GOA:Q5B022"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B022"
FT                   /protein_id="CBF70168.1"
FT                   /translation="MGRKTYDSIPPRLRPLGKRLNVVISRDPDGSVAERVKIDLESKLE
FT                   REREAAEAKAKQQPQNQAEGRNSGEEPVNAAAVTAVVAPPVKEGSTGAFVERSLEEALR
FT                   RLDNAAAGEEGVGNIYVIGGAEIYNASLKLGSRSENERTIRIVMTDVEKLDGSGFECDT
FT                   FFPVDAEELNSGKWRKVSPAEVTGWVGEEVTGEWTEEGDVRVRMVGSCVSIE"
FT   gene            complement(1232162..1234948)
FT                   /locus_tag="ANIA_06107"
FT                   /old_locus_tag="AN6107.4"
FT                   /product="CLC channel [Source:UniProtKB/TrEMBL;Acc:Q870M6]"
FT   mRNA            complement(join(1232162..1232317,1232375..1234948))
FT                   /locus_tag="ANIA_06107"
FT                   /old_locus_tag="AN6107.4"
FT                   /note="transcript_id=CADANIAT00006905"
FT   CDS_pept        complement(join(1232162..1232317,1232375..1234948))
FT                   /locus_tag="ANIA_06107"
FT                   /old_locus_tag="AN6107.4"
FT                   /product="CLC channel [Source:UniProtKB/TrEMBL;Acc:Q870M6]"
FT                   /note="transcript_id=CADANIAT00006905"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006905"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006905"
FT                   /db_xref="GOA:Q5B023"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B023"
FT                   /protein_id="CBF70170.1"
FT                   /translation="MPRSIPSYFTSAPPAEEHHDPENVSPGPRLNPRTAPPSPSVMRRT
FT                   YSHLSESHTAYQSLEPPLEAGETTSLLGKAKEGGSGRMEPQRSYTTFSASSGPESGFRY
FT                   TLLGSSLRRSRHHSRANSVHQRFSRRASMDEVPVESTAASIKDAMTSSFMDDRLWYDQF
FT                   TSTDWVHDSVADGVRLRELRRRKDIRGRLLALFDGAQGWILVALIGCIVAAIAYFVDIT
FT                   EEYVFGLKNGICTTGWLRSRETCCADEEECPAWRSWSEMMNHHGGGSVSVDFGIYVLWS
FT                   VILAAISCLLTLLTKTVVPSSVSLTTLDENLGANGSRQATEADGSPASVSGSSPYPPLP
FT                   LRPDMVYYSAAGSGVAEVKVINSGFVLHGYLGFKTLVIKTLALIFSVASGLSLGKEGPY
FT                   VHIATCVGNIACRLFSKYNLNDGKRREVLSASAASGVAVAFGAPIGGVLFSLEEVSYYF
FT                   PPKTLFRTFFCCIAAALSLKFFNPYGTGKIVLFEVRYLGDWEIFELAIFMFLGVLGGAA
FT                   GALFIKASSIWAKSFRRIPVIKRWPLFEVGLVALVTGLISFWNPYTKLPVTELLFQLAS
FT                   PCEHSTSDGLCPHPEGIGEVIRALTIAFVIKSFLTIVTFGIKVPAGIYVPSMVVGGLMG
FT                   RIVGHVTQYLALQYPNFFLFGSSCAAGTGMESCVTPGVYAMVAAGATMCGVTRLSVTLA
FT                   VILFELTGSLDHVLPFSLAVLCAKWTADAIEPHSIYDFLTEMNSYPFLDNKLQTVSDAV
FT                   LGDIVRPIRRSRLIDITETPLVPARELRSKLQHLLMAGELDSGLPILRDGVLIGLIPAP
FT                   DLEYALDNLEDEDRTSCLMATDTSSVVSDTDDEDTLQVDFTKYIDPAPLALDIHSPIDL
FT                   VYQCFVKLGLRYLCVLHDGQYAGLVHKKAFVKFMKEQH"
FT   gene            complement(1236432..1237334)
FT                   /locus_tag="ANIA_06106"
FT                   /old_locus_tag="AN6106.4"
FT                   /product="pectate lyase (Eurofung)"
FT   mRNA            complement(join(1236432..1236719,1236775..1236830,
FT                   1236889..1236931,1236987..1237334))
FT                   /locus_tag="ANIA_06106"
FT                   /old_locus_tag="AN6106.4"
FT                   /note="transcript_id=CADANIAT00006906"
FT   CDS_pept        complement(join(1236432..1236719,1236775..1236830,
FT                   1236889..1236931,1236987..1237334))
FT                   /locus_tag="ANIA_06106"
FT                   /old_locus_tag="AN6106.4"
FT                   /product="pectate lyase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006906"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006906"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006906"
FT                   /db_xref="GOA:Q5B024"
FT                   /db_xref="InterPro:IPR004898"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B024"
FT                   /protein_id="CBF70172.1"
FT                   /translation="MLSKLALASTLIPAALACLGYEGGVPTPTASYSNSAPIEIAAGQT
FT                   FDAGWARYDRGSGACTDGEGGNDDAVFILRSGATLKNVIIGKNQKEGVHCEGPCTLEFV
FT                   WFEDVCEDAITVRGDSAGDHTWIIGGGAYHASDKIVQHNGCGTVNRDAALTDHYLKIIN
FT                   FYAEDYGKVYRSCGNCSSQCKRNVYIEGVTAYDGGDICGINSNYGDTCTLNNVCTDADH
FT                   PCVLYEGCAGGCEPEKVGYCSG"
FT   gene            complement(1241642..1242130)
FT                   /locus_tag="ANIA_10773"
FT                   /old_locus_tag="AN10773.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(1241642..1242130)
FT                   /locus_tag="ANIA_10773"
FT                   /old_locus_tag="AN10773.4"
FT                   /note="transcript_id=CADANIAT00006907"
FT   CDS_pept        complement(1241642..1242040)
FT                   /locus_tag="ANIA_10773"
FT                   /old_locus_tag="AN10773.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006907"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006907"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006907"
FT                   /db_xref="GOA:C8V2J9"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2J9"
FT                   /protein_id="CBF70173.1"
FT                   /translation="MSSSDSNLPDFEHFLSDSSTDSSSSHSFPTAVIVLLPLITGVVLM
FT                   AGIWCFAVKRGARNRARTLAKEQEQEQQSNPHGSGAGAGETLIHMQQIPPVVVRPGERH
FT                   GVGDGVRNEVEDAPPPYSVAVQSADRSR"
FT   gene            complement(1242579..1243200)
FT                   /locus_tag="ANIA_06105"
FT                   /old_locus_tag="AN6105.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1242579..1242783,1242881..1243200))
FT                   /locus_tag="ANIA_06105"
FT                   /old_locus_tag="AN6105.4"
FT                   /note="transcript_id=CADANIAT00006908"
FT   CDS_pept        complement(join(1242579..1242783,1242881..1243200))
FT                   /locus_tag="ANIA_06105"
FT                   /old_locus_tag="AN6105.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006908"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006908"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006908"
FT                   /db_xref="GOA:Q5B025"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B025"
FT                   /protein_id="CBF70175.1"
FT                   /translation="MVMSTSAAPTPSASASAPQTANSNGSIACANTVATLTGTCPCGSI
FT                   SVTVTDRSLEGKHGQRDSNPNLTIDAEKTAIQDRQKTLKMYFDLDTMSGRQIEKFFCSS
FT                   CGCPIMSMTALLPGQVNLTMGLFPRIPASGFETTSSAFQPHRHQNPHPRSLEGRLDDVV
FT                   QWSAKANAGLA"
FT   gene            complement(1246284..1247691)
FT                   /locus_tag="ANIA_06104"
FT                   /old_locus_tag="AN6104.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(1246284..1247691)
FT                   /locus_tag="ANIA_06104"
FT                   /old_locus_tag="AN6104.4"
FT                   /note="transcript_id=CADANIAT00006909"
FT   CDS_pept        complement(1246541..1247335)
FT                   /locus_tag="ANIA_06104"
FT                   /old_locus_tag="AN6104.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006909"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006909"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006909"
FT                   /db_xref="GOA:Q5B026"
FT                   /db_xref="InterPro:IPR037738"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B026"
FT                   /protein_id="CBF70177.1"
FT                   /translation="MSSINFSPLPSSPAASSPLAAPSFTSYFNLLTRKRQQKKMSITQT
FT                   YYLAHTARRKLTREASRADHDLRLLVGHANLLDSLMLDLADAEQEQERWFNQTVSGATK
FT                   GAYRSENQHHIQWAETLVEEPEEDWDPSEDLSDEDSDLSEEEDSDFEENYAPVRRRAPS
FT                   PVAIVTETELEDYDSDSDSEYDYDDAEDLDELALTRSPSRQPPELSHDEDDSEDDSMPP
FT                   SPPQPVLESFDEKQAHTEVTLADPDFEHRYYVRPAQPMIEAC"
FT   gene            1252711..1254367
FT                   /locus_tag="ANIA_06103"
FT                   /old_locus_tag="AN6103.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1252711..1252812,1252889..1253538,1253632..1253672,
FT                   1254107..1254226,1254258..1254284,1254321..1254367)
FT                   /locus_tag="ANIA_06103"
FT                   /old_locus_tag="AN6103.4"
FT                   /note="transcript_id=CADANIAT00006910"
FT   CDS_pept        join(1252711..1252812,1252889..1253538,1253632..1253672,
FT                   1254107..1254226,1254258..1254284,1254321..1254367)
FT                   /locus_tag="ANIA_06103"
FT                   /old_locus_tag="AN6103.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006910"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006910"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006910"
FT                   /db_xref="GOA:Q5B027"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B027"
FT                   /protein_id="CBF70179.1"
FT                   /translation="MKAFFAISASTLLATVHGHGYLTVPASRTRLGFEAGIDTCPECSI
FT                   LEPVDAWPNVTEAQVGRSGPCGYNARVSVDYNQPGDNWGNEPVVTYKAGDIVEVQWCVD
FT                   NNGDHGGMFTYGICQDQELVDKFLDPDYLPTEEEKQAAEDCFLQGELKCGDVDGQECEY
FT                   SPDCGEGEACYRNDWFTCNAFEADSDRGCQGVDGAELNSCKTTIAGGYTVTKKIKIPDY
FT                   TSEHTLLRFRWNSFQTPQIYLHCADPTIEGGMEVRMRMIVMHGSFGVDTQHSFGHSFGF
FT                   QGEGVYRAYRYIRGVAIIQMNLNINASLLPQPTLPIRGWSTRNIQHT"
FT   gene            complement(1254883..1256396)
FT                   /locus_tag="ANIA_10775"
FT                   /old_locus_tag="AN10775.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(1254883..1256226,1256292..1256396))
FT                   /locus_tag="ANIA_10775"
FT                   /old_locus_tag="AN10775.4"
FT                   /note="transcript_id=CADANIAT00006911"
FT   CDS_pept        complement(join(1254883..1256226,1256292..1256396))
FT                   /locus_tag="ANIA_10775"
FT                   /old_locus_tag="AN10775.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006911"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006911"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006911"
FT                   /db_xref="GOA:C8V2K3"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2K3"
FT                   /protein_id="CBF70180.1"
FT                   /translation="MSASNQPLRVAPKRLRATHTKSRQGCYTCKSRRVKCDEAKPICGA
FT                   CALRGEPCGFPPDTSRQPRRERDDASGGTTSRQAQREPPSVSNARSPHALEFDLSPAPS
FT                   NVAAEANSQSMNMVDLQLLSYFMIHTGKNMSLIPSRQKVWQTVIPRLAARHEFLMHLLL
FT                   ALAGLDYFHPDGNPDADLAVGSESRADQSTSISVEHHLQLVVRHHQCGLQGFRNQLSAL
FT                   SDSNCHEVFSGSLLLVGFAFASLRMRNWNDSHTSPLPPLRKPRLDWIYLIRGLTAVVEQ
FT                   CWPSLRMGPLREMLQYPGATEDWKMYPEKMSTTVIPRGCSPRISRFCQGAYRALARLQA
FT                   LEGSTPSSSAEDSPESRPSGLKDGLDLVESVYMRILYLAQFSRDEKCTSIELQADMEDA
FT                   AVMGWPQALSEEFLATLGDPDIAPNISLVILAYLYLTLALFEAAWFLNGAFDEDIQKID
FT                   ALCKSYGDRTLISLMEWPVSVING"
FT   gene            complement(1256668..1257698)
FT                   /locus_tag="ANIA_10770"
FT                   /old_locus_tag="AN10770.4"
FT                   /product="RTA1 domain protein, putative (AFU_orthologue;
FT                   AFUA_6G09550)"
FT   mRNA            complement(join(1256668..1257155,1257220..1257462,
FT                   1257524..1257698))
FT                   /locus_tag="ANIA_10770"
FT                   /old_locus_tag="AN10770.4"
FT                   /note="transcript_id=CADANIAT00006912"
FT   CDS_pept        complement(join(1256668..1257155,1257220..1257462,
FT                   1257524..1257698))
FT                   /locus_tag="ANIA_10770"
FT                   /old_locus_tag="AN10770.4"
FT                   /product="RTA1 domain protein, putative (AFU_orthologue;
FT                   AFUA_6G09550)"
FT                   /note="transcript_id=CADANIAT00006912"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006912"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006912"
FT                   /db_xref="GOA:C8V2K4"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2K4"
FT                   /protein_id="CBF70181.1"
FT                   /translation="MSSAESSQEVYFALYRYTPSIPAAAVFVAVFVALAVFHGIVLVRH
FT                   RALFFTPFIVGLIFEAAGYAARIFSHYDTLALGPYIVQTMLILVAPPLFAASIYMTLGR
FT                   VIFRLEAEWASMIRVKYITKIFVVGDVVSFLLQCGGGGYMAAGSLSAMENGERIVIAGL
FT                   AVQLLFFGFFMFLSAVFHYRVKSDTQHSVRPIAAHSRFSSSWEAMMWCLYGACILIFVR
FT                   SVFRVIEFVQGNDGYIMKREYLLYVFDAVLMALQAILLLLAYPGAVVKGSRRTGDVALN
FT                   SRGESSDGMLPAGSGKREPC"
FT   gene            complement(1259881..1261769)
FT                   /locus_tag="ANIA_06101"
FT                   /old_locus_tag="AN6101.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            complement(join(1259881..1260065,1260114..1260648,
FT                   1260695..1261029,1261085..1261276,1261328..1261769))
FT                   /locus_tag="ANIA_06101"
FT                   /old_locus_tag="AN6101.4"
FT                   /note="transcript_id=CADANIAT00006913"
FT   CDS_pept        complement(join(1259881..1260065,1260114..1260648,
FT                   1260695..1261029,1261085..1261276,1261328..1261769))
FT                   /locus_tag="ANIA_06101"
FT                   /old_locus_tag="AN6101.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006913"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006913"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006913"
FT                   /db_xref="GOA:C8V2K5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2K5"
FT                   /protein_id="CBF70183.1"
FT                   /translation="MNSLLFREALQHASSTDISKLLLSAATLGVLSHVSLFRSLPVEEY
FT                   LYGLLGLYTATVVAVTVLYLTATAFSPLQVLLRVGCISAAFNTGLASSIAIYRLFFHRL
FT                   RRFPGPRLSKLSRFYDAYLAGKGLQYHVEIAEMHKRYGDFFRTGPREICIVRKSAVPLL
FT                   LSPQSKCGKSTFYAQAQTEAEYCNVHQTRDFEDHRRRRKAWDRGLSVKALATYEPSIRA
FT                   KADLLVLHIEKNRGRAIDATKWSMFLSFDIMGKVGFGKEFNNLSTGVEHPGIKAIHDHM
FT                   AILGVMCHVPWLLNLISNLPGASFSMAEFFKWCEDEIVQKHRSWDIKETPQDITSWLLK
FT                   AYVHKEVSAAPTANALHEDSRAVIVAGSETTATTLASILYFLCKNPEILAKLQLLLDEA
FT                   MPGGSSEWTYDKIKTISYLDDIINETLRLRPAILTGGYRVTPAEGLQVDEVYIPGDVNV
FT                   FVPTQLIQTDERYYVDAKRFVPERWNEKKEMIQDGAPYFPFLYGPYVCPKKNLALMSLR
FT                   ISVSKLAQLYDIHFAPGENGELFETRTLDTFTTTLPPLHVQFLSR"
FT   gene            complement(1262855..1264264)
FT                   /locus_tag="ANIA_06100"
FT                   /old_locus_tag="AN6100.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1262855..1263399,1263457..1264264))
FT                   /locus_tag="ANIA_06100"
FT                   /old_locus_tag="AN6100.4"
FT                   /note="transcript_id=CADANIAT00006914"
FT   CDS_pept        complement(join(1262855..1263399,1263457..1264264))
FT                   /locus_tag="ANIA_06100"
FT                   /old_locus_tag="AN6100.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006914"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006914"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006914"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B030"
FT                   /protein_id="CBF70185.1"
FT                   /translation="MPPGTQPSIKRAGSPVKQPSLPPRPMDQNTDPIKIDSVPSQDVRT
FT                   ASLPSYRATNTQPKITIKCGPNQQQAPQQNSAVTRPATEPIKGKQPANTADELQRLQLE
FT                   HAESRKRIQDLERQLEEQCALTKTILNERDKVAAQAEENWKLWKQTARELRKAKQAPSH
FT                   YQFTDSQLTGLIQQLRYSIRDFAVQYFTGIPRSHVSRDRLDVWESCVVSTTPGTTAYQE
FT                   YIRSPSRCASIIQAIVWKLLDRRVFGSFVWAGKAGESLCDLRFYLKYASRHDPVPDPDL
FT                   ERKFQIWSSEASALILQMCDFTEGSQEYKRMQSTRKEIREEFWSIAGQYLSIRSSAPGQ
FT                   DFRRILENAIALDREIHRQAARVTWEFPPVDAHVRFNPEFMEAEKGQQRPRVDQQVLLV
FT                   VAPGLTKRGKSDGQDFAGEEQLLVPMEVSCLLPGDIPGAGGLSSLVYSWLR"
FT   gene            1264727..1267002
FT                   /locus_tag="ANIA_06099"
FT                   /old_locus_tag="AN6099.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1264727..1264881,1264943..1265549,1265597..1265663,
FT                   1265716..1265983,1266040..1266087,1266134..1266139,
FT                   1266346..1266628,1266667..1267002)
FT                   /locus_tag="ANIA_06099"
FT                   /old_locus_tag="AN6099.4"
FT                   /note="transcript_id=CADANIAT00006915"
FT   CDS_pept        join(1264727..1264881,1264943..1265549,1265597..1265663,
FT                   1265716..1265983,1266040..1266087,1266134..1266139,
FT                   1266346..1266628,1266667..1267002)
FT                   /locus_tag="ANIA_06099"
FT                   /old_locus_tag="AN6099.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006915"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006915"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006915"
FT                   /db_xref="GOA:Q5B031"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B031"
FT                   /protein_id="CBF70187.1"
FT                   /translation="MLASRVTSLSESALNTLNAINAADGDITWPLQGLRINEDDDQLVI
FT                   GIDFGTTFSGVAWATPEHFEADQINLINAWPGTGREEGKAPTELLYDDEKIMWGYNIPG
FT                   GADTVRGFKLLLLHDEDLTDDVKTSEFFLRAKKMLRDTGKTPVGLIADYLRALWQHTMD
FT                   TINKALGDSVMDGLRFHVVITVPAIWKAYARQSMQDAAKRAGILKARKAGGTTLSFIPE
FT                   PEAAALSTLCERGRRIKKGDVYVICDAGGGTVDLISYEVKDTNPIAMREAVEGRGGLCG
FT                   GLLIDEAFETMCKRRLGRRWDNLSKKGINDLMRGEWEQYIKPQFKPGSTPGDWIVGIPA
FT                   EAFERSKLDDLSRQPYIKQGRIHFRDCDIEQAFTSSLAGIDASRRTAICRGAIYKGFLH
FT                   LSESNPNNQNGYDYKSIKVVSTISRISIGKMYWTDFDESKHLEEDRKWDSDQEKWRADH
FT                   QMHWFIRKVRLSSTSVLILQGDDVSTKHRVSHGYHKIVERDFDGFFRVRIYQCEADDPP
FT                   TRRDSSVKLLCTINCSLDVQTSELKTFRCSDGTKKKELYYKLEMVPSGAAAECTVYIDG
FT                   RKQGSQHVEIQFQ"
FT   gene            complement(1267620..1269225)
FT                   /locus_tag="ANIA_06098"
FT                   /old_locus_tag="AN6098.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1267620..1267843,1267905..1268312,
FT                   1268405..1268731,1269129..1269225))
FT                   /locus_tag="ANIA_06098"
FT                   /old_locus_tag="AN6098.4"
FT                   /note="transcript_id=CADANIAT00006916"
FT   CDS_pept        complement(join(1267620..1267843,1267905..1268312,
FT                   1268405..1268731,1269129..1269225))
FT                   /locus_tag="ANIA_06098"
FT                   /old_locus_tag="AN6098.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006916"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006916"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006916"
FT                   /db_xref="GOA:C8V2K8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2K8"
FT                   /protein_id="CBF70189.1"
FT                   /translation="MPDPGSCLCPFFIPSNPTYHRASSNNRIQCHSDSALGPSECRSTL
FT                   LVFQEWSIVFGIVISYWTSFGTRYMAGEWSWRLPFLLQIMPLFNLAAGIMVLSFSPRWL
FT                   ASKGRNKEALQSFSRLRRLPITDRRVRQEYMDSQAELNCFRKRTWRRIHIAIMIPFFQQ
FT                   FSGINALIYYSPTFETMGFDLSIQLIMSGVLNSLQLVGCTSTVWTMDTLGRRKLLFAGS
FT                   VSETISHNIIAALVGRYSSNWASHQTAGWVSAAFLLVYMVAFGAAWGPVGLAIPSEIFP
FT                   SSLRAKGVAIATCSNWLNNFIIGLITLPLIEGTGYGTYVFFAVFCGLSGIWTFFFVGDD
FT                   GAHARADGPCF"
FT   gene            complement(1269566..1270941)
FT                   /locus_tag="ANIA_06097"
FT                   /old_locus_tag="AN6097.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1269566..1270132,1270185..1270475,
FT                   1270568..1270653,1270683..1270941))
FT                   /locus_tag="ANIA_06097"
FT                   /old_locus_tag="AN6097.4"
FT                   /note="transcript_id=CADANIAT00006917"
FT   CDS_pept        complement(join(1269566..1270132,1270185..1270475,
FT                   1270568..1270653,1270683..1270941))
FT                   /locus_tag="ANIA_06097"
FT                   /old_locus_tag="AN6097.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006917"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006917"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006917"
FT                   /db_xref="GOA:Q5B033"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B033"
FT                   /protein_id="CBF70190.1"
FT                   /translation="MSYRLLLPGDRPTFTILALDVAKRNCAFSPTIQPIQCLLGRASCL
FT                   ARECRPSRRALSGLLYTFEIDHAQKACRTTSQQQTQGAPAHYYGTSSNAGLERLLLVVM
FT                   LRARSTIALATTKTPAGLCSEMMLARKSCRISPTPSRATAPTKTASDNAMSTKCWRTVK
FT                   VGCKLQTWDQTAFGSSLGARTRPSLNLKYALGFSVRLEQAPGMPYSPLMLMLRIHYICP
FT                   RRAFPHHPRLRPVCCTCRLLPAAAPLSISPIQGFAPNIIPTIVPPTHQLRIDSAEICLH
FT                   PTISNVIYASNRWERHIAQREPQIQDTRILTVLPAGDAIAILLLSDNGRAVVEIRHVRT
FT                   NLDVICGMRLSNDGRYVVLAGQEGGGVEVYDISGEGDEVWTLAAGLNEGLDAGLKHAVW
FT                   L"
FT   gene            1271205..1272134
FT                   /locus_tag="ANIA_06096"
FT                   /old_locus_tag="AN6096.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1271205..1271265,1271313..1271397,1271568..1271688,
FT                   1271841..1272134)
FT                   /locus_tag="ANIA_06096"
FT                   /old_locus_tag="AN6096.4"
FT                   /note="transcript_id=CADANIAT00006918"
FT   CDS_pept        join(1271205..1271265,1271313..1271397,1271568..1271688,
FT                   1271841..1272134)
FT                   /locus_tag="ANIA_06096"
FT                   /old_locus_tag="AN6096.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006918"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006918"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006918"
FT                   /db_xref="GOA:Q5B034"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B034"
FT                   /protein_id="CBF70192.1"
FT                   /translation="MSPPAHFKLNPGALIPAVGLGTWKSEPGEVARALAHALKTGYRHI
FT                   DAALGVPREEIFITSKLWNTHQPNIKEGLQKTLDALGVDCLDLYNETSDLLPVNPDGTR
FT                   AVDRSWDQSETWRQMEDFYKSGKAKAIGVANWSIPYLEELLADEVTRAIVRGRVAQDAL
FT                   EIGHAGNLGGHWNAAEGGGHDDV"
FT   gene            1274758..1276500
FT                   /locus_tag="ANIA_06095"
FT                   /old_locus_tag="AN6095.4"
FT                   /product="carboxylic acid transport protein
FT                   (AFU_orthologue; AFUA_2G09450)"
FT   mRNA            join(1274758..1275314,1275355..1275500,1275551..1275729,
FT                   1275787..1276135,1276187..1276500)
FT                   /locus_tag="ANIA_06095"
FT                   /old_locus_tag="AN6095.4"
FT                   /note="transcript_id=CADANIAT00006919"
FT   CDS_pept        join(1274758..1275314,1275355..1275500,1275551..1275729,
FT                   1275787..1276135,1276187..1276500)
FT                   /locus_tag="ANIA_06095"
FT                   /old_locus_tag="AN6095.4"
FT                   /product="carboxylic acid transport protein
FT                   (AFU_orthologue; AFUA_2G09450)"
FT                   /note="transcript_id=CADANIAT00006919"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006919"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006919"
FT                   /db_xref="GOA:Q5B035"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B035"
FT                   /protein_id="CBF70194.1"
FT                   /translation="MPSQNEPAEPIPDGIFAVAKQSWGDLFRWKQRVIIENEQGESYAE
FT                   WQDPEPFKNPISLLMLLSARDWLFFLVGLAAWTADAFDFHALSIQQVKLADYYGKTKTD
FT                   ISTAITLTLLLRSVGAAFFGLAGDRFGRKWPMVINMIVLGVLQIATIYSSTFQQFLAVR
FT                   SLFGLFMGGVYGNAIAMALEHCPLIARSVSARGLMSGILQQGYSLGYVFAACANLGVGG
FT                   GTETYKTVFWIAAGISIGIGLIRVLFPESKQFLEAKAAGKRSVSAGEFWRETKVMVGQE
FT                   WKICVYCIFLMTWFNYYSHTSQDSYTTFMLTQKELENSGASRASILMKTGACVGGTIIG
FT                   YLSQFVGRRRAIIISAFVSGLIIPAWILPTTERSLSATGFFMQFFVQGAWGVIPIHLNE
FT                   LSPPAFRSLFPGLTYQLGNMISSPSAQIINAIAEKTFIKGPSGNPVEAYGPTMGVATAI
FT                   IATGIMVTTAFGPEKRGRRFETVVVGMQEQNRTDKQLDLEADSKPGEETVERVDKV"
FT   gene            complement(1276697..1277768)
FT                   /locus_tag="ANIA_06094"
FT                   /old_locus_tag="AN6094.4"
FT                   /product="thiol methyltransferase, putative
FT                   (AFU_orthologue; AFUA_4G13570)"
FT   mRNA            complement(join(1276697..1276975,1277044..1277346,
FT                   1277443..1277653,1277710..1277768))
FT                   /locus_tag="ANIA_06094"
FT                   /old_locus_tag="AN6094.4"
FT                   /note="transcript_id=CADANIAT00006920"
FT   CDS_pept        complement(join(1276697..1276975,1277044..1277346,
FT                   1277443..1277653,1277710..1277768))
FT                   /locus_tag="ANIA_06094"
FT                   /old_locus_tag="AN6094.4"
FT                   /product="thiol methyltransferase, putative
FT                   (AFU_orthologue; AFUA_4G13570)"
FT                   /note="transcript_id=CADANIAT00006920"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006920"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006920"
FT                   /db_xref="GOA:Q5B036"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B036"
FT                   /protein_id="CBF70196.1"
FT                   /translation="MSSPSQQPIKGRLISHFENRPTPSHPKAWSDLWDSGKSSLWDRGM
FT                   PSPALIDLLESYQDTLLHPFEIDIEDEEDSSDAGKTRKRKRALVPGCGRGYDVITFALH
FT                   GFDACGLEVSTTAVSEARAFAKKELCSPQSGNFGRRFDRERARHIGVGKAQFLQGDFFT
FT                   DTWIENESTGLDQGRTENGKFDLVYDYTFLCALHPAQRTRWAERMADLLRPGGLLVCLE
FT                   FPMYKDPALPGPPWGVNGIHWELLAGGDTGQGKFTRKAYVQPERTFEVGRGTDMISVYE
FT                   RK"
FT   gene            complement(1278577..1279603)
FT                   /locus_tag="ANIA_06093"
FT                   /old_locus_tag="AN6093.4"
FT                   /product="Acetylxylan esterase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q1HFS5]"
FT   mRNA            complement(join(1278577..1279038,1279092..1279348,
FT                   1279402..1279603))
FT                   /locus_tag="ANIA_06093"
FT                   /old_locus_tag="AN6093.4"
FT                   /note="transcript_id=CADANIAT00006921"
FT   CDS_pept        complement(join(1278577..1279038,1279092..1279348,
FT                   1279402..1279603))
FT                   /locus_tag="ANIA_06093"
FT                   /old_locus_tag="AN6093.4"
FT                   /product="Acetylxylan esterase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q1HFS5]"
FT                   /note="transcript_id=CADANIAT00006921"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006921"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006921"
FT                   /db_xref="GOA:Q5B037"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B037"
FT                   /protein_id="CBF70198.1"
FT                   /translation="MVKLQYLLSILLYAYSCTALMLDRRDPTPGQLSQVTDFGDNPTNV
FT                   GFYIYVPQNLASNPAIIVAIHYCTGTAQAYYSGTPYAQYAETYGFIVIYPESPYSGTCW
FT                   DVSSQSTLTHNGGGNSNSIANMVDWTINQYNADASRVYVTGTSSGAMMTPQNVMAATYP
FT                   NLFAAGIAYAGVPAGCFYSEANVEDQWNSTCAQGQSISTPEHWAQIAQAMYSGYEGSRP
FT                   KMQIYHGSADATLYPQNYYETCKQWAGVFGYNYDSPQEVQNDTPVAGWAKTIWGENLQG
FT                   ILADGVGHNIQIQGEEDLKWFGFTS"
FT   gene            1281051..1283552
FT                   /locus_tag="ANIA_06092"
FT                   /old_locus_tag="AN6092.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1281051..1281421,1281470..1283552)
FT                   /locus_tag="ANIA_06092"
FT                   /old_locus_tag="AN6092.4"
FT                   /note="transcript_id=CADANIAT00006922"
FT   CDS_pept        join(1281051..1281421,1281470..1283552)
FT                   /locus_tag="ANIA_06092"
FT                   /old_locus_tag="AN6092.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006922"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006922"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006922"
FT                   /db_xref="GOA:Q5B038"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015328"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="InterPro:IPR036460"
FT                   /db_xref="PDB:3PGB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B038"
FT                   /protein_id="CBF70200.1"
FT                   /translation="MKLPLSFSGGIALLLIGSLAGDVVATKLDPSRDLVRQKSRGRKNQ
FT                   MRSLVGRSNQHITHQSRPYTNEYASPCQITPPQEIKAPKENVWYGLTDDETADVAKWLF
FT                   GRPELNLTTTENAGEWDNTIALIELHRPNKSEAIPYLDGSGPAPTRHAHVRLNNRATTD
FT                   PYFADILVGPLPVSNATTWEPLEFPYTRKTQGQVRNVEPDGETVYSEWLFKISASIADI
FT                   TLDLWNGTALGLENDTLDIWGIDPLWQDDGRIIRWDMFWNMADDEFDSETLLPLGLYLK
FT                   SDVTGRDPSQWKLLGWMYNDIFYETTEEFRKAYWSPGFVKLKPNVDGAWAHTEQRGPVP
FT                   PQDRKQPPVMIAPDGARYSVDAERKYVTWMDFSFYIAFNRDTGLSLFDIKYKGQRVLYE
FT                   LGLQEALAHYAANDPVQSSVAYLDSYYGFGPYAFELLKGYDCPSYASYLNTSFYKDEET
FT                   HTHVDSLCLFEFDADYPMARHSTSEFVSVTKNVYFTLRSVSTIGNYDYMFSYNFHMDGT
FT                   IGVEVRASGYIQSAYYANNQDFGYQIHDSLSGSMHDHVLNFKADFDILGPNNTIELVSV
FT                   VPVTKQFSWSGNKTRNTMQLGRSFIHSEDEARLNWGFNGQTQLHVVNQDKPNKFGEPRG
FT                   YRILPSAGTAHLTVLNSSNLVHAAHWAEYDVQVTRQHDFEPTSAHPYNSQDIHNPPVDF
FT                   STFFNGESLNQTDLVVWLNLGMHHVPHTGDLPNTVFTTAHSGVAFTPLNYLPGDPSRET
FT                   VNMVRVDYSDGAATAVRTFGQSNETCSVVLQPVENELWSYQGDVVVRKFPYDPNDPFYE
FT                   TDSDA"
FT   gene            complement(1284276..1286839)
FT                   /locus_tag="ANIA_06091"
FT                   /old_locus_tag="AN6091.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(1284276..1285308,1285374..1285464,
FT                   1285518..1285652,1285708..1285967,1286021..1286839))
FT                   /locus_tag="ANIA_06091"
FT                   /old_locus_tag="AN6091.4"
FT                   /note="transcript_id=CADANIAT00006923"
FT   CDS_pept        complement(join(1284339..1285308,1285374..1285464,
FT                   1285518..1285652,1285708..1285967,1286021..1286769))
FT                   /locus_tag="ANIA_06091"
FT                   /old_locus_tag="AN6091.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00006923"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006923"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006923"
FT                   /db_xref="GOA:C8V2L5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2L5"
FT                   /protein_id="CBF70202.1"
FT                   /translation="MPVYPIRRRPRECKTCHQCRASKVRCDRNAPCSNCVKRGFTCTYG
FT                   RPPPTLIPPRPSIAPESFAVAAALNSAPQVQISPTYSTINQDVLYAGDSSVDDSSLDTI
FT                   TISPIEWEELNSKMQEMAQVIESMKSIVQAHSRPPPRQRLSNPLSDVSGGGLIRSPSQQ
FT                   SNIYGSTTLKTGSVHIGNRSALHDILDKTKGSVGPAQALPKDDLLAELALENDNSGYPF
FT                   LDLWSSDPLHFNIGGVCDVLPDDNQCLKFFGFYKSIAAVLYPVLPDIDRFENDLKRLLE
FT                   GRRRAGGVYKPDGDRLLKPFGMSIAFLSLCFAVFASGCQLCDLPGIQREMTSWIYISCS
FT                   YQCLRMLNYVSQPTVEVIQILLIISSVLSYNMNAGASYTLLGMTERMCMVLGLHAEAPG
FT                   YPSALQEARRRVWWAMAFQNSHFSLAYDRPSITMISQPDIPYHRKSMPGHRSYFETLSR
FT                   ILGVVLETLRVLMMTKQSYLQPKEIGMYVQRIRDILGEAAAHLRDQGRCTKLADSIEWA
FT                   ELRLHSSYYISLLCRPSLDPDAIMSAEDRKNIRHDCLTNLLGTVEAFLDLHMISPYASR
FT                   TWISVQRTIASAFLLIANTNDQVLPRTQDLLRRLEKVLEDHVYTDGTVNPTTRTDTARH
FT                   LSSSLEALRAVNSAFSAGKRHGKKQNAAPLKDESAAPSAGIPTTTQFLSSAEYANLAVS
FT                   SMPPCTGSYSGISLEDGQIGDILNQVSGVMLFPNMNLGNS"
FT   gene            complement(1287800..1290467)
FT                   /locus_tag="ANIA_06090"
FT                   /old_locus_tag="AN6090.4"
FT                   /product="amino-acid N-acetyltransferase subunit Mak10,
FT                   putative (AFU_orthologue; AFUA_2G09320)"
FT   mRNA            complement(join(1287800..1288717,1288765..1288863,
FT                   1288913..1289170,1289217..1289328,1289461..1289672,
FT                   1289730..1289966,1290039..1290176,1290259..1290326,
FT                   1290398..1290467))
FT                   /locus_tag="ANIA_06090"
FT                   /old_locus_tag="AN6090.4"
FT                   /note="transcript_id=CADANIAT00006924"
FT   CDS_pept        complement(join(1287800..1288717,1288765..1288863,
FT                   1288913..1289170,1289217..1289328,1289461..1289672,
FT                   1289730..1289966,1290039..1290176,1290259..1290326,
FT                   1290398..1290467))
FT                   /locus_tag="ANIA_06090"
FT                   /old_locus_tag="AN6090.4"
FT                   /product="amino-acid N-acetyltransferase subunit Mak10,
FT                   putative (AFU_orthologue; AFUA_2G09320)"
FT                   /note="transcript_id=CADANIAT00006924"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006924"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006924"
FT                   /db_xref="GOA:Q5B040"
FT                   /db_xref="InterPro:IPR007244"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B040"
FT                   /protein_id="CBF70204.1"
FT                   /translation="MTRIVSQSVVPRDITEEFTQAASKLKTGQLVKDEHFTLFEAVGAL
FT                   EIMDPKMDSGYLGPEEKGQGLEDDYDILRELTPEEVVWIMDELLCHEMAWHMGHPLSQT
FT                   LFTSLYLDKLLWPIPKNIEDAHFGREGLSVGREQPDLVHIVLRAYCLALVKCCDFVHAR
FT                   VTSEFYYEEEDFSTQLYNRTLLSHFAYEHFPSLLNRAISWIDEQESIDAAAKSAIKSRL
FT                   LFRQEFLLGLQQDINILETRPVVKISFEDALAHLERLCQDGIHLNQILDYRGPYNLKVA
FT                   IWTLLSRKPQPSVYIRSLVQSIIMDQSTVLGSVPVKQFLYDELAALVLPSSILLEASLD
FT                   ETEVPSDPRFQIAQLMDGFVRRFSQPFVDTFRSACLNRCRIRRTVCHTLADWDNLQMEA
FT                   EDLDEQLRTLSEEPPLSLPNGDTTYSYPLSSWAYHQKLIQFRLILQLGFELSIYGPEEL
FT                   PGMYWYLSHICSTHLGHIDRIRTFILAAVQRNRRSPTQHATLRSSFLLFDRLTTQIVAI
FT                   DAFAIALHALYVLLSRHRILPTASAPNAYSNDQFRYELRMKPFLQITLPELVPYEEYRR
FT                   EATLQGDSDEIVMERATKAIGEARKAWEATLANGPFDNFNDEKPDAPALEEDWKRDVKD
FT                   TMRACIGASIAIETVKKAIANNATGDAESLGLRVNIPDAGSKNRWHDWWAVPQVSQVQT
FT                   QSPSTTSKS"
FT   gene            complement(1290711..1291318)
FT                   /locus_tag="ANIA_11499"
FT                   /old_locus_tag="AN11499.4"
FT                   /product="Mitochondrial ATP synthase epsilon chain
FT                   domain-containing protein (AFU_orthologue; AFUA_2G09310)"
FT   mRNA            complement(join(1290711..1290980,1291050..1291164,
FT                   1291238..1291318))
FT                   /locus_tag="ANIA_11499"
FT                   /old_locus_tag="AN11499.4"
FT                   /note="transcript_id=CADANIAT00006925"
FT   CDS_pept        complement(join(1290903..1290980,1291050..1291164,
FT                   1291238..1291269))
FT                   /locus_tag="ANIA_11499"
FT                   /old_locus_tag="AN11499.4"
FT                   /product="Mitochondrial ATP synthase epsilon chain
FT                   domain-containing protein (AFU_orthologue; AFUA_2G09310)"
FT                   /note="transcript_id=CADANIAT00006925"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006925"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006925"
FT                   /db_xref="GOA:C8V2L7"
FT                   /db_xref="InterPro:IPR006721"
FT                   /db_xref="InterPro:IPR036742"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2L7"
FT                   /protein_id="CBF70206.1"
FT                   /translation="MVFAWKSAGLTYNRYLAVAARAVRRSLQDGPRLAAERRGNMDLRF
FT                   AKWENGKQGEVKNLAEANDQAIAAQAEKK"
FT   gene            1293443..1295861
FT                   /locus_tag="ANIA_06089"
FT                   /old_locus_tag="AN6089.4"
FT                   /product="Heat shock protein 60 Precursor (60 kDa
FT                   chaperonin)(Protein Cpn60)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B041]"
FT   mRNA            join(1293443..1293711,1293816..1293957,1294046..1295861)
FT                   /locus_tag="ANIA_06089"
FT                   /old_locus_tag="AN6089.4"
FT                   /note="transcript_id=CADANIAT00006926"
FT   CDS_pept        join(1293601..1293711,1293816..1293957,1294046..1295559)
FT                   /locus_tag="ANIA_06089"
FT                   /old_locus_tag="AN6089.4"
FT                   /product="Heat shock protein 60 Precursor (60 kDa
FT                   chaperonin)(Protein Cpn60)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B041]"
FT                   /note="transcript_id=CADANIAT00006926"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006926"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006926"
FT                   /db_xref="GOA:Q5B041"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B041"
FT                   /protein_id="CBF70208.1"
FT                   /translation="MQRALSSRTSVLSAASKRAAFTKPAGLNLQQQRFAHKELKFGVEA
FT                   RAQLLKGVDTLAKAVTSTLGPKGRNVLIESPYGSPKITKDGVTVAKAVQLQDKFENLGA
FT                   RLLQDVASKTNELAGDGTTTATVLARAIFSETVKNVAAGCNPMDLRRGIQAAVEAAVDY
FT                   LQQNKRDITTGEEIAQVATISANGDTHVGKLISTAMERVGKEGVITVKEGKTLEDELEV
FT                   TEGMRFDRGYTSPYFITDAKAQKVEFEKPLILLSEKKISAVQDIIPALEASTTLRRPLV
FT                   IIAEDIEGEALAVCILNKLRGQLQVAAVKAPGFGDNRKSILGDLGVLTNGTVFTDELDI
FT                   KLEKLTPDMLGSTGSITITKEDTIILNGEGSKDAIAQRCEQIRGVMADPTTSEYEKEKL
FT                   QERLAKLSGGVAVIKVGGASEVEVGEKKDRVVDALNATRAAVEEGILPGGGTALLKAAA
FT                   NGLENVKPANFDQQLGVSIVKSAITRPARTIVENAGLEGSVIVGKLTDEFSKDFNRGFD
FT                   SAKGEYVDMIAAGIVDPLKVVRTALVDASGVSSLLGTTEVAIVEAPEEKGPAAPGGMGG
FT                   MGGMGGMGGGMF"
FT   gene            complement(1296106..1300226)
FT                   /locus_tag="ANIA_06088"
FT                   /old_locus_tag="AN6088.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1296106..1296635,1296708..1296811,
FT                   1296882..1297009,1297095..1297463,1297523..1298146,
FT                   1298262..1298424,1298484..1298690,1298747..1299867,
FT                   1299921..1300131,1300198..1300226))
FT                   /locus_tag="ANIA_06088"
FT                   /old_locus_tag="AN6088.4"
FT                   /note="transcript_id=CADANIAT00006927"
FT   CDS_pept        complement(join(1296106..1296635,1296708..1296811,
FT                   1296882..1297009,1297095..1297463,1297523..1298146,
FT                   1298262..1298424,1298484..1298690,1298747..1299867,
FT                   1299921..1300131,1300198..1300226))
FT                   /locus_tag="ANIA_06088"
FT                   /old_locus_tag="AN6088.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00006927"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006927"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006927"
FT                   /db_xref="GOA:C8V2L9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039182"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2L9"
FT                   /protein_id="CBF70209.1"
FT                   /translation="MAGDIITNVDIVAIPAIGADRGGAWTGEDTQSPWLTTELRRFIPN
FT                   ARVLLLDHGELGVEDTLDSLATRLLNKLQEARKSTSRRRPIFFICHSTGGVVATAALVK
FT                   ASRSPSPLDSVFSSCYGIAFFGTPHYGSSYLSAPEFGRSIHRLLRLKHTIPTGLRETFK
FT                   PRHEQLQRLAGQFRAISADMKIWTFLETVDSVFTITDTETGSTIDMHVPITSIRSGLLG
FT                   FEHESELPLATDHVGTASFKGQEATARMDFIRDLQSSISTALELSIMSDVPLQVEQEVM
FT                   VHVNGFFEDTARGVSRESPLQLWSTKTPLEQFLETGPTKCLEERLKTSTRLSSGTLDSD
FT                   TSDFSRPTSAPAELSQIDSRLRDPDIISLEVVPSRPSVKRSRSFLAQHPSQQQPSPRIH
FT                   VTEPPIEGYFDIQSEGSASERRISHEDSGDEGTENDEIEASDNLGTISPSQRNLLSSLS
FT                   SRYREFLNVPFMERTPEERPRMIPRFDRPEPGTEKMIWVHVPYTHTDWVPAVLSKTCKG
FT                   KTKQNLFRKLVNPDNWYSNLITARHLEPHARYVRPACIHFKLDSPPIKASEPHDPQLAL
FT                   YLHWDTYWNLLQRRRVIEERLRQGRSRPVPDDISRSSLESKLIWKYLGNEPPIHIRRTL
FT                   DQFGYPNLRSTVARDDDQMLWKRTRKAINLVDELGNSLPLHDRSDLQSSVFVDGKVLMV
FT                   DQLWLWIVDQKTVVTFFPKQEPTTVEGKFYEQTNLFNSIYNELNGDLARRFETAGDLAA
FT                   LIVLHAVTVLFDRTLHSDLQILRIFEESISILTELTTKSFKQFRNRGFVTRPAEYNKTR
FT                   EGRIMTAAEREERDREVAQQNRNDLSSMLELRDIVDELGTIMKLLEQQTSTINDMAKYF
FT                   EHRGYGKRFILASLARLDEYRTHISEMRENAIAAQKAVENLLDLKQKQANVDESRLARW
FT                   EAEVTQSQSRAVMVFTIFTVIFLPLSFFTSLFGINAREWSGEPTNLTLQTMLIIAGPTS
FT                   IAVIVSALLIAFSERLRDTLLKFQKIIFGLCKDLIFTPLAAFFHQTYQRDQKSPRRSKS
FT                   SLASTTKTSKTSRIGDRFGRYLASWRYRGDTEEDFWRRDDEREKGGYSSSATASNLNGA
FT                   GYVARRTEGTGEGMTLPSVLVSEASGHAASNGHGGYVDRMRGPLDGMVRERHPA"
FT   gene            complement(1300685..1302630)
FT                   /locus_tag="ANIA_06087"
FT                   /old_locus_tag="AN6087.4"
FT                   /product="mitochondrial carrier protein, putative
FT                   (AFU_orthologue; AFUA_2G09250)"
FT   mRNA            complement(join(1300685..1302165,1302239..1302630))
FT                   /locus_tag="ANIA_06087"
FT                   /old_locus_tag="AN6087.4"
FT                   /note="transcript_id=CADANIAT00006928"
FT   CDS_pept        complement(join(1301006..1302165,1302239..1302479))
FT                   /locus_tag="ANIA_06087"
FT                   /old_locus_tag="AN6087.4"
FT                   /product="mitochondrial carrier protein, putative
FT                   (AFU_orthologue; AFUA_2G09250)"
FT                   /note="transcript_id=CADANIAT00006928"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00006928"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00006928"
FT                   /db_xref="GOA:C8V2M0"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C8V2M0"
FT                   /protein_id="CBF70211.1"
FT                   /translation="MSSPGTQGTSWDRYRSNNLTSIELDGHSAETWNWAAEDTDMAATS
FT                   GTGSVSTVEASPAGEVSITQKMVSATCGSVLTGLLVTPLDVVRVRLQSQSPIKNTSPFT
FT                   SHTTPTLKNAPPNLGVTACCREVFWGGQNSEICMVGPSGSALGATSQSVAECAVEETQR
FT                   RTFTSTLDGLRKIARNEGVLTLWRGLSPTLMMGIPGNVIYFAGYDWLRTDDRSPIKRVV
FT                   PGAYVPFVAGAVARVAAATAISPIEMFRTRLQATPGTGAGHFKATLEGLYQMTQAKGYG
FT                   SLWRGFTLTMWRDVPFSGLYWWGYEEVKKSIIEVRKKARGHNPPQTAPSSTQLGTSDVE
FT                   GNTFLDSFVAGSISGALAALVTTPFDVGKTRQQVFRHMGDDAPSTAGSKLPKGPLQPEQ
FT                   LSLPKFLLHIFREEGAAGLFRGWVARCLKVAPACAIMISTYEVGKKFARDVNERRQSPP
FT                   DGNVSDAS"
FT   gene            1302825..1304588
FT                   /locus_tag="ANIA_06086"
FT