(data stored in ACNUC27125 zone)

EMBL: BN001303

ID   BN001303; SV 1; linear; genomic DNA; STD; FUN; 3412996 BP.
XX
AC   BN001303;
XX
PR   Project:PRJEA40559;
XX
DT   24-SEP-2009 (Rel. 102, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   TPA: Aspergillus nidulans FGSC A4 chromosome III
XX
KW   Third Party Data; TPA; TPA:reassembly.
XX
OS   Aspergillus nidulans FGSC A4
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RG   the Eurofungbase Aspergillus nidulans re-annotation project
RA   Mabey Gilsenan J.;
RT   ;
RL   Submitted (09-SEP-2009) to the INSDC.
RL   Mabey Gilsenan J.E., School of Medicine, University of Manchester, ERC,
RL   University Hospital of South Manchester, Manchester, M23 9LT, UK
XX
RN   [2]
RP   1-3412996
RA   Russo Wortman J., Mabey Gilsenan J., Joardar V., Deegan J., Clutterbuck J.,
RA   Andersen M.R., Archer D., Bencina M., Braus G., Coutinho P., von Dohren H.,
RA   Doonan J., Driessen A.J.M., Durek P., Espeso E., Fekete E., Flipphi M.,
RA   Garcia Estrada C., Geysens S., Goldman G., de Groot P.W.J., Hansen K.,
RA   Harris S.D., Heinekamp T., Helmstaedt K., Henrissat B., Hofmann G.,
RA   Homan T., Horio T., Horiuchi H., James S., Jones M., Karaffa L.,
RA   Karanyi Z., Kato M., Keller N., Kelly D.E., Kiel J.A.K.W., Kim J-M.,
RA   van der Klei I.J., Klis F.M., Kovalchuk A., Krasevec N., Kubicek C.P.,
RA   Liu B., MacCabe A., Meyer V., Mirabito P., Miskei M., Mos M., Mullins J.,
RA   Nelson D.R., Nielsen J., Oakley B.R., Osmani S.A., Pakula T., Paszewski A.,
RA   Paulsen I., Pilsyk S., Posci I., Punt P.J., Ram A.F.J., Ren Q.,
RA   Robellet X., Robson G., Seiboth B., van Solingen P., Specht T., Sun J.,
RA   Taheri-Talesh N., Takeshita N., Ussery D., vanKuyk P.A., Visser H.,
RA   van der Vondervoot P.J.I., de Vries R.P., Walton J., Xiang X., Xiong Y.,
RA   Ping Zeng A., Brandt B.W., Cornell M.J., van den Hondel C.A.M.J.J.,
RA   Visser J., Oliver S.G., Turner G.;
RT   "The 2008 update of the Aspergillus nidulans genome annotation: A community
RT   effort";
RL   Fungal Genet. Biol. 46(1):S2-S13(2009).
XX
DR   MD5; d021d369b09a695b2091aaae3c724c18.
DR   BioSample; SAMEA2272224.
DR   CABRI; LMBP 2360.
DR   EnsemblGenomes-Gn; CADANIAG00005474.
DR   EnsemblGenomes-Gn; CADANIAG00010565.
DR   EnsemblGenomes-Gn; CADANIAG00010566.
DR   EnsemblGenomes-Gn; CADANIAG00010567.
DR   EnsemblGenomes-Gn; CADANIAG00010568.
DR   EnsemblGenomes-Gn; CADANIAG00010569.
DR   EnsemblGenomes-Gn; CADANIAG00010570.
DR   EnsemblGenomes-Gn; CADANIAG00010571.
DR   EnsemblGenomes-Gn; CADANIAG00010610.
DR   EnsemblGenomes-Gn; CADANIAG00010612.
DR   EnsemblGenomes-Gn; CADANIAG00010629.
DR   EnsemblGenomes-Gn; CADANIAG00010633.
DR   EnsemblGenomes-Gn; CADANIAG00010648.
DR   EnsemblGenomes-Gn; CADANIAG00010656.
DR   EnsemblGenomes-Gn; CADANIAG00010666.
DR   EnsemblGenomes-Gn; CADANIAG00010697.
DR   EnsemblGenomes-Gn; CADANIAG00010706.
DR   EnsemblGenomes-Gn; CADANIAG00010721.
DR   EnsemblGenomes-Gn; CADANIAG00010751.
DR   EnsemblGenomes-Gn; CADANIAG00010756.
DR   EnsemblGenomes-Gn; CADANIAG00010757.
DR   EnsemblGenomes-Gn; CADANIAG00010779.
DR   EnsemblGenomes-Gn; CADANIAG00010802.
DR   EnsemblGenomes-Gn; CADANIAG00010806.
DR   EnsemblGenomes-Gn; CADANIAG00010810.
DR   EnsemblGenomes-Gn; CADANIAG00010815.
DR   EnsemblGenomes-Gn; CADANIAG00010826.
DR   EnsemblGenomes-Gn; ENSRNA049496380.
DR   EnsemblGenomes-Gn; ENSRNA049496397.
DR   EnsemblGenomes-Gn; ENSRNA049496398.
DR   EnsemblGenomes-Gn; ENSRNA049496399.
DR   EnsemblGenomes-Gn; ENSRNA049496408.
DR   EnsemblGenomes-Gn; ENSRNA049496410.
DR   EnsemblGenomes-Gn; ENSRNA049496413.
DR   EnsemblGenomes-Gn; ENSRNA049496415.
DR   EnsemblGenomes-Gn; ENSRNA049496417.
DR   EnsemblGenomes-Gn; ENSRNA049526517.
DR   EnsemblGenomes-Gn; ENSRNA049526533.
DR   EnsemblGenomes-Gn; ENSRNA049526557.
DR   EnsemblGenomes-Gn; ENSRNA049526577.
DR   EnsemblGenomes-Gn; ENSRNA049526606.
DR   EnsemblGenomes-Gn; ENSRNA049526623.
DR   EnsemblGenomes-Gn; ENSRNA049526644.
DR   EnsemblGenomes-Gn; ENSRNA049526661.
DR   EnsemblGenomes-Gn; ENSRNA049526681.
DR   EnsemblGenomes-Gn; ENSRNA049526709.
DR   EnsemblGenomes-Gn; ENSRNA049526732.
DR   EnsemblGenomes-Tr; CADANIAT00005474.
DR   EnsemblGenomes-Tr; CADANIAT00010565.
DR   EnsemblGenomes-Tr; CADANIAT00010566.
DR   EnsemblGenomes-Tr; CADANIAT00010567.
DR   EnsemblGenomes-Tr; CADANIAT00010568.
DR   EnsemblGenomes-Tr; CADANIAT00010569.
DR   EnsemblGenomes-Tr; CADANIAT00010570.
DR   EnsemblGenomes-Tr; CADANIAT00010571.
DR   EnsemblGenomes-Tr; CADANIAT00010610.
DR   EnsemblGenomes-Tr; CADANIAT00010612.
DR   EnsemblGenomes-Tr; CADANIAT00010629.
DR   EnsemblGenomes-Tr; CADANIAT00010633.
DR   EnsemblGenomes-Tr; CADANIAT00010648.
DR   EnsemblGenomes-Tr; CADANIAT00010656.
DR   EnsemblGenomes-Tr; CADANIAT00010666.
DR   EnsemblGenomes-Tr; CADANIAT00010697.
DR   EnsemblGenomes-Tr; CADANIAT00010706.
DR   EnsemblGenomes-Tr; CADANIAT00010721.
DR   EnsemblGenomes-Tr; CADANIAT00010751.
DR   EnsemblGenomes-Tr; CADANIAT00010756.
DR   EnsemblGenomes-Tr; CADANIAT00010757.
DR   EnsemblGenomes-Tr; CADANIAT00010779.
DR   EnsemblGenomes-Tr; CADANIAT00010802.
DR   EnsemblGenomes-Tr; CADANIAT00010806.
DR   EnsemblGenomes-Tr; CADANIAT00010810.
DR   EnsemblGenomes-Tr; CADANIAT00010815.
DR   EnsemblGenomes-Tr; CADANIAT00010826.
DR   EuropePMC; PMC3892141; 24375164.
DR   GOA; P11837.
DR   GOA; Q5ASI4.
DR   GOA; Q5ASN8.
DR   GOA; Q5ASP0.
DR   GOA; Q5ASQ0.
DR   GOA; Q5B4S6.
DR   InterPro; IPR001245; Ser-Thr/Tyr_kinase_cat_dom.
DR   InterPro; IPR002715; Nas_poly-pep-assoc_cplx_dom.
DR   InterPro; IPR012471; DUF1690.
DR   InterPro; IPR013740; Redoxin.
DR   InterPro; IPR013766; Thioredoxin_domain.
DR   InterPro; IPR037944; PRX5-like.
DR   InterPro; IPR038187; NAC_A/B_dom_sf.
DR   InterPro; IPR039370; BTF3.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00004; U2.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00030; RNase_MRP.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF01496; Afu_182.
DR   StrainInfo; 598196; 0.
DR   UniProtKB/Swiss-Prot; P11837; NIMA_EMENI.
DR   UniProtKB/Swiss-Prot; Q5ASI4; NACB_EMENI.
DR   UniProtKB/Swiss-Prot; Q5ASN8; PRX5_EMENI.
DR   UniProtKB/Swiss-Prot; Q5ASP0; MIC19_EMENI.
DR   UniProtKB/Swiss-Prot; Q5ASQ0; PPIL1_EMENI.
DR   UniProtKB/Swiss-Prot; Q5B4S6; COX23_EMENI.
XX
CC   Aspergillus nidulans FGSC A4 CADRE,
CC   updated by Eurofungbase with contributions from
CC   CADRE (http://www.cadre-genomes.org.uk),
CC   AspGD (http://www.aspergillusgenome.org) and
CC     Ensembl Genomes (http://www.ensemblgenomes.org).
XX
AH   LOCAL_SPAN       PRIMARY_IDENTIFIER   PRIMARY_SPAN   COMP
AS   1-112247         AACD01000086.1       1-112247       c
AS   112348-146878    AACD01000085.1       1-34531        c
AS   146979-767837    AACD01000084.1       954-621812     c
AS   767838-771823    AACD01000233.1       996-4981       c
AS   771824-826838    AACD01000083.1       1-55015        c
AS   826939-871283    AACD01000082.1       641-44985      c
AS   871284-881188    AACD01000183.1       1-9905
AS   881189-1035823   AACD01000081.1       1629-156263    c
AS   1035824-1042768  AACD01000201.1       1-6945
AS   1042769-1376361  AACD01000080.1       1848-335440    c
AS   1376362-1585225  AACD01000079.1       190-209053     c
AS   1585226-1589285  AACD01000238.1       585-4644       c
AS   1589286-1942083  AACD01000078.1       659-353456     c
AS   1942084-1953480  AACD01000179.1       1-11397
AS   1953481-2086003  AACD01000077.1       1-132523       c
AS   2086104-2239313  AACD01000076.1       1-153210       c
AS   2239414-2452906  AACD01000075.1       1-213493       c
AS   2453007-2463364  AACD01000074.1       2030-12387     c
AS   2463365-2467287  AACD01000073.1       1-3923         c
AS   2467388-2485203  AACD01000072.1       1-17816        c
AS   2485304-2577227  AACD01000163.1       1-91924        c
AS   2577328-2641557  AACD01000162.1       773-65002      c
AS   2641558-2649245  AACD01000198.1       1-7688         c
AS   2649346-2914992  AACD01000161.1       621-266267     c
AS   2914993-2920707  AACD01000214.1       865-6579       c
AS   2920708-3065866  AACD01000160.1       1822-146980    c
AS   3065867-3123491  AACD01000159.1       662-58286      c
AS   3123492-3129659  AACD01000209.1       1-6168
AS   3129660-3412996  AACD01000158.1       1-283337       c
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3412996
FT                   /organism="Aspergillus nidulans FGSC A4"
FT                   /chromosome="III"
FT                   /strain="FGSC A4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:227321"
FT   misc_feature    1..112247
FT                   /note="contig 1.86 1..112247(-1)"
FT   gene            19..1365
FT                   /locus_tag="ANIA_05093"
FT                   /old_locus_tag="AN5093.4"
FT                   /product="serine-leucine-rich repeat protein
FT                   (AFU_orthologue; AFUA_8G02230)"
FT   mRNA            join(19..657,698..831,927..1044,1102..1365)
FT                   /locus_tag="ANIA_05093"
FT                   /old_locus_tag="AN5093.4"
FT                   /note="transcript_id=CADANIAT00005287"
FT   CDS_pept        join(19..657,698..831,927..1044,1102..1365)
FT                   /locus_tag="ANIA_05093"
FT                   /old_locus_tag="AN5093.4"
FT                   /product="serine-leucine-rich repeat protein
FT                   (AFU_orthologue; AFUA_8G02230)"
FT                   /note="transcript_id=CADANIAT00005287"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005287"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005287"
FT                   /db_xref="GOA:Q5B2Y7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B2Y7"
FT                   /protein_id="CBF76093.1"
FT                   /translation="MATSAPQTLICRCSTDLTSPLSPPSLTPTIINAKSKRRYYHNQQW
FT                   EQECVLQASLITALPQYPAPLDSMDELVIAKPAADTNNSHNNNNNSHNNNNNNNNTNTN
FT                   SNNSQDADSNADSDHNSNSDQNQQKPIIETTDDHSVDDQHIDTVSDSDEPSSPIMGIGL
FT                   RPISKPVSVVVDNTRRKRRARSLVASEDDDVAAPSTRQKRARANKYLTRKTQKAIQAAA
FT                   RVRDPESKTLTPSSPIAPASAVRKTSSSLTQPLARCLVRRALSLARMPRTKEAAHQTLK
FT                   FRFDIDAELQKANKQKFWRQVQLSVLYHTFQLRNEIRSLKNFAPVPASEMLVGLDEFDN
FT                   ALAAGADNDLDFLEEDDDDNHNVEEDDDDDNNNNNDRDSNDDDE"
FT   gene            complement(1860..7010)
FT                   /locus_tag="ANIA_05092"
FT                   /old_locus_tag="AN5092.4"
FT                   /product="telomere-associated RecQ helicase, putative
FT                   (AFU_orthologue; AFUA_6G14720)"
FT   mRNA            complement(join(1860..2633,2685..5006,5166..6522,
FT                   6559..7010))
FT                   /locus_tag="ANIA_05092"
FT                   /old_locus_tag="AN5092.4"
FT                   /note="transcript_id=CADANIAT00005288"
FT   CDS_pept        complement(join(1963..2633,2685..5006,5166..6522,
FT                   6559..6924))
FT                   /locus_tag="ANIA_05092"
FT                   /old_locus_tag="AN5092.4"
FT                   /product="telomere-associated RecQ helicase, putative
FT                   (AFU_orthologue; AFUA_6G14720)"
FT                   /note="transcript_id=CADANIAT00005288"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005288"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005288"
FT                   /db_xref="GOA:Q5B2Y8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022698"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B2Y8"
FT                   /protein_id="CBF76095.1"
FT                   /translation="MSHLLFETIPELQIMVCRQCKHGVHLIEVETHLYRKHFMTSLQIQ
FT                   PVLETVQQWTNLIRDPGAVEIPRALDHPLPILPVSTNGMQCRRDLDCPYIATNLNTMHN
FT                   HWQQVHGWTQYKRRGRAKQSYHMVAWQQVFPTRKNSHLVHIRSCDPTPDEPPVPTTAHQ
FT                   QIAAEIKARAANNKQLATCRTAESDTLHDANPWLRMTRWARYLADVHFQDLLDVVTPPD
FT                   CDENDATLHEQGDPVSQATQRVWDAMGQLARRSQRTVQHCGNGIHMTAASTMPNQIPHQ
FT                   PLRAYMDETSIAKHMRPWQQILLFIIRTQTEWPWRQKKPSYVMTARQQWTWQRLWQHAC
FT                   RSDKAGASPASRQSPDPMDDRLEAFVMTPLETACLDFCIELLNQKTKVHKYESPLVCAM
FT                   AVLGRGEQGWRDADSYPLILSRVLKVARFLVVQKALWLDPQHWAIIQMWAAAAEQGSWM
FT                   GEAADQELAWLFEDKGYAEASSPSSPSSPETVSASQGRTIGCIRSRSFQTGVDWMVQRF
FT                   MVRGQHGPVKVLLDWRTYGLKVHYNTTAPGHVTWMGQERLLYKQMEFTIGQFRGFVHAG
FT                   KTWLVDRISTEPAVARAFITQGAVSANKVQKYFQQVARFKEKLAVAVHLTSGAPARVPE
FT                   LLSIQHVNTDNNWRRNIFIKDSLVVFVTAYHKGFYASNDVKIIHRYLPREVGELVMWYL
FT                   WLVLPFVRQLAVTWRQVMFSSTSQGSNASELPTHHSSYLWGPDVGTGREWSSERLREVL
FT                   KRESETSISAQYPLNIANYRDIAIGISRRFLRASSVFPNNIQAEREQAMAALEADEDLD
FT                   EMGNIADEQAGHSPHVAAMVYGRKSSKLAGSTTTRRLRFRASSTDWHRFLGFPDPLPVN
FT                   TVLGKRANPWEEQAVDHQEQQQQQLAQTDMAQALQRMTGRPALQLRGVQAPALKAIQDG
FT                   ASPVVAIMPTGSGKSMLFMLPAYAAPGGCTIMVVPLLSLRADLMMRCQALGISCVSWES
FT                   RRPPDEAAIVLVTPESTENPDFHTFLNRQRQMRRLDRIVIDECHVILNDQKDFQPAMAR
FT                   LGRLVSAQTQLVFLTAMLPPIEEARFLRRIKHQRSEVGIHRARTSRRNVAYRMVRPSLP
FT                   RGVPRKPHQWLTQPNVRGFIQQRIQQAGDGQVIVYANIKSQVDAISCELGCEAYHSAVL
FT                   DQTGVMQRFQSSQTRIIAATSALGMGIDIPDIRCVIHLGRPRTLLDYSQESGRAGRDGL
FT                   ASKAVIVHPQGWDDLDPWVDRVSDAEFEHIQAYMEVVEGVGCRRYVLDQYLDGTVDGYT
FT                   RQQCQDQDPDKLPCDACRPDRQDERTPTPSPSLSPAASAAECNVDMSNRPNDPPNAQNR
FT                   PVLLDLPRSAAVAPSFKALAPPAAVSTVPADGMTPAQYQHTTIRQQTATVQWGLDREFL
FT                   EQEAWRWLHQYYICTVAGRDGNHELYNCRHPDSQTAKQWMVQLRSQIDYAPFRCYFQCG
FT                   MPQSVCQGWQAGQECLWRGALISTIAGMLYGPHGAQVQSAWQRHLAGRMVEQRMVYAQK
FT                   ARRQVDAHVVDVQEVTSVAAFLGQATADRQGMEMQAAFCWLRRVCQECEAA"
FT   gene            complement(10124..11768)
FT                   /locus_tag="ANIA_05091"
FT                   /old_locus_tag="AN5091.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(10124..10361,10416..10853,10899..10939,
FT                   11003..11120,11368..11443,11675..11768))
FT                   /locus_tag="ANIA_05091"
FT                   /old_locus_tag="AN5091.4"
FT                   /note="transcript_id=CADANIAT00005289"
FT   CDS_pept        complement(join(10124..10361,10416..10853,10899..10939,
FT                   11003..11120,11368..11443,11675..11768))
FT                   /locus_tag="ANIA_05091"
FT                   /old_locus_tag="AN5091.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005289"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005289"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005289"
FT                   /db_xref="GOA:C8V7Y1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8V7Y1"
FT                   /protein_id="CBF76097.1"
FT                   /translation="MSLDPVDEIMPIFPLLEASILGDRPTPQPAHFRVSTVISQNHADP
FT                   FCAYPVPMSNAIKPKITQRLLTISNERRQNLERSSAGSRDCGGRVYSVNPQAILDVGTG
FT                   TGIWAIDVADAFPAARVTGLDLSPIQPTFVPPTCSFEIDDVTMPWTYDTEQFDLIYVRE
FT                   MFGSIPDWDAFLRQCWASLRPGGYIEVVEHSITPIWDADTSLGPIYALWEQTMAQVEQV
FT                   SGRSFSIWRESAQVLEGSGFQDITKRSYKWPISGWNTDPRLRELGRLNQLRLLQAIEDI
FT                   FLRHLTSTMAWPYDAVQNFIERIRSTIRDEQRHLYQPVTVVYGRKPCPSSEIL"
FT   gene            complement(12331..12658)
FT                   /pseudo
FT                   /locus_tag="ANIA_11461"
FT                   /old_locus_tag="AN11461.4"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(12331..12442,12570..12658))
FT                   /pseudo
FT                   /locus_tag="ANIA_11461"
FT                   /old_locus_tag="AN11461.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00010565"
FT                   /db_xref="PSEUDO:CBF76099.1"
FT   gene            13084..13908
FT                   /locus_tag="ANIA_05090"
FT                   /old_locus_tag="AN5090.4"
FT                   /product="hypothetical protein"
FT   mRNA            13084..13908
FT                   /locus_tag="ANIA_05090"
FT                   /old_locus_tag="AN5090.4"
FT                   /note="transcript_id=CADANIAT00005290"
FT   CDS_pept        13084..13794
FT                   /locus_tag="ANIA_05090"
FT                   /old_locus_tag="AN5090.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005290"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005290"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005290"
FT                   /db_xref="GOA:Q5B2Z0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B2Z0"
FT                   /protein_id="CBF76101.1"
FT                   /translation="MSLNTANSGLTGPVSDTTNTATTATKPVANTVKDTTSSTLPGTFP
FT                   KEEPPTNERNNVTIPSWGSLQTSFTAWLKSFIPRAVDIFETAVRRFINWLIPPARQAEM
FT                   YKTAMEHPIAATFLACQLLCVGIPFILFVAGTLLFAAVALIVWVVLSMLILGPIFLVAS
FT                   MLGVGLWGWGWFLFGLVWWLDRLVLGGVMNRFWVQQMQARKAEEEAEEMEKQRDGEDGE
FT                   KGTAKETNEEKSDG"
FT   gene            complement(14735..15349)
FT                   /locus_tag="ANIA_05089"
FT                   /old_locus_tag="AN5089.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(14735..15349)
FT                   /locus_tag="ANIA_05089"
FT                   /old_locus_tag="AN5089.4"
FT                   /note="transcript_id=CADANIAT00005291"
FT   CDS_pept        complement(14735..15349)
FT                   /locus_tag="ANIA_05089"
FT                   /old_locus_tag="AN5089.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005291"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005291"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005291"
FT                   /db_xref="GOA:Q5B2Z1"
FT                   /db_xref="InterPro:IPR041622"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B2Z1"
FT                   /protein_id="CBF76103.1"
FT                   /translation="MSESAVPRNPTSPDETFRNATACLSQKLKAQETQKFFSHQLYSII
FT                   FVLLTIVQLMVGATITALGPLSGRYMVVITILGAVTTVIAGLLAFMEGRGLPQRHRKDL
FT                   VEIRKVQTYIAGAEIKLKYGDRARAVRDVDAFIEEARARYERMQNVIDMNHPDSYADGP
FT                   QLERCNRLEGHRPVADERTPLLRAAAARATGADEEGGLGGR"
FT   gene            complement(16181..17145)
FT                   /locus_tag="ANIA_10630"
FT                   /old_locus_tag="AN10630.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(16181..16339,16402..16632,16696..17145))
FT                   /locus_tag="ANIA_10630"
FT                   /old_locus_tag="AN10630.4"
FT                   /note="transcript_id=CADANIAT00005292"
FT   CDS_pept        complement(join(16181..16339,16402..16632,16696..17145))
FT                   /locus_tag="ANIA_10630"
FT                   /old_locus_tag="AN10630.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005292"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005292"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005292"
FT                   /db_xref="GOA:C8V7Y5"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:C8V7Y5"
FT                   /protein_id="CBF76105.1"
FT                   /translation="MPLYWDQLPSWQRDNQYILSGYRTVSNSFRESFASLGYLHNETVN
FT                   IYSHLIPAILLSFFSIPLHTSLKARYTNVSTADTVVLSCFVLGAVLCLVISATFPTVQN
FT                   HSPHVARIANQMDYIGIVFLIVGSFVPSIFYGFYCQPVLQTVYLTMITSLGLLCAAVSA
FT                   TPQFRHPTWRPFRARMFIALGLSALFPVVHGVMRFGIRQMDKQIGLSWVVLQGSLYIVG
FT                   ACFYATQVPERIYPGVFDIWISSHQIFHFMVVMAIISHLYGLINAFDYNHNHLAIHC"
FT   gene            complement(18174..21847)
FT                   /locus_tag="ANIA_05088"
FT                   /old_locus_tag="AN5088.4"
FT                   /product="calcium ion P-type ATPase (Eurofung)"
FT   mRNA            complement(join(18174..18406,18483..18649,18703..18934,
FT                   19025..19166,19217..21847))
FT                   /locus_tag="ANIA_05088"
FT                   /old_locus_tag="AN5088.4"
FT                   /note="transcript_id=CADANIAT00005293"
FT   CDS_pept        complement(join(18174..18406,18483..18649,18703..18934,
FT                   19025..19166,19217..21847))
FT                   /locus_tag="ANIA_05088"
FT                   /old_locus_tag="AN5088.4"
FT                   /product="calcium ion P-type ATPase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005293"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005293"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005293"
FT                   /db_xref="GOA:Q5B2Z2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B2Z2"
FT                   /protein_id="CBF76107.1"
FT                   /translation="MAQPNFPALSRPLTPPRGGSGHPGYGTQSSSKYGNSDVRASNCTL
FT                   NKDNSVNGRGTKRPEPNGKSDSGMENNKFAFSPDQLDKLLNPKNFGAFGTFGGLRGLEK
FT                   GLRTNVQSGLSLDETVLDGTVSFNEAVSRTFVPATKSASPAPLTPSRDTIADASQDRFV
FT                   DRQRVFGTNKLPEKKLKSIWELVWIAYNDKVLILLSFAALVSLVVGIPQSVRGTGVEWV
FT                   EGAAIIAAIVVVVTVGAANDWQKERQFAKLNKKKEDRYVKVIRSGQISEVSTYDIIAGD
FT                   VMYLEPGDMIPADGILIEGHGVKCDESSVTGESDLLRKTPGDKVYEAVAQKKELKKMDP
FT                   FIMSGSSVEEGTGTFLVTATGVHTTYGRTVMSLQDEGEITPLQVKLNALADYIAKVGLT
FT                   SGLILFVVLFIKFLVRLKEIEGGAEAKGQAFLRILIVAVTIVVVAVPEGLPLAVTLALA
FT                   FATTRMIKDNNLVRLLRACETMGNATTICSDKTGTLTQNKMIVVAATLDTASQFGGQPS
FT                   LNNAASAPGSRAHSALEFVSTLSPSTKNHLLQSIALNSTAFESDRDGVTTFIGSKTETA
FT                   LLSFAREQLGLGPVAEERANAEIVQMFPFDSSRKCMAVVTCMDNGKYRMMVKGAAEILL
FT                   RQSAQIVQDATNGLAAVPLSEEAKITLDTIITDYASRSLRCIALVHRDFEKWPPHGIPT
FT                   DENEMAVFEPIFKDMTMLGIFGIQDPVREGVPDAVRQCQHAGVFVRMVTGDNIITAKAI
FT                   AQQCGIYTPGGVAIEGPEFRELSHDQMNKLIPRLQVIARSSPDDKKILVSQLKELGETV
FT                   AVTGDGTNDAQALKTADVGFAMGVAGTEVAKEASDIIIMDDNFTSIVKAIAWGRTVNDA
FT                   VKKFLQFQLTVNITAVILTFVSAVASNDEDPVLSAVQLLWVNLIMDTFAALALATDPPS
FT                   PHVLERKPEPKSAPLITLTMWKMIISQAIYQLAVTLVLNFAGQHIFPKWDSRCIQTVVF
FT                   NTFVFMQIFNQYNCRRVDNRLNVIEGILNNRWFIAIQVIIIGGQIMIIFLGGQVFSVQR
FT                   LDQPSQWAATYFIYLAPLEGPRARYLRGKPPLRVGFGSKRNPRPANVHEEGPRRTTEAY
FT                   HTQAPPNFPPVPRQLTIPAFFYAPNSS"
FT   gene            23827..24093
FT                   /locus_tag="ANIA_11460"
FT                   /old_locus_tag="AN11460.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(23827..23850,23983..24093)
FT                   /locus_tag="ANIA_11460"
FT                   /old_locus_tag="AN11460.4"
FT                   /note="transcript_id=CADANIAT00005294"
FT   CDS_pept        join(23827..23850,23983..24093)
FT                   /locus_tag="ANIA_11460"
FT                   /old_locus_tag="AN11460.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005294"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005294"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005294"
FT                   /db_xref="UniProtKB/TrEMBL:C8V7Y7"
FT                   /protein_id="CBF76109.1"
FT                   /translation="MWAIHKGQSPKPKKFVSSHVYDVITITHHPPPKSSPNLTPSLTV"
FT   gene            26174..27606
FT                   /locus_tag="ANIA_05087"
FT                   /old_locus_tag="AN5087.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(26174..26428,26481..26852,26890..27606)
FT                   /locus_tag="ANIA_05087"
FT                   /old_locus_tag="AN5087.4"
FT                   /note="transcript_id=CADANIAT00005295"
FT   CDS_pept        join(26380..26428,26481..26852,26890..27263)
FT                   /locus_tag="ANIA_05087"
FT                   /old_locus_tag="AN5087.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005295"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005295"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005295"
FT                   /db_xref="GOA:C8V7Y8"
FT                   /db_xref="UniProtKB/TrEMBL:C8V7Y8"
FT                   /protein_id="CBF76111.1"
FT                   /translation="MKTAGTRELFYREQTIANLRIVFGKDVDVVTCKQGYESRFVALAY
FT                   VVGAEGERIQVMQSSALDVTYALRDLLALSSRRVQAYFADHNHQVAKNELATCSIVLPR
FT                   KPESLLELNQPTPLKYDVLPEDEAALEEAGGDYLEAEANPGGHEAETSSSTPQYLESCN
FT                   VEQKGYSILLIIEHPFHPPFGGLRYIGAPSRQVILQAISKIMSENGLSNTVYHMKTLCV
FT                   KSDTGSYDILGYEYDHIEDLLDHVLKSEKFAKIECVYGIPAA"
FT   gene            complement(28511..29181)
FT                   /locus_tag="ANIA_05086"
FT                   /old_locus_tag="AN5086.4"
FT                   /product="Conidium-specific protein
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P19815]"
FT   mRNA            complement(28511..29181)
FT                   /locus_tag="ANIA_05086"
FT                   /old_locus_tag="AN5086.4"
FT                   /note="transcript_id=CADANIAT00005296"
FT   CDS_pept        complement(28693..29148)
FT                   /locus_tag="ANIA_05086"
FT                   /old_locus_tag="AN5086.4"
FT                   /product="Conidium-specific protein
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P19815]"
FT                   /note="transcript_id=CADANIAT00005296"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005296"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005296"
FT                   /db_xref="GOA:P19815"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19815"
FT                   /protein_id="CBF76113.1"
FT                   /translation="MAKPHCSSRSGLLALPRGGSGQPGYGTQSSSNVVGDIDVRASTHK
FT                   LNRKDNSADKGDTLRPEFSGDPDSEVENNKFAFSPGQLDKLLNPKNFGAFGAFGGLRGL
FT                   ENGLRTNVQSGLSMDETVLDGMVNFNEAVSRTFVPAPKSASPAPLAP"
FT   gene            complement(29495..30960)
FT                   /locus_tag="ANIA_10628"
FT                   /old_locus_tag="AN10628.4"
FT                   /product="SpoC1-C1C protein Fragment
FT                   [Source:UniProtKB/TrEMBL;Acc:Q00785]"
FT   mRNA            complement(join(29495..30840,30894..30960))
FT                   /locus_tag="ANIA_10628"
FT                   /old_locus_tag="AN10628.4"
FT                   /note="transcript_id=CADANIAT00005297"
FT   CDS_pept        complement(join(29537..30840,30894..30960))
FT                   /locus_tag="ANIA_10628"
FT                   /old_locus_tag="AN10628.4"
FT                   /product="SpoC1-C1C protein Fragment
FT                   [Source:UniProtKB/TrEMBL;Acc:Q00785]"
FT                   /note="transcript_id=CADANIAT00005297"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005297"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005297"
FT                   /db_xref="GOA:C8V7Z0"
FT                   /db_xref="InterPro:IPR020864"
FT                   /db_xref="UniProtKB/TrEMBL:C8V7Z0"
FT                   /protein_id="CBF76115.1"
FT                   /translation="MDTPPEILPACELLGRGITLFPGSNLFDYLEILGGVEKVQLLNFN
FT                   LNNKPTTVPGSNKQYLVPEDVFILPAGTEIIAENLLCTTGAALANELAINPSMAYRYFG
FT                   ISAERNGKIGYRVSFNDRYLFGLWSIGDLNYTVQFDMQSLERCINADFIWAARRLPCWD
FT                   ENDASARDAFAKFFATWGTHVTTGCCLGARYQLQVTRPDASDESKKNFHEHIETEYSSV
FT                   LGINGGTRDTAQYREYLGRRESKCSVMGGHPQLKRSLSRDPTNSRLFSQWIRSIGASGT
FT                   QDVIHVLADSIYNFLLRSPNPEHKEIGDKIQRASRFHSKFITATGVFKVKGIGGATGRV
FT                   SSCEVRGAPGISLQVIPRRGTAASSLSKIKFEALQLSGDEIECDVIMSAPPLTPVEVVL
FT                   ASSKEELSQDNPFVFDLQLQLYPEHLSGAITVGLGNKGHEGKVTLPSLTAIGNYVAE"
FT   gene            complement(31167..32699)
FT                   /locus_tag="ANIA_10629"
FT                   /old_locus_tag="AN10629.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(31167..31580,31640..32493,32555..32699))
FT                   /locus_tag="ANIA_10629"
FT                   /old_locus_tag="AN10629.4"
FT                   /note="transcript_id=CADANIAT00005298"
FT   CDS_pept        complement(join(31272..31580,31640..32493,32555..32699))
FT                   /locus_tag="ANIA_10629"
FT                   /old_locus_tag="AN10629.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005298"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005298"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005298"
FT                   /db_xref="GOA:C8V7Z1"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:C8V7Z1"
FT                   /protein_id="CBF76117.1"
FT                   /translation="MTFLSPTNSTLTLPDLLVLETLLGDAESTTKGISLNRGLENCRPR
FT                   ASLTAFSSGEPRSAIEATIKRLKALNDPNDSDFDPTVVLGWDRGDFELHPFMDRWILQP
FT                   YAKLAREIVRVETDVVIITHVLLYFTTSFPSAILLFQHFHWIHGLMHWAMQAYLVGTYT
FT                   LMMHQHIHMGGLLKREFLWFDTLFPYIMDPLMGHTWNSYYYHHVKHHHVEGNGPDDLSS
FT                   TIRYQRDELFDFLCYISRFLFLTWLELPLYFVRKGKFSFAFKTAAWEFGYYIFLYLFWR
FT                   YICWKATIFVFILPLLQLRLGLMVGNWGQHAFVDEANPKSDFRSSVTVIDVASNRFCYN
FT                   DGYHTSHHLNPLRHWREHPVSFLQQKDRYSAEDALVFQNIDYIMITNRLLQKDYKYLAE
FT                   CLVPIGNQVGMTVDELAIMLRKKTRRFSAMDIRSKF"
FT   gene            complement(35596..37465)
FT                   /locus_tag="ANIA_10626"
FT                   /old_locus_tag="AN10626.4"
FT                   /product="hypothetical protein similar to ATP synthase
FT                   alpha chain (Broad)"
FT   mRNA            complement(35596..37465)
FT                   /locus_tag="ANIA_10626"
FT                   /old_locus_tag="AN10626.4"
FT                   /note="transcript_id=CADANIAT00005299"
FT   CDS_pept        complement(35780..37465)
FT                   /locus_tag="ANIA_10626"
FT                   /old_locus_tag="AN10626.4"
FT                   /product="hypothetical protein similar to ATP synthase
FT                   alpha chain (Broad)"
FT                   /note="transcript_id=CADANIAT00005299"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005299"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005299"
FT                   /db_xref="GOA:C8V7Z2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:C8V7Z2"
FT                   /protein_id="CBF76119.1"
FT                   /translation="MPENYLIMSKSTWQSLNRLATATLIPRRGRSTSNPTSSLAILWKQ
FT                   PFSSGRCVKCPSGEISSLLEQRIRGLKGSPNLAESGHVLSVCDGIVRARGLTNVQAEEL
FT                   VEFESGVKGMCMNLESNHVGIVLFGSDRLVKQSEPVWRTGEIVDVPVGPKMLGRVVDAL
FT                   GNPIDGKGPIETTERSRAQIKAPGILPRRSVNQPVQTGLKAIDAMVPIGRGQRELIIGD
FT                   RQTGKTAIALDTILNQKIWNKSDDESKKLYCVYVAVGQKRSTVAQLVKTLEENDAMKYS
FT                   IVVAATASEAAPLQYIAPFAGCAMGEWFRDHGRHAIIIYDDLSKHAVAYRQMSLLLRRP
FT                   PGREAYPGDVFYLHSRLLERAAKLNDKHGGGSLTALPIIETQGGDVSAYIPTNVISITD
FT                   GQIYLESELFNRGIRPAINVGLSVSRVGSAAQVRAMKQVAGSLKLYLAQYREIAAFSQF
FT                   GSDLDAATKQTLRRGEHLTELLKQKQYAPMAVNEMVPLLYAGINGLIDRIPIGQIQSWE
FT                   ADVLAHFKSYEPEVLAQIEKDGKLSHDLEARIKEIIIAFNAAFL"
FT   gene            complement(37832..38651)
FT                   /locus_tag="ANIA_10631"
FT                   /old_locus_tag="AN10631.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(37832..38158,38228..38351,38432..38651))
FT                   /locus_tag="ANIA_10631"
FT                   /old_locus_tag="AN10631.4"
FT                   /note="transcript_id=CADANIAT00005300"
FT   CDS_pept        complement(join(38102..38158,38228..38351,38432..38592))
FT                   /locus_tag="ANIA_10631"
FT                   /old_locus_tag="AN10631.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005300"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005300"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005300"
FT                   /db_xref="GOA:C8V7Z3"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="InterPro:IPR036786"
FT                   /db_xref="InterPro:IPR039100"
FT                   /db_xref="UniProtKB/TrEMBL:C8V7Z3"
FT                   /protein_id="CBF76121.1"
FT                   /translation="MTRGNTLQSKVFYKGRTEDFVIMVEDAAAVQKWRGDHSIPLAQVL
FT                   DGWKIFTAQHGPQGIHNEASNATVENEFGTSNDNEAIAKILDQGEIQENINAERQGIRN
FT                   ESQGPRGIR"
FT   gene            39075..42183
FT                   /locus_tag="ANIA_05083"
FT                   /old_locus_tag="AN5083.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(39075..39200,39275..39353,39424..40886,40933..41297,
FT                   41868..42183)
FT                   /locus_tag="ANIA_05083"
FT                   /old_locus_tag="AN5083.4"
FT                   /note="transcript_id=CADANIAT00005301"
FT   CDS_pept        join(39075..39200,39275..39353,39424..40886,40933..41297,
FT                   41868..42183)
FT                   /locus_tag="ANIA_05083"
FT                   /old_locus_tag="AN5083.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005301"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005301"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005301"
FT                   /db_xref="GOA:C8V7Z4"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="InterPro:IPR026028"
FT                   /db_xref="UniProtKB/TrEMBL:C8V7Z4"
FT                   /protein_id="CBF76123.1"
FT                   /translation="MGPKDTFFRSVDMSLIQLYIANENGREVVRALGELGQVQFKDLNQ
FT                   DTNALRRTFTGEISRLDNVERQLRYFRSQLDKASILIPTLSEYSDTMADNLTLEIDELA
FT                   EHIGCLEQQISFLNDTYETIMQRVLELTEWRWVLLEAGRYFDHAHGPREEIRQSLNNNE
FT                   TPSLHDVEQQAGLGNDTLGQRGFQAMSIGIIAGVIPRVRMGLLQRILWRTLRGNLYMNQ
FT                   SDIPEPIIDPTSNEEILKNVFIILGHGKDIMVRIRSISKSLGASLYSFDKDCRLRMRRM
FT                   HDVSIRRNDVRNVVQKIKFKLHAKLTQVAPALAAWVTIIKKEKAIYGTLNEFSYDQARS
FT                   IHVAEAWCPTSSLPLIKTTLGDINGRAGVTVPTIVNQIWTNKTPPTFVRTNKFTKCFQT
FT                   IVDAYGIPKYSESNPGLYMVVTFPFIFAVMFGDFGHGALITMVATVLIYWETKLGSTKL
FT                   EEMIEMAFLGRYIMLMMGLFSMYTGLIYCDIFSRSFTIFQSQWKWPDNIRQGQTVKASL
FT                   RDGYRFPFGVDWNWHDAENTLLFTNSLKMKMSILIGWAHMTYALCLQYANARHFQCKAD
FT                   ILGNFIPQMIFFQSIFGYLAFAIIYKWSIDWECRGQSPPSLLNMLISYFLSPGEVQEQL
FT                   YPGQAVVQVILLLLAVTQIPIMLLFKPFYLRWEYNRATTSMSRTASGRPPPAAANQTGR
FT                   LTSLALQSSRFAQPRESRLPFRWKLKLARIYSAAWTWSGGWDMGRAAVVARYYCSRVPI
FT                   RATGCIARGGHIVLAMALYAYRNQTRIAR"
FT   gene            complement(42804..44554)
FT                   /locus_tag="ANIA_05082"
FT                   /old_locus_tag="AN5082.4"
FT                   /product="Miscellaneous Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(42804..43500,43820..44085,44456..44554))
FT                   /locus_tag="ANIA_05082"
FT                   /old_locus_tag="AN5082.4"
FT                   /note="transcript_id=CADANIAT00005302"
FT   CDS_pept        complement(join(42804..43500,43820..44085,44456..44554))
FT                   /locus_tag="ANIA_05082"
FT                   /old_locus_tag="AN5082.4"
FT                   /product="Miscellaneous Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005302"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005302"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005302"
FT                   /db_xref="GOA:C8V7Z5"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002452"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:C8V7Z5"
FT                   /protein_id="CBF76125.1"
FT                   /translation="MEDFYWSSQVSSPSSHISGAEYDEIPWRLANDQRPRLKPRRFDRR
FT                   QGGERKIGKRSGDFDRRRKTHKKCLRRELAAWTPNAKRFPSNWRRNARQPSSWSASGKS
FT                   WRSRSRNYAGTGRCWSGCTIENSECTFLMDNEAVYDICKRKLDIPRPGYNNLNRLNAWV
FT                   GSSLTTSLHFNSDLNIDLNEFQTNLVPFPCIYYPLILYTPVISSSCSTYKSFKVKDLTL
FT                   QCMYPVFSSKISLQSNHLAGFEPRNQMVVYNPQTGKYIAVALLYQGDMMPHNYARAVTD
FT                   IKAKASFNLVKWCPTGFKLGINNQKPIFVPNSKLTSINCSVTILSNSTAIAEAWSCLGH
FT                   KFDLMYSKHAFIY"
FT   gene            45743..46006
FT                   /locus_tag="ANIA_11459"
FT                   /old_locus_tag="AN11459.4"
FT                   /product="hypothetical protein"
FT   mRNA            45743..46006
FT                   /locus_tag="ANIA_11459"
FT                   /old_locus_tag="AN11459.4"
FT                   /note="transcript_id=CADANIAT00005303"
FT   CDS_pept        45743..46006
FT                   /locus_tag="ANIA_11459"
FT                   /old_locus_tag="AN11459.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005303"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005303"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005303"
FT                   /db_xref="UniProtKB/TrEMBL:C8V7Z6"
FT                   /protein_id="CBF76127.1"
FT                   /translation="MSHRFFGFLLAFSFVALSTGNPQGALFPHDPWLENRKTGPISRDL
FT                   TTGLSISALHHVVTAHVQSLYRLDEDTVSAEIIHSFPTQPAP"
FT   gene            complement(47151..48303)
FT                   /locus_tag="ANIA_05081"
FT                   /old_locus_tag="AN5081.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(47151..47486,47565..48005,48079..48303))
FT                   /locus_tag="ANIA_05081"
FT                   /old_locus_tag="AN5081.4"
FT                   /note="transcript_id=CADANIAT00005304"
FT   CDS_pept        complement(join(47151..47486,47565..48005,48079..48303))
FT                   /locus_tag="ANIA_05081"
FT                   /old_locus_tag="AN5081.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005304"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005304"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005304"
FT                   /db_xref="GOA:Q5B2Z9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B2Z9"
FT                   /protein_id="CBF76129.1"
FT                   /translation="MSPGQLYTKLCLAAGHKAALESCNGVSSIASQRSLRDCLQFRTNA
FT                   VRILNDLLQDPVTAVAESTVLLVGSIVTIETINAEFAALQTHMKGLATLAELAGGLDAL
FT                   EHMTVSSIYQYNTPLMFIPFAANAPSAVTVYAALQNEPPIIPMSAKFRSEILQEPAIFY
FT                   RRPDAYAIGFVIPPYIATLGSRFASSRWYTEVSPSLKYFLPIFTRLIQHFELGKAYPEL
FT                   VNDLNPPLRYSLLVYLYVRVSHVQSLPIVRHMVETFKHILAPRIPYLLVIAPDLLFWML
FT                   VIGGLGSKGYNTHSWFVDHTAYVAQHVGLSDRHQARRLLGEFFYTDQPEDTW"
FT   gene            49608..51566
FT                   /locus_tag="ANIA_10625"
FT                   /old_locus_tag="AN10625.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(49608..49734,49978..50819,50868..51566)
FT                   /locus_tag="ANIA_10625"
FT                   /old_locus_tag="AN10625.4"
FT                   /note="transcript_id=CADANIAT00005305"
FT   CDS_pept        join(49608..49734,49978..50819,50868..51359)
FT                   /locus_tag="ANIA_10625"
FT                   /old_locus_tag="AN10625.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005305"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005305"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005305"
FT                   /db_xref="GOA:C8V7Z8"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C8V7Z8"
FT                   /protein_id="CBF76131.1"
FT                   /translation="MSLPAVPEAYIPRDPSTLSIPQATGGEAEPLICELSSPQKRQSKS
FT                   KPQQQELSPALSGPRHLRGLTSRHTYSQSNALGEKDDSDILWFHTGTAMDMVERVRRGE
FT                   DIGNGHLGNGWRPWSWSPLEKIQDFTEREIGKDSLRNLEQILPFSVAPHWVSPDIIIDG
FT                   DAETAIETHRNILNRAPRPIALYTDGSGINGRVGAAAICPKYLISRSSYMGQQSESTVY
FT                   VAELQGILLALVIILQRQMQHAVIFTDNQATLQALRNPGSQSGQYILEAIIMALNKGRK
FT                   AGLNVHFRWIPAHRGVEGNEQADRRAKEATGWRRIRGHRGRMTIRSAVKRRAHEVVNAR
FT                   WENDWKSCHHGRELYELTPTPTRKVLRVHQDLHRALSTIIVQMRTGKIGLRHYLYQRGV
FT                   PDVPNSDCQCGRATQSVRHILLACPTFSGLREEIFGGRSGGPEGEGSVKKIFNTPKLAI
FT                   QAAKFMLRTGLLGQFGAVRRAEIDEAEH"
FT   gene            51866..53499
FT                   /locus_tag="ANIA_10627"
FT                   /old_locus_tag="AN10627.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(51866..51933,51994..52147,52206..52293,52349..52411,
FT                   52475..52978,53033..53499)
FT                   /locus_tag="ANIA_10627"
FT                   /old_locus_tag="AN10627.4"
FT                   /note="transcript_id=CADANIAT00005306"
FT   CDS_pept        join(51911..51933,51994..52147,52206..52293,52349..52411,
FT                   52475..52978,53033..53370)
FT                   /locus_tag="ANIA_10627"
FT                   /old_locus_tag="AN10627.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005306"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005306"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005306"
FT                   /db_xref="GOA:C8V7Z9"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002452"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:C8V7Z9"
FT                   /protein_id="CBF76133.1"
FT                   /translation="MGNAAWELYLLEHGLTADGHVNPDITTDIHRNDSYVTIFTELGNG
FT                   KFVPRSIFVDLDPSPIDEIRTGTYRHLFHPEQLISGKEDAANNYARGHYTVGKTLVRGV
FT                   VDRIRHSCSSLQGFMIFHAFGGGTGSGFGALLLEHLSSEYGKMSKLEFAVYPSPRTSTA
FT                   VVEPYNAVLSTHSTIENSECTFLMDNEAVYDICKRKLDIPRPGYNNLNRLNARVVSSLT
FT                   TSLRFNGDLNIDLNEFQTNLVPFPRIHYPLILYAPVISSSCSTYKSFKVKDLTLQCFEP
FT                   RNQIVICNPQTRKYIAVALLYQGDVMPHNCARAITDIKAKASFNLVKWCPTGFKLGINN
FT                   QKPMFVPNSKLASINCLVTMLSNLTAIAEAWSRLGHKFNLIYSKHAFIY"
FT   gene            54588..55197
FT                   /locus_tag="ANIA_05079"
FT                   /old_locus_tag="AN5079.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(54588..54778,54827..55197)
FT                   /locus_tag="ANIA_05079"
FT                   /old_locus_tag="AN5079.4"
FT                   /note="transcript_id=CADANIAT00005307"
FT   CDS_pept        join(54615..54778,54827..55136)
FT                   /locus_tag="ANIA_05079"
FT                   /old_locus_tag="AN5079.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005307"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005307"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005307"
FT                   /db_xref="GOA:C8V800"
FT                   /db_xref="UniProtKB/TrEMBL:C8V800"
FT                   /protein_id="CBF76135.1"
FT                   /translation="MHSGDEGTCPEARHSHTSQRKSTKYLPSNCLKVRSVTSVSTESCC
FT                   VEAHLVKELRNECTSTPATSLFPLVIARRIMVLSKQEKSIPTVTAFRILTPLSQPRAML
FT                   IRMQTKTCIGGVQALQRVLSCSRQISKIKDPKRMRDRISQPLKTVKTELWPSD"
FT   gene            complement(55481..56772)
FT                   /locus_tag="ANIA_05078"
FT                   /old_locus_tag="AN5078.4"
FT                   /product="putative bHLH transcription factor (Eurofung)"
FT   mRNA            complement(join(55481..56323,56360..56427,56769..56772))
FT                   /locus_tag="ANIA_05078"
FT                   /old_locus_tag="AN5078.4"
FT                   /note="transcript_id=CADANIAT00005308"
FT   CDS_pept        complement(join(55481..56323,56360..56427,56769..56772))
FT                   /locus_tag="ANIA_05078"
FT                   /old_locus_tag="AN5078.4"
FT                   /product="putative bHLH transcription factor (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005308"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005308"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005308"
FT                   /db_xref="GOA:Q5B302"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B302"
FT                   /protein_id="CBF76137.1"
FT                   /translation="MLALAPQISIGGTEFMNLGPLSQNLTPQTLAGGGGITPEEGLPIN
FT                   FNISPFVESPQPTDDAESGNSPLQQQQQQQQQQHQSPPVPPQIPPHMPPQISFHPQIRP
FT                   PYGISIPTIHRVKLDRIRRNSAPELSLHELERQTKHANRRASHNIVEKRYRINLNSKFR
FT                   KLHEIVFCRTDPTFVPDIANANGSSNSANSNSEGPASAPVSAIATQANRSQPPKASIID
FT                   SALNYIESLQREVHELKRRLEVYEKDGAPLQGLGRVGGKALPDLGAEIGSGDAQDYAND
FT                   EHTKEGCESSSVKSESPFAWTIT"
FT   gene            complement(57864..64500)
FT                   /locus_tag="ANIA_05077"
FT                   /old_locus_tag="AN5077.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(57864..59066,59352..59673,60280..60400,
FT                   60451..61240,61377..61401,61448..61518,61574..62090,
FT                   62201..64500))
FT                   /locus_tag="ANIA_05077"
FT                   /old_locus_tag="AN5077.4"
FT                   /note="transcript_id=CADANIAT00005309"
FT   CDS_pept        complement(join(57864..59066,59352..59673,60280..60400,
FT                   60451..61240,61377..61401,61448..61518,61574..62090,
FT                   62201..64500))
FT                   /locus_tag="ANIA_05077"
FT                   /old_locus_tag="AN5077.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005309"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005309"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005309"
FT                   /db_xref="GOA:Q5B303"
FT                   /db_xref="InterPro:IPR001002"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR018371"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036861"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B303"
FT                   /protein_id="CBF76139.1"
FT                   /translation="MLLLKQGIVGLLFFPALIAASGRHGVHHKHAQRSHPPALDERANV
FT                   LSAKVAAVDSQGGDYTCGPDSPCSNGACCGESGWCGYGPTYCGDGCQSNCDATAECGEF
FT                   AATPNAGCPLNVCCSQYGFCGTTADFCGDGCQSNCDQPKPSPQTTNPQQRVIGYWEGWS
FT                   TQRSCGTMSAGEIPVNLLTHLNIAFGYINSAFQITNMDGLSADVYKQVGNLKSRNPSLK
FT                   IMIALGGWTFSDPGPWQAIFPTLASTAANRATFIQNLLGFMSEYGYDGVDFDWEYPGAD
FT                   DRGGSDSMVDGENYTLLLKELQEAITASGRNYLVTFTAPTSYWYLRHFDLKAMMEYVDW
FT                   VNLMSYDLHGTWDSENPIGNQILAHTNLTEIDLALDLFWRVDVDPSSIVLGIGFYGRTF
FT                   QLSSGSCWKPGCPFDGPGAGGRCTATPGILSYMEIMELLENSGATAHLDEEAAVQYLVY
FT                   ADNSWVSYDDATTFAAKIDYAKRIGLSGLMIWAIDLDDSYLTALRSIVDPDSLNNVDGL
FT                   FTLVDLENLFPTEYLPPDDTVLTWGLSTVAGDMTDPSDASFGFLLVTGDSYAVTQLRKR
FT                   DGLPDPFVFIDCPASVNENDSKDEIHTARVICLSDDLAGCFRVMERGVEGTLVEMPEDC
FT                   APNTFARALSLDLSKDQYVPEHIAKRSPTSQVFEFSFDFNIGLMRRDTNNTSVRLDYSN
FT                   LPGYWDSIVDSPGIQTDNLEKRFFGPRHSHWRSQYESTEFAYSSELATRIHEVIDAPLF
FT                   WQAEEDCPHGTNLRQASGFLKLTGTMDITYGIGGIGTVDISSAGKGNPAISDETEIKLT
FT                   GKTITAGRRANTASFDPYVQLTYQMATFNDTDDNDFGQSAAPFDGRLTARVVTDLGNMG
FT                   DSPVIFPSDESNAGDNFDSRSLNNISISDSDVLYGSPGLGGKIALGTFIKFGLKVSTSF
FT                   WDWRPEPLDLSLVYNTQTQFSFYPTSYDESCTELPNFAAIVQSPARGSVCYLNSEEQPD
FT                   SNVTLAEEASRSQDLSPRQTVIMDMPGWGYNGNRPVSPIDYWNWRPPTEILQGQNAVFP
FT                   CRPGACHTCETLSDPSHTPCCGCINMDIKYGFWDIPNCISCDRPDGIYPGPIQHVSNRR
FT                   RDTIETIGEEQEEKKEEEEKEEKDDLEKKDLHVLEPRVDGKATRTSKKVMACGGSFGLG
FT                   RDWRYPAFPSVHSYGWEGIENGAWDSISRYWGNVSDSCSSWAVSGQTRHDTRWVFNNGN
FT                   PAQIRANYQTEHVFEGQLIGDFFDLWLNEGKIKNQRPAPASASSKYTVTRLQYEEPGSL
FT                   LAMGFRDPTWGGQFLDRPATTPVPQPAGAARVNRVTFPPSTAIFRTPLGSDHISLPCST
FT                   NQWQNCRIRFISVSWACDAWNCSEEMRLGPGTRSWFQPSINNFKPWTPLPAKPCPPHRT
FT                   LNACSPQTSYPPNPEPCHVLLPGTLPPPKHHLPARPPAEVCVHVSANTQLESETFGRST
FT                   ASRQSSVPHVPAPDLIRPCYPQDETRTPTKPPGFQEDDAARNVPSPSTSSSTDSLEDFF
FT                   RMPDSPQDNIPIDPVILANLGPWESDDLQLHAPPADGITNPETTCLYPEPPAILGSPTS
FT                   RFEVPGERDGSDNGGIQGSRYGCQQMNPPSPGTGPDQSSPDSHGKHHIKRKTRKSDGGI
FT                   RKSPRVRSTSAPREDSFAALRSQFTSLPLNDRLQFLSWLFEGALSHCMSDTSQTACEEL
FT                   KARESRRSRPRPEIDQSRSVRKSVRKSSRKGMSWSAEEVDLLVRLRKDEGRSWSDVTRV
FT                   FSKQYPGRSQGAIQVYWCSTLSKKAS"
FT   gene            65193..67344
FT                   /locus_tag="ANIA_05076"
FT                   /old_locus_tag="AN5076.4"
FT                   /product="LysM domain protein, putative (AFU_orthologue;
FT                   AFUA_5G03980)"
FT   mRNA            join(65193..65362,65422..65529,65577..65696,65742..65975,
FT                   66025..66106,66160..67344)
FT                   /locus_tag="ANIA_05076"
FT                   /old_locus_tag="AN5076.4"
FT                   /note="transcript_id=CADANIAT00005310"
FT   CDS_pept        join(65193..65362,65422..65529,65577..65696,65742..65975,
FT                   66025..66106,66160..67344)
FT                   /locus_tag="ANIA_05076"
FT                   /old_locus_tag="AN5076.4"
FT                   /product="LysM domain protein, putative (AFU_orthologue;
FT                   AFUA_5G03980)"
FT                   /note="transcript_id=CADANIAT00005310"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005310"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005310"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B304"
FT                   /protein_id="CBF76141.1"
FT                   /translation="MKRTLLLAAAYLLRSANADCAVYTVQAGDTCVSIGRSTNATYAQL
FT                   LAWNSEINIQCSNLGSLTGSELCVSNPLGNYGIPTNTLGSPEIVTTVVPAPSPTPDDTN
FT                   SNCGEYYLVVTGDDCGTVTTQFQITLDDFLFLNPQVWDNCTNLMRDYYYCVRPVGYITT
FT                   YPGYGGSATTEPFVQTPSTPVPENPLANYSSSQPVIPIANKTRLDCYHYITFDNITENE
FT                   AANCWNLAGIVGVSPEELILWNPSLAENSTSIEPPATITTSSVTRTITSNPYAYPCTLS
FT                   ESTSYCVAVASPTTSDGQASAIATPVPRAAGEIANCTQWFHVESVRDTCESILNTYWLA
FT                   FEEFYAMNPSVKEDCSGLVLGTYYCVSTYPDGVPPGQPDWTGPTFPLPDETATATSTTT
FT                   STSGVSTPSPVQTGIIETCNEFYKVVTGDTCYDIAVENDVALSDFYDWNPAVKTDCTGL
FT                   QADVYVCVGVQAPSSTTTTTIPTSDVSTPTPIQSGMVTTCSEFYFVASGNSCYDIAVDN
FT                   GIELASFYDWNPAVQTDCSGLQANVYVCVGVSGGTPTATTSIATMSTTAISTPTPTQAG
FT                   MVDNCGEFYLVQAGDGCWNLANEQGIALGAFYVWNPAVKDDCSGLQADVYVCVGLA"
FT   gene            complement(67560..71552)
FT                   /locus_tag="ANIA_05075"
FT                   /old_locus_tag="AN5075.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(67560..69085,69530..69600,69781..69804,
FT                   70068..70120,70281..70488,70791..70867,70922..70955,
FT                   71059..71163,71269..71552))
FT                   /locus_tag="ANIA_05075"
FT                   /old_locus_tag="AN5075.4"
FT                   /note="transcript_id=CADANIAT00005311"
FT   CDS_pept        complement(join(67560..69085,69530..69600,69781..69804,
FT                   70068..70120,70281..70488,70791..70867,70922..70955,
FT                   71059..71163,71269..71552))
FT                   /locus_tag="ANIA_05075"
FT                   /old_locus_tag="AN5075.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005311"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005311"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005311"
FT                   /db_xref="GOA:Q5B305"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B305"
FT                   /protein_id="CBF76143.1"
FT                   /translation="MKREEDGLDKPCLFKWSPSDLILCLCSANSREMKEALVAELQGPA
FT                   PCYEPDFPGLFPVHSMDLIELWLAAKTTLYSTLLDRYGPLLDVGSQYKILPRFQFTTLS
FT                   PYWQPQNQNQNQNRPRPALIELSARVSGAPVLTVMLETKVTYHSVLGNATAGPMMFYTG
FT                   AAIHWTMLGFFVAEPSNRLGEVWSNAFFQQQGLMVRLFSYEYDSVDTFSTGFGRVSGEA
FT                   DGLLNHISTVRPKAALVNASQNGHYAEIKSATNLDSQISRFTLPPPYKEGDVCRAKLTR
FT                   VRMNALPTEIIAIIAGYLPNSGIKTLRLTCRTLCNTVRLRLDRVFLSANPLNIAVFRAI
FT                   ADSETFRHGIKEIIWDDARFLQVPYGEFHIADSREDLRIDKESGCLQWFVDACKKNRED
FT                   LQMRKFAHLDRGKMPKQIVVAEEQAATELPLWICWQYYQNLLQQQEEVIVFNKDAQALE
FT                   YGLRRFPALKRVTVTPAAHGWIFTPLYETPMIRAFPRGFNYPIPRGWPSVSSSGTYRPR
FT                   AQPWEDEATKKDYRGFGIITRALASYTKHQVSELIIDAHALDTGLNCRVFEEPNPEYDD
FT                   LVTILRRPGFTRLDLSLSVRGQEWTGWPCFRNGYLRRALAEAHDLKHIALSTDVEEDPA
FT                   SDTTVPETGGGRAQLVSLRTILPTEKWHSLRYFSLSNFLVDKNDIIAILSSLPPTLRFV
FT                   HIGFLYFVDHGGSYRELLEDMRDQLDWRSRDPTIRPVVSVAKPTMYIQIGHAIWLDGEV
FT                   SQFLYGDGPNPFYNGGDAVGEVGVVRDAFMDGVEWRNRGY"
FT   gene            complement(74338..75165)
FT                   /locus_tag="ANIA_05074"
FT                   /old_locus_tag="AN5074.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(74338..75165)
FT                   /locus_tag="ANIA_05074"
FT                   /old_locus_tag="AN5074.4"
FT                   /note="transcript_id=CADANIAT00005312"
FT   CDS_pept        complement(74338..75165)
FT                   /locus_tag="ANIA_05074"
FT                   /old_locus_tag="AN5074.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005312"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005312"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005312"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B306"
FT                   /protein_id="CBF76145.1"
FT                   /translation="MHYNERLISEEIRAIARKNSREALEAFLQQQREAAGELEYTPPLE
FT                   DLLLAATDCRANQVAAYCLEHGQKATREMMTSVVVHNSFAVYRLMVKHKVVRINFVVPW
FT                   YGDILGTMASDNKIDWVRFCLEHGANPNASLVEEHLSALACAVHTGNVELVDLLLAHGA
FT                   RLKGSNAIVRAAIDEDLEMVKYLLLRGADIDEVGIKGPPGAEAYGDMGSPLHQAAVEGY
FT                   MEMALFLIEAGADIYLKDPLGRTAEDLALEKGHMEILDALRQKKMKDNVDIKE"
FT   gene            complement(75972..76924)
FT                   /locus_tag="ANIA_05073"
FT                   /old_locus_tag="AN5073.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(75972..76156,76273..76645,76711..76809,
FT                   76859..76924))
FT                   /locus_tag="ANIA_05073"
FT                   /old_locus_tag="AN5073.4"
FT                   /note="transcript_id=CADANIAT00005313"
FT   CDS_pept        complement(join(75972..76156,76273..76645,76711..76809,
FT                   76859..76924))
FT                   /locus_tag="ANIA_05073"
FT                   /old_locus_tag="AN5073.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005313"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005313"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005313"
FT                   /db_xref="GOA:Q5B307"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B307"
FT                   /protein_id="CBF76147.1"
FT                   /translation="MSGVILEEEADYGCFPFDIFVSDRWDHNHNATRDGQEQWEQLVWE
FT                   WESLTLTERYPYQKRAESENGPPELSEEIKRVLATHQTAHERNISLISCDGWQTVWLRT
FT                   CYDPGLADKYKQMKSTSEVPGWGVSGDKILDDPARYDFDDDGSNSWQQVLIRVPGITDF
FT                   SGVWGEGDGGSSIRYRSHIESGLIKILWLDEHGQVAWENRLDTSTSALSRLTGSLLNAT
FT                   SLVEMTGYDGTRGTLIEN"
FT   gene            77500..78363
FT                   /locus_tag="ANIA_05072"
FT                   /old_locus_tag="AN5072.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(77500..77675,77802..77858,77970..77971,78059..78363)
FT                   /locus_tag="ANIA_05072"
FT                   /old_locus_tag="AN5072.4"
FT                   /note="transcript_id=CADANIAT00005314"
FT   CDS_pept        join(77500..77675,77802..77858,77970..77971,78059..78363)
FT                   /locus_tag="ANIA_05072"
FT                   /old_locus_tag="AN5072.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005314"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005314"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005314"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B308"
FT                   /protein_id="CBF76149.1"
FT                   /translation="MGLRHSVLFPLRGSCPGESPSPSPTGWPRRPRHRGLDLLNPTRQE
FT                   IGWIMLSENPLGFGILKGYVTIEEMRENLGSNLSHQYTTIGEGYEEIPTVQGAAKPSHD
FT                   SCNTEYEPSFAIVGIDSDIQLGLERSAEDLYPASSSRPSKFSNEPGKGELLMELISVTG
FT                   SDACFRAALMKSWVTT"
FT   gene            complement(78671..80283)
FT                   /locus_tag="ANIA_05071"
FT                   /old_locus_tag="AN5071.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(78671..79094,79263..79540,79715..80167,
FT                   80239..80283))
FT                   /locus_tag="ANIA_05071"
FT                   /old_locus_tag="AN5071.4"
FT                   /note="transcript_id=CADANIAT00005315"
FT   CDS_pept        complement(join(78671..79094,79263..79540,79715..80167,
FT                   80239..80283))
FT                   /locus_tag="ANIA_05071"
FT                   /old_locus_tag="AN5071.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005315"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005315"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005315"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B309"
FT                   /protein_id="CBF76151.1"
FT                   /translation="MSGQHVCSFPYEETKVRSVTVNIHAIIVRAVEDQRSVSIVALWQC
FT                   HRPRRFSLLTEAQGRPLETAQPSMVRADLLEPGGPLSAVSDEAKRYSYSRRSALAHSFG
FT                   YFEDSSCNTCIAPASGALTRFLTVGAASVDATDQVSLSSGTLRVMVTAMAAKQWHLISI
FT                   SFSLPSTVSAVVDRKSTVDCARRRVRRSDLRVSAYTAHFLPSPSHTVDSIGGVSLTDIR
FT                   NTCSNVGDSLAQACLSLDWEGSLVRVQYTLFLALRFSHLSRQLDRVPFLPDGIVADALP
FT                   WLCLVPDTSANASAPEIFTERLMQVHLGRFWRRFGPRRKFEYDPLEAEQRYDRFCAEYL
FT                   PTLSPEFALEPDSQWDAILPKLPMQRQLMHTAIFDSICWNFRLLLILKPTQIARLAPYK
FT                   "
FT   gene            complement(81392..83721)
FT                   /locus_tag="ANIA_05070"
FT                   /old_locus_tag="AN5070.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(81392..81529,81621..82279,82341..82573,
FT                   82630..83612,83659..83721))
FT                   /locus_tag="ANIA_05070"
FT                   /old_locus_tag="AN5070.4"
FT                   /note="transcript_id=CADANIAT00005316"
FT   CDS_pept        complement(join(81392..81529,81621..82279,82341..82573,
FT                   82630..83612,83659..83721))
FT                   /locus_tag="ANIA_05070"
FT                   /old_locus_tag="AN5070.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005316"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005316"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005316"
FT                   /db_xref="GOA:Q5B310"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B310"
FT                   /protein_id="CBF76153.1"
FT                   /translation="MASSDSIKRTGPSCTECRKKKTKCCGDWAPCKRCAKLGLHCSLPV
FT                   NTAAAGSSRRSKKYQKHQEDQQDRRSPLPRPNGYHSGKLRDPNGRFASNLRKESVDAKN
FT                   TRNSGRAMRVRPRPARDACPLPTVAAATPSRVQGLKTKQQLCSVTYPTPSESQETGDLR
FT                   NWAASPAARASGRDHSGLVACLAEAATTPAEALELFTLFGERIAPFIPSLYATDFTALP
FT                   TQPLYVLAAIYAVARYLPDSTALRDRTGCILRRLISELIFRSMANQSSIAKAENMQGLV
FT                   VLYACCEATGPNHEDQQAFPYFDMLFLKGITETYASKIRLGLDYTLDKASDDKLPLVWE
FT                   VWLYTMSHHCAVLHGCPRTLSGSVELHRAKSALEQTVDHPRIRLLLAEFELCLLWESAS
FT                   SIPASCPKTVNDTLDHWKSQWQESLTGAAAPGHQLFFYFHFTRFHLLTHLVDEAGEIYI
FT                   AMNETLEAAQDFLQWFKDLPPVSKDRLRYLCDFAFVLMVHVCLCVIRALRGGLVLPKCR
FT                   KEFLELVQDAAVLMQSLSVRADTRPAIYGCALVTMCRQYQSSQVDGISAGAANNLRDSA
FT                   EFLHLPRQTQLDMEVPMAAEALMDEELLRQSRLSPGFWTLDPDISVFDGIIAAIPVPEE
FT                   SDMIDNVALHSNPDCLRISGKLANLHNSLDTSHSICPFSYRRKGAKPVTISINFDS"
FT   gene            complement(88280..90142)
FT                   /locus_tag="ANIA_05069"
FT                   /old_locus_tag="AN5069.4"
FT                   /product="integral membrane protein, putative
FT                   (AFU_orthologue; AFUA_5G02860)"
FT   mRNA            complement(join(88280..89036,89111..89583,89651..89718,
FT                   89783..89819,89884..89903,89965..90142))
FT                   /locus_tag="ANIA_05069"
FT                   /old_locus_tag="AN5069.4"
FT                   /note="transcript_id=CADANIAT00005317"
FT   CDS_pept        complement(join(88742..89036,89111..89583,89651..89718,
FT                   89783..89819,89884..89903,89965..90142))
FT                   /locus_tag="ANIA_05069"
FT                   /old_locus_tag="AN5069.4"
FT                   /product="integral membrane protein, putative
FT                   (AFU_orthologue; AFUA_5G02860)"
FT                   /note="transcript_id=CADANIAT00005317"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005317"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005317"
FT                   /db_xref="GOA:Q5B311"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B311"
FT                   /protein_id="CBF76155.1"
FT                   /translation="MTLIQSLIERDAAPEHHVDRSMQKWNYATQSLCIIFMTIFFGLRV
FT                   YTRTSLQRNWEQEDWYCSAAWLLGVIYSAIALAMGHYGGGVHWDDVSEDNRTQFQKLTY
FT                   VTMVMYGPTAFLTKLTLLWIVTRVFSPFKKWVIFIYVFLGLMLIYYIPAVIIKIRICMP
FT                   ISRFWNEEQPGSCMNRNAIIMADAVVSVVSDLIVLIMPLPLTMQLQMSKKKKLRVVGIL
FT                   GAGGLACASSIIRLVLIQLTGKSTDATIAFMRINMFGNAEIAIGVVCACLPALSALISR
FT                   TYNEYSSNRYNSHESDYHLSEMRNTTKGTRVQGSRKMSVASDEGTLIANAQSKPKDNEV
FT                   GIMRTVDISMSVASRD"
FT   gene            complement(91203..93260)
FT                   /locus_tag="ANIA_05068"
FT                   /old_locus_tag="AN5068.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(91203..91303,92056..92151,92215..92281,
FT                   92351..92670,92738..92893,92957..93260))
FT                   /locus_tag="ANIA_05068"
FT                   /old_locus_tag="AN5068.4"
FT                   /note="transcript_id=CADANIAT00005318"
FT   CDS_pept        complement(join(91203..91303,92056..92151,92215..92281,
FT                   92351..92670,92738..92893,92957..93260))
FT                   /locus_tag="ANIA_05068"
FT                   /old_locus_tag="AN5068.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005318"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005318"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005318"
FT                   /db_xref="GOA:Q5B312"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B312"
FT                   /protein_id="CBF76157.1"
FT                   /translation="MADSKLSQSPYDIPYDELANPRQVWVGEPGSEEEGKAKLGMLTPE
FT                   VVHGAAASEIRTGRRVTMGWTLTELGYPNLGRQPCKHRIVPLLDGLAFDDYYEFNPQQS
FT                   SQWDGLRHFSQTVPGQSERVFYGGTTAAEIYDRKNDRIGMQHWAKEGIAGRGVLIDYAS
FT                   WAKKKGIKYSTFSTHQVRLSDIQEIAKECEIEFKKGDILFVRIGVTEEWDTMTEAQKQE
FT                   YSNNSKPLHAGVEATEDMLRWLWNEKFAAIASDAISWEVYPPQSDIFLHEYVLAGWGMP
FT                   IGELFDLEALARMCIEHKRWSFFVASIPLNMPGVPATPKAPEVLDQSNISKFQHASIVM
FT                   DVFETRG"
FT   gene            94651..97066
FT                   /locus_tag="ANIA_05067"
FT                   /old_locus_tag="AN5067.4"
FT                   /product="MFS sugar transporter, putative (AFU_orthologue;
FT                   AFUA_5G02840)"
FT   mRNA            join(94651..94875,94948..95222,95283..95829,95885..95972,
FT                   96025..96223,96285..96385,96442..96540,96590..97066)
FT                   /locus_tag="ANIA_05067"
FT                   /old_locus_tag="AN5067.4"
FT                   /note="transcript_id=CADANIAT00005319"
FT   CDS_pept        join(94804..94875,94948..95222,95283..95829,95885..95972,
FT                   96025..96223,96285..96385,96442..96540,96590..96804)
FT                   /locus_tag="ANIA_05067"
FT                   /old_locus_tag="AN5067.4"
FT                   /product="MFS sugar transporter, putative (AFU_orthologue;
FT                   AFUA_5G02840)"
FT                   /note="transcript_id=CADANIAT00005319"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005319"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005319"
FT                   /db_xref="GOA:Q5B313"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B313"
FT                   /protein_id="CBF76159.1"
FT                   /translation="MGRFGSQTSTYNRLVSIFVAVGSLTYGYCASIISSTIGQPGWYTY
FT                   FDLPVEGEPGYDSTTTPTIATANGVFSAGGAVGTLFLMWACGYFGRKVNIQLGAFFSLF
FT                   GGALQGGANSLKMFQAGRFICGLGIGILVTVCPMYLSEMSSAFRRGWLVGHHAIFLVFG
FT                   YMLAGWVGFACYYAEGKLGTFGWRFPLCLQCLPPLVLLAGSPLLPRSPRWLISKGKDEE
FT                   ARLTLEKLRKSPDDPDNLVAKEEYYQMKEQIRLEAEKLSAYGNVWNAVIKKPSYRKRMI
FT                   IGFLTQWGAEFGGPLIINNYAVILYQGLGETGSMPLLLSAVWLTTAGVIYNPLGAWLHD
FT                   KVNSRRGMYITGFVGIIITTSILAAMTAEYAGTTNRGGNAVGILMMYLYLAFQGTCCDT
FT                   TMYLYVSEIFPTEIRPIGMGFSLFGQFAATLILLQTAPIGFANSGWKYYLVIILWSFFF
FT                   IFVIYFFFPETARLTLEEIAKNFGEEVAVNLTEATDEERARIEQVVVQPDPRKIESTTA
FT                   DGAASSNAEPVKQG"
FT   gene            complement(98289..99921)
FT                   /locus_tag="ANIA_05066"
FT                   /old_locus_tag="AN5066.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(98289..98308,98430..98996,99529..99560,
FT                   99803..99921))
FT                   /locus_tag="ANIA_05066"
FT                   /old_locus_tag="AN5066.4"
FT                   /note="transcript_id=CADANIAT00005320"
FT   CDS_pept        complement(join(98289..98308,98430..98996,99529..99560,
FT                   99803..99921))
FT                   /locus_tag="ANIA_05066"
FT                   /old_locus_tag="AN5066.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005320"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005320"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005320"
FT                   /db_xref="GOA:Q5B314"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B314"
FT                   /protein_id="CBF76161.1"
FT                   /translation="MPDDEDDRVKSRTMQLFTEKYLGKMVVATLQPAEEQPWEPTSWLR
FT                   ANIFAELAINGRTSTATGVSPFYLSHGYNLSPFTPTKEVEHLAEEPTKSPIQKGEAIVQ
FT                   KVKEALDWAQASMAYSQQNTENQANKHRSPATNYQVGNKVWLSLKNICMDRPSKKLDWK
FT                   NAKYEVIGLVGSHAVRLNTPPGIHPVFHVDLLRLASSDPLPSQKNDDSQPPSIMVNGEE
FT                   EYMVEKILDERRRRYGRDFRTAH"
FT   gene            complement(100673..101167)
FT                   /locus_tag="ANIA_05065"
FT                   /old_locus_tag="AN5065.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(100673..100933,101099..101167))
FT                   /locus_tag="ANIA_05065"
FT                   /old_locus_tag="AN5065.4"
FT                   /note="transcript_id=CADANIAT00005321"
FT   CDS_pept        complement(join(100673..100933,101099..101167))
FT                   /locus_tag="ANIA_05065"
FT                   /old_locus_tag="AN5065.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005321"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005321"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005321"
FT                   /db_xref="GOA:Q5B315"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B315"
FT                   /protein_id="CBF76163.1"
FT                   /translation="MTQEELIVLWKTLSELLQKGFICFTKLDVSAAFHKIRIAKDQEWM
FT                   TAFRTRYGLFEWLVTPFGLANAPSTFQKYINWTLREYLDEFCSAYIDNVLVYTNRDLRQ
FT                   HWKHI"
FT   gene            complement(102320..103602)
FT                   /locus_tag="ANIA_05064"
FT                   /old_locus_tag="AN5064.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(102320..102790,102944..103088,
FT                   103171..103319,103463..103490,103526..103602))
FT                   /locus_tag="ANIA_05064"
FT                   /old_locus_tag="AN5064.4"
FT                   /note="transcript_id=CADANIAT00005322"
FT   CDS_pept        complement(join(102320..102790,102944..103088,
FT                   103171..103319,103463..103490,103526..103602))
FT                   /locus_tag="ANIA_05064"
FT                   /old_locus_tag="AN5064.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005322"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005322"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005322"
FT                   /db_xref="InterPro:IPR005162"
FT                   /db_xref="InterPro:IPR032567"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B316"
FT                   /protein_id="CBF76165.1"
FT                   /translation="MPKTYKALNIRPYTKESCSYKHKLPWPQRLYSILPTCYGSFAYTR
FT                   TLDLSDSAKACAVLKAVSHLQDFLATTILLSHFFFSDSFFMRRPFTMTMEEESVALLLQ
FT                   QLQELRTEMRTQKQQLQEENNSLQAELQAINLYMKFAINAACYPTEEEQVYYAYSRLRG
FT                   KASQCVLPWLLARQKSETPVLWAEFSAVLDKAFGDPDQQRKALVRVNTIKQGKRDFEEF
FT                   LNEFDKELLNTGGINWDDNQKKALLDTAINVELLKAMVGIRQEDSYNNYCNQLREINHN
FT                   LQRVARLT"
FT   gene            103858..105782
FT                   /locus_tag="ANIA_11458"
FT                   /old_locus_tag="AN11458.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(103858..103870,104362..104375,104436..104462,
FT                   104654..104662,104732..104736,104921..104938,
FT                   105052..105065,105116..105121,105320..105338,
FT                   105521..105546,105621..105625,105759..105782)
FT                   /locus_tag="ANIA_11458"
FT                   /old_locus_tag="AN11458.4"
FT                   /note="transcript_id=CADANIAT00005323"
FT   CDS_pept        join(103858..103870,104362..104375,104436..104462,
FT                   104654..104662,104732..104736,104921..104938,
FT                   105052..105065,105116..105121,105320..105338,
FT                   105521..105546,105621..105625,105759..105782)
FT                   /locus_tag="ANIA_11458"
FT                   /old_locus_tag="AN11458.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005323"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005323"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005323"
FT                   /db_xref="UniProtKB/TrEMBL:C8V816"
FT                   /protein_id="CBF76167.1"
FT                   /translation="MSIRELLGLPGLLCRREKALKVGRKSPLRYRVASITIYYTRRPEL
FT                   PLSSSSIGKSSKLV"
FT   gap             112248..112347
FT                   /estimated_length=unknown
FT   misc_feature    112348..146878
FT                   /note="contig 1.85 1..34531(-1)"
FT   gene            112494..113141
FT                   /locus_tag="ANIA_05063"
FT                   /old_locus_tag="AN5063.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            112494..113141
FT                   /locus_tag="ANIA_05063"
FT                   /old_locus_tag="AN5063.4"
FT                   /note="transcript_id=CADANIAT00005324"
FT   CDS_pept        112494..113141
FT                   /locus_tag="ANIA_05063"
FT                   /old_locus_tag="AN5063.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005324"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005324"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005324"
FT                   /db_xref="GOA:Q5B317"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B317"
FT                   /protein_id="CBF76169.1"
FT                   /translation="MGVIYRCTYNDEATWQHLKQWIVDENRESIATSKAPTLIDNLDIV
FT                   FFEDRARFDGASRDELRVHFKEWRADQFTRLGPADLEVMRGTRLGELVPRITMVHPELM
FT                   GSRFQQFIEVDEESLHSMREGFDEPVRPYGTGHVDLVYADWPHDLEDSDEDESQEEYED
FT                   YEVFEPIDGCTEENVGWMKVVATGLGPPFFFLSYGIEWWQESYVRPPDVLYI"
FT   gene            113582..115243
FT                   /locus_tag="ANIA_05062"
FT                   /old_locus_tag="AN5062.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(113582..113584,114064..114700,114741..115243)
FT                   /locus_tag="ANIA_05062"
FT                   /old_locus_tag="AN5062.4"
FT                   /note="transcript_id=CADANIAT00005325"
FT   CDS_pept        join(113582..113584,114064..114700,114741..115243)
FT                   /locus_tag="ANIA_05062"
FT                   /old_locus_tag="AN5062.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005325"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005325"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005325"
FT                   /db_xref="GOA:Q5B318"
FT                   /db_xref="InterPro:IPR021514"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B318"
FT                   /protein_id="CBF76171.1"
FT                   /translation="MTGSAVLSLVVWKANWELFRILCEGGSEQAADPAPFKYRRRPIYS
FT                   PSEWLFEGMSSLLAMVIVITIAVIFWMMDGKPLKEWSGPVSLAATISILTTAYSSALMH
FT                   SVSSFIRQLKWLHFKDKPRRLSHLETFDEASRGVWGALLLLTNVKWNLATLGAIITILR
FT                   LTFSAFSQQAVQIAQRASTTPSDINSVAFGYAHNYSRDFSNFSTYGNTDKRLSAKQLTE
FT                   AIPQDPDMQFAIIKGLYGIDTPATFSCPSSCRWDGSYVSLGFKSACKNVKQDTLRSAAC
FT                   DGTEHRNRCNMTTPNGVNIITHRIHTDAATSYVMNTTSTLEPSAEEKLLEIARFGIYRS
FT                   SPDGNFRQQNVSITQCSLYLTAYEYANAFAKLPTEVSSIS"
FT   gene            complement(115829..118839)
FT                   /locus_tag="ANIA_05061"
FT                   /old_locus_tag="AN5061.4"
FT                   /product="xyloglucanase (Eurofung)"
FT   mRNA            complement(join(115829..115866,116080..117804,
FT                   117855..117908,117962..118202,118273..118471,
FT                   118531..118675,118731..118839))
FT                   /locus_tag="ANIA_05061"
FT                   /old_locus_tag="AN5061.4"
FT                   /note="transcript_id=CADANIAT00005326"
FT   CDS_pept        complement(join(115829..115866,116080..117804,
FT                   117855..117908,117962..118202,118273..118471,
FT                   118531..118675,118731..118839))
FT                   /locus_tag="ANIA_05061"
FT                   /old_locus_tag="AN5061.4"
FT                   /product="xyloglucanase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005326"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005326"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005326"
FT                   /db_xref="GOA:Q5B319"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR035971"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B319"
FT                   /protein_id="CBF76173.1"
FT                   /translation="MKKPNHAVLGIGLALCIEAAYSAASQSYTWKNVVTGGGGGFVPGI
FT                   VFNPSEEGLAYVRTDIGGAYRLNSDDTWTPLTDFVGNSNWNRWGVDALATDPVDTNRLY
FT                   LAVGMYTNEWDTSNGAILRSTDKGETWTETALPFKVGGNMPGRGMGERLAVDPHKNSIL
FT                   FFGARSGHGLWKSTDYGATWSNVTSFTWTGTYFQDSSSTYTSDIVGIAWVTFDSTSGSS
FT                   GSPTPRIFVGVADTGKSVFVSEDAGATWNWVTGEPQYGFLPHKGVLSPAEKTLYISYSN
FT                   GAGPYDGTNGTVHKYDISSGTWTDISPTSMEDTYYGYGGLSVDLKVPGTLMVAALNCWW
FT                   PDELIWRSVDSGANWSPIWAWNGYPNINYYYDYEVSNAPWLEDTTSTDGFPVRVGWMVE
FT                   ALSIDPFDSNHWLYGTGATIYGGHDLTSWDSIHRVTLQSLASGIEETAVQALIVPPGGP
FT                   PLLSAVYDVGGFYHSDLDTPPTQAYHTPTYGSTNGLDYAGNNPATIVRSGSTDADDPTV
FT                   ALSNDFGRTWSANYAASSATGPGPVAISADGDTILLMSNTQGALRSQYQSTFAAVTSLP
FT                   SGAVIASDKANNTVFYGGSSGSFYVSTNTGTSFTKTATLGSSSTVNAIRAHPSLAGDVW
FT                   ASTDTGLYHSTDYGRTFTKTGSSCTAGWGFGLGKPSSTSAYPVIYGFFTVDGVTALSKT
FT                   EDEGTTWAMISDSEHGFGAASANVVNGDMGNYGRVFVGTNGRGIFYGEPNGSSPPSSSS
FT                   TSTTATTSSTSTTLTTTSTPTTTVTTTTTSTTATATATASPYGQCGGSEYTGPTACPSG
FT                   WTCTFFNHFYSQWLYGVLLAVWGR"
FT   gene            complement(121018..121546)
FT                   /locus_tag="ANIA_11457"
FT                   /old_locus_tag="AN11457.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(121018..121044,121087..121234,
FT                   121536..121546))
FT                   /locus_tag="ANIA_11457"
FT                   /old_locus_tag="AN11457.4"
FT                   /note="transcript_id=CADANIAT00005327"
FT   CDS_pept        complement(join(121018..121044,121087..121234,
FT                   121536..121546))
FT                   /locus_tag="ANIA_11457"
FT                   /old_locus_tag="AN11457.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005327"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005327"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005327"
FT                   /db_xref="GOA:C8V820"
FT                   /db_xref="UniProtKB/TrEMBL:C8V820"
FT                   /protein_id="CBF76175.1"
FT                   /translation="MDISPNVAGASCELDSPAAWWLLKEATTNFNGSTVSELYFPEDQA
FT                   ALSSFLGQISNRIAKQ"
FT   gene            complement(122251..123343)
FT                   /locus_tag="ANIA_05060"
FT                   /old_locus_tag="AN5060.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(122251..122426,122488..123343))
FT                   /locus_tag="ANIA_05060"
FT                   /old_locus_tag="AN5060.4"
FT                   /note="transcript_id=CADANIAT00005328"
FT   CDS_pept        complement(join(122251..122426,122488..123343))
FT                   /locus_tag="ANIA_05060"
FT                   /old_locus_tag="AN5060.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005328"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005328"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005328"
FT                   /db_xref="GOA:Q5B320"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B320"
FT                   /protein_id="CBF76177.1"
FT                   /translation="MSEYTNLPDYDSLPPVKGMPRGCAWGIFDKDGKKDHIGCLNLLTP
FT                   SVVRAALKEAETGQSVSLNWPINAIHKPGFQRAGLEHKVSSFQDTPFKLHGFDDEVAFN
FT                   TQCSSQWDSLVHFAHQPSGFSYNGVKPTKEALLQADAPFHKDTDLPTLDHWHSRGGLVG
FT                   RGVLLDYQAYADAHGRKYSPFETHKITVADLEAVAQWENVELRQGDIVIIRSGFTKGLQ
FT                   EAATPEKQAECMASHRTVGVEGNEATAKWFWNKHFAAVAGDAIAFECLPPSKEDGTEGS
FT                   IGDLVLHQYFLGLFGLNIGELWDLEALSKLCAEKKRYSFLLTSCPLNVPGSVGSPPNAL
FT                   AIF"
FT   gene            complement(124671..126128)
FT                   /locus_tag="ANIA_05059"
FT                   /old_locus_tag="AN5059.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(124671..125191,125234..125307,
FT                   125371..125855,125919..126128))
FT                   /locus_tag="ANIA_05059"
FT                   /old_locus_tag="AN5059.4"
FT                   /note="transcript_id=CADANIAT00005329"
FT   CDS_pept        complement(join(124671..125191,125234..125307,
FT                   125371..125855,125919..126128))
FT                   /locus_tag="ANIA_05059"
FT                   /old_locus_tag="AN5059.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005329"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005329"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005329"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B321"
FT                   /protein_id="CBF76179.1"
FT                   /translation="MSTVSEASPVLDWYEDRGTPLQIHFIIMLALPVVAVALRFWSRAV
FT                   MPSVGPGRRTIGRFWWDDWTALLATVSNTAVCILAIKMVQLGLGRHAVIVLPENITLFL
FT                   RFLWAVYIIFIIGASIAKASALFFYARVFTQTRSRFRYSLWTLQAFNVLWLLGTILAVI
FT                   FMCSPVAKVWNQSTPGHCRRPADIWLGSGVSSVFIDVLILVLPIPILWGLQMKPSRKFL
FT                   AVLVIILGHLVVVVSIGRLASVAWTVQHLAMDPTSVNTVAPIFWHGSEIPIAVISVSLP
FT                   SIFLLARRGFSHGMKSMFSMKTIPSSVWADESHVERAEPRPARSVSSIGLVPVRPVYIQ
FT                   NPVKCVTTDSGFTESITALPPIPEEPCEHRTPSVTAEYGSTSTLSTVLPQIPEEVHGRQ
FT                   TPQLTVDCGSTSPISWARATEAQLAELGHV"
FT   gene            127777..129993
FT                   /locus_tag="ANIA_05058"
FT                   /old_locus_tag="AN5058.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(127777..127917,127971..128829,129500..129993)
FT                   /locus_tag="ANIA_05058"
FT                   /old_locus_tag="AN5058.4"
FT                   /note="transcript_id=CADANIAT00005330"
FT   CDS_pept        join(127777..127917,127971..128829,129500..129993)
FT                   /locus_tag="ANIA_05058"
FT                   /old_locus_tag="AN5058.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005330"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005330"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B322"
FT                   /protein_id="CBF76181.1"
FT                   /translation="MPTRLRLIYLIAGALVLFAFLHLFQGPELSPTSAFLPRDTAGNNT
FT                   LGFQQIFALSQHPSWRTRGLDAAANLTGLQITIPPQPPVDDRLVEAFANIQGDPWDTQH
FT                   PSPGASKAWLAHLDLLKHVYQSEIETALILEDDVDWDIALRNQMMNISTAVRNLTRAPE
FT                   TDRSPYSLEWDVLWLGHCGERWDESIETIVFNDTHVCPHEDYRGFWPDEIALLPDLKRT
FT                   VYRSNSPVCTFAYAVTHKGARRILESLGAGQGEAFDVQLQIECHSQRLTCVSVVPEVFH
FT                   QYFPPAQFGVKSDVDIGNNKGDGPVEETFESVMGSTENILHSARCRALWGSDSYSVLDL
FT                   LWSISAISKRSGYDVERRSITIRYWVITLPKKDSSEMPILPTRTTCMMSFELFRPSNLA
FT                   LLFANVFSRPQPQKFVVPACRNENATAVTQYTSGRDGFDAPKVHPINATTYDWWWFDAI
FT                   QQPVPTEDGGQSQAHIVITFYNLGSEVLTEQFPKRLAEW"
FT   gene            131192..133248
FT                   /locus_tag="ANIA_05057"
FT                   /old_locus_tag="AN5057.4"
FT                   /product="protein-tyrosine phosphatase, putative
FT                   (AFU_orthologue; AFUA_3G12250)"
FT   mRNA            join(131192..131240,131295..131814,131866..133248)
FT                   /locus_tag="ANIA_05057"
FT                   /old_locus_tag="AN5057.4"
FT                   /note="transcript_id=CADANIAT00005331"
FT   CDS_pept        join(131192..131240,131295..131814,131866..133084)
FT                   /locus_tag="ANIA_05057"
FT                   /old_locus_tag="AN5057.4"
FT                   /product="protein-tyrosine phosphatase, putative
FT                   (AFU_orthologue; AFUA_3G12250)"
FT                   /note="transcript_id=CADANIAT00005331"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005331"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005331"
FT                   /db_xref="GOA:Q5B323"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR026070"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR029260"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B323"
FT                   /protein_id="CBF76183.1"
FT                   /translation="MAGSTAGYGQIIEYIQDKLYLASYDHTPDAKTPFPYPAEQPKSPS
FT                   KRRAQASPSKKRSPVYFTVDDTLLYNSFHADFGPLHIGHLYRFAVHFHDLLAANNDRAI
FT                   VFYSRTDARSRANAACLVACYMVLIQSWPPHLALAPIAQADPPYMPFRDAGYSQADFIL
FT                   NIQDVVYGVWKAKEQGVCGLRDFSLEEYEKFERVDMGDFNWISPHFLAFASPQHQPVAP
FT                   IPRDSPEYAALPSTVSEVRSSRLPLPFKNVLEHFATRGVGLVVRLNSELYSPSYFTALG
FT                   ISHIDMIFEDGTCPPLPLVKKFIRMAHEMINVKHKAIAVHCKAGLGRTGCLIGAYLIYR
FT                   YGFTANEVIAFMRFMRPGMVVGPQQHWLHLNQGSFREWWFEDCMKEKLAQMQPNPVTPG
FT                   RSPAKHRAAAVTTPPQNGHSKRSALGEIDNNEATPIYDDNLPAPTPGQPRKSHRKDSRH
FT                   HPYSRTASGSLVVDKDTRKTRRSTDSSESEEETQLRMLAKQRSSKSPAASPGQRSISYS
FT                   ATVTASYTLNDDIHEDRENWGGAAQPPKTPVTSKTSGAVSVSKVRSSSRRVTGESKGVR
FT                   KPSGRIGSTGSPVRVKAQA"
FT   gene            complement(135115..135684)
FT                   /locus_tag="ANIA_05056"
FT                   /old_locus_tag="AN5056.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(135115..135269,135351..135534,
FT                   135600..135684))
FT                   /locus_tag="ANIA_05056"
FT                   /old_locus_tag="AN5056.4"
FT                   /note="transcript_id=CADANIAT00005332"
FT   CDS_pept        complement(join(135253..135269,135351..135534,
FT                   135600..135614))
FT                   /locus_tag="ANIA_05056"
FT                   /old_locus_tag="AN5056.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005332"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005332"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005332"
FT                   /db_xref="GOA:Q5B324"
FT                   /db_xref="InterPro:IPR020100"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B324"
FT                   /protein_id="CBF76185.1"
FT                   /translation="METIKNTVNYVTESIQGAGATASKEVNKDVAKDNNADLTTRATAA
FT                   KDALFDKKDEKVHETQADVYKEAAKH"
FT   gene            136063..136375
FT                   /locus_tag="ANIA_11456"
FT                   /old_locus_tag="AN11456.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(136063..136085,136174..136375)
FT                   /locus_tag="ANIA_11456"
FT                   /old_locus_tag="AN11456.4"
FT                   /note="transcript_id=CADANIAT00005333"
FT   CDS_pept        join(136063..136085,136174..136375)
FT                   /locus_tag="ANIA_11456"
FT                   /old_locus_tag="AN11456.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005333"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005333"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005333"
FT                   /db_xref="GOA:C8V826"
FT                   /db_xref="UniProtKB/TrEMBL:C8V826"
FT                   /protein_id="CBF76187.1"
FT                   /translation="MIPVASASTGLASAGLIKQILEQEEDGTGKKPHIMLDQDCIERGY
FT                   GSHAVWLDRELTLDHVGFQPEELATVPCR"
FT   gene            complement(138364..139897)
FT                   /locus_tag="ANIA_05055"
FT                   /old_locus_tag="AN5055.4"
FT                   /product="methionine aminopeptidase, type I, putative
FT                   (AFU_orthologue; AFUA_8G00460)"
FT   mRNA            complement(join(138364..138512,138593..139139,
FT                   139198..139511,139671..139897))
FT                   /locus_tag="ANIA_05055"
FT                   /old_locus_tag="AN5055.4"
FT                   /note="transcript_id=CADANIAT00005334"
FT   CDS_pept        complement(join(138364..138512,138593..139139,
FT                   139198..139511,139671..139743))
FT                   /locus_tag="ANIA_05055"
FT                   /old_locus_tag="AN5055.4"
FT                   /product="methionine aminopeptidase, type I, putative
FT                   (AFU_orthologue; AFUA_8G00460)"
FT                   /note="transcript_id=CADANIAT00005334"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005334"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005334"
FT                   /db_xref="GOA:C8V827"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C8V827"
FT                   /protein_id="CBF76189.1"
FT                   /translation="MPNMSEAGYQRQLLLLPRLLQEELDRGLFNPFPTYQFTGSVRPVY
FT                   PLSPRRPVPKIITHPDWAETGIPRREMRLSRSKWDLLDAKGQQAMRKVCRLAREVLDIT
FT                   AAAVKPGVTTDYLDEICHNACIERGSYPSPLNYNHFPKSICTSVNEVVCHGIPDQRVLL
FT                   DGDILNLDVSLYHGGYHADLNETYYVGDKAKADPDAVKLIETTRQALDMAIEIVKPGVP
FT                   IREFGRIIEKHAASRGLAVIKTWGGHGINSEFHPPPWIPHYAKNKAVGTCKPGMTFTIE
FT                   PILTLGANREKYWPDDWTNVTMDGKRTAQFETGVEVLTARQENSPGGPIPIPEVVNGVA
FT                   DGVANGDANRDANGAAINES"
FT   gene            141857..142897
FT                   /locus_tag="ANIA_05054"
FT                   /old_locus_tag="AN5054.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(141857..142411,142534..142578,142643..142897)
FT                   /locus_tag="ANIA_05054"
FT                   /old_locus_tag="AN5054.4"
FT                   /note="transcript_id=CADANIAT00005335"
FT   CDS_pept        join(141857..142411,142534..142578,142643..142897)
FT                   /locus_tag="ANIA_05054"
FT                   /old_locus_tag="AN5054.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005335"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005335"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005335"
FT                   /db_xref="GOA:Q5B326"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B326"
FT                   /protein_id="CBF76191.1"
FT                   /translation="MAITIPDYDAIVIGGGFSGIRMLWKFQRLGLTARCFDAGSEIGGT
FT                   WWCNRYPGCRTDREAWVYALRFLPELLEEWDFTERYPSQEEIQWYLRLVVDRYDLRRNI
FT                   KFRAIVVSAHYGDCDNLWSIRTKDGSMATSRYFLPATGITSTPKEPSFPGLRRSKGRCT
FT                   QRRPGQSMRSTLKTLESAWSAQEEVKKNFGVTSDIAKKRSDMSSKMVGRGCYNFQLGTF
FT                   DDSFMDPDANAATANFIRHKIRSIVREPETAEALCQAYLFGARRPPCADRYYETFNRCH
FT                   VYC"
FT   gene            144604..145644
FT                   /locus_tag="ANIA_05053"
FT                   /old_locus_tag="AN5053.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            144604..145644
FT                   /locus_tag="ANIA_05053"
FT                   /old_locus_tag="AN5053.4"
FT                   /note="transcript_id=CADANIAT00005336"
FT   CDS_pept        144648..145544
FT                   /locus_tag="ANIA_05053"
FT                   /old_locus_tag="AN5053.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005336"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005336"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005336"
FT                   /db_xref="GOA:C8V829"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C8V829"
FT                   /protein_id="CBF76193.1"
FT                   /translation="MPHPTSQGRAVTPAEARLIERAETAFITAQIDAGRQVYPEDGFQA
FT                   ESIGGGVAAVTKASFGRKLNHVAGIGMERPVTDKDIEDIERLFKAIGVQPEINLCPFAH
FT                   NSAMEALKKRGYMICAEMNVYALSLQDYEAEDGSHHKDGECKQTKGNDIDITPVSKEDY
FT                   ALFIRSSTTGFASTGSPSPDLFRALATIATLRPDTRLYVAKIDGKIAGTAGLALITTSL
FT                   GKVAELYIDSTLPEFRGRGVQVALLKARLAEAKRDGYDIAAVTTWPGGVSARNMERVGF
FT                   KLAYRKDVYTPGSPGCG"
FT   gap             146879..146978
FT                   /estimated_length=unknown
FT   misc_feature    146979..767837
FT                   /note="contig 1.84 954..621812(-1)"
FT   gene            147706..150014
FT                   /locus_tag="ANIA_05052"
FT                   /old_locus_tag="AN5052.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(147706..147929,147985..149232,149285..149570,
FT                   149625..150014)
FT                   /locus_tag="ANIA_05052"
FT                   /old_locus_tag="AN5052.4"
FT                   /note="transcript_id=CADANIAT00005337"
FT   CDS_pept        join(147706..147929,147985..149232,149285..149570,
FT                   149625..150014)
FT                   /locus_tag="ANIA_05052"
FT                   /old_locus_tag="AN5052.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005337"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005337"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005337"
FT                   /db_xref="GOA:C8V830"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8V830"
FT                   /protein_id="CBF76195.1"
FT                   /translation="MTDSTPAIRRNGLLQSCEPCRKSKLKCDHGRPVCGRCIAKNITQR
FT                   CFYHPAPMTKDASQPPSYRPAKRPRTESSLTPSPEPTSASGTASASASASTVQYGLRLA
FT                   AADQRPSTTPGYLGSTSFSAVFSEHRANISFEEGNHAPDGVLSKLTDGYRLESGLEVIK
FT                   FLYRNNIWEILIRKFYAGHLMAVVSNLIIRAIIISLRRIFDAIDREKDVEKQLRDLVQR
FT                   IFQSSAHPLTSHASMTVEEYFASFTDENLRWEVVGLVLATAGIAMMSTSDDDPDVLRVA
FT                   PDAQGAEMLRSRLVEASRTCLLFCATAASVNELLGFYQYNDMLLRTQYYGDTSTPCSHD
FT                   TNIATNDSIGYAAWRKLGNLTATIYAAGLHQESTRAQNCPPFLHQWRKMCFAAAFYADK
FT                   SLSTFVGRPPFINYRYCSISPPLDIKDEDLIAGEEQLRRAMANLDSSGWNTKGNTLRGS
FT                   LLRLRFHLAVLREQALEIALGNYDDKTILSKYNELIQTAQNQWQSCPVYLRHDQYIPNG
FT                   ESPNITFARRHIYLDYLYTLFLVQRMVVKRTNTSQEALFMTSREVLAIILEVTGERHPG
FT                   VDMSRHHSWIVLYYGLPSASTLAFELLRQTQEPGPHPVMPPRPEIIRNLSVFVSCLSWV
FT                   ATPGQGNYRTCKAVEKKLSDILDQILDPKPDPQPVQGFLDASGGYPDHDAAGLYSLLNW
FT                   YAPNNIDLDSFESPAKDEFLF"
FT   gene            complement(150199..150771)
FT                   /locus_tag="ANIA_05051"
FT                   /old_locus_tag="AN5051.4"
FT                   /product="RING finger domain protein, putative
FT                   (AFU_orthologue; AFUA_3G12190)"
FT   mRNA            complement(join(150199..150207,150244..150502,
FT                   150573..150695,150761..150771))
FT                   /locus_tag="ANIA_05051"
FT                   /old_locus_tag="AN5051.4"
FT                   /note="transcript_id=CADANIAT00005338"
FT   CDS_pept        complement(join(150199..150207,150244..150502,
FT                   150573..150695,150761..150771))
FT                   /locus_tag="ANIA_05051"
FT                   /old_locus_tag="AN5051.4"
FT                   /product="RING finger domain protein, putative
FT                   (AFU_orthologue; AFUA_3G12190)"
FT                   /note="transcript_id=CADANIAT00005338"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005338"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005338"
FT                   /db_xref="GOA:Q5B329"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B329"
FT                   /protein_id="CBF76197.1"
FT                   /translation="MCLIFTVYFNRRERRPPSKKSRKRDSSDKLRKLDAVSPSRTLEEC
FT                   LVFSPLLWMVSHYRLFGSPSLTTLHCSVVCLEPVLRSQVIRELKCLHVFHRECLDKWYL
FT                   QDHYNCPLCHRAYFYQETRPTNDFVWMIG"
FT   gene            complement(152347..154599)
FT                   /locus_tag="ANIA_05050"
FT                   /old_locus_tag="AN5050.4"
FT                   /product="MFS sugar transporter, putative (AFU_orthologue;
FT                   AFUA_3G12170)"
FT   mRNA            complement(join(152347..152525,152583..152743,
FT                   152791..153177,153216..153518,153565..153844,
FT                   153895..154460,154537..154599))
FT                   /locus_tag="ANIA_05050"
FT                   /old_locus_tag="AN5050.4"
FT                   /note="transcript_id=CADANIAT00005339"
FT   CDS_pept        complement(join(152347..152525,152583..152743,
FT                   152791..153177,153216..153518,153565..153844,
FT                   153895..154072))
FT                   /locus_tag="ANIA_05050"
FT                   /old_locus_tag="AN5050.4"
FT                   /product="MFS sugar transporter, putative (AFU_orthologue;
FT                   AFUA_3G12170)"
FT                   /note="transcript_id=CADANIAT00005339"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005339"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005339"
FT                   /db_xref="GOA:Q5B330"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B330"
FT                   /protein_id="CBF76199.1"
FT                   /translation="MGRLYTFNLALFAATGSFLFGYDSGVMTDVIASKNFLRYFNTTKT
FT                   SAIIGAINSTFSGGAAIGALQGGLTMDRFGRKFTIQMGASICLVGAILQAAATNLAMIL
FT                   VGRILAGWAVGLMSMSVPVYQSECAHPRNRGMIIGLAQQMIGVGFIVSTWIGFGSLHAP
FT                   ESSEFQWRFPLAFQVVPAVILLIGLFFLPESPRHLIGKEKYEEAMKVLRKLHYDGTNED
FT                   WIQREYGEIKSTIDAERAVTEPGWLVMFKVPQLLTTADRYRHGVLVQVFTQMTGINVIN
FT                   YYQTIMYENLGITGSTNILVTGIYNCLGPLANLLFILFVLDKVGRRRPMLFGAIGITIA
FT                   LFCEAALNSQNEDGHRRGYSIGGVFFIFCVTIIFSWSFGPCSWVYMAEVMPMQIRGRGN
FT                   AFATGVGNWTVSTLWSQVSPIALGKIGWKFYFIFAGWNICVTLPVVYFFFIETKQKSLE
FT                   EIDILFGGRALGTLPEDIADKDNEVVATTEHHDKREV"
FT   gene            157752..159642
FT                   /locus_tag="ANIA_05049"
FT                   /old_locus_tag="AN5049.4"
FT                   /product="CDF divalent metal cation transporter (Eurofung)"
FT   mRNA            join(157752..158203,158365..159188,159242..159642)
FT                   /locus_tag="ANIA_05049"
FT                   /old_locus_tag="AN5049.4"
FT                   /note="transcript_id=CADANIAT00005340"
FT   CDS_pept        join(157752..158203,158365..159188,159242..159642)
FT                   /locus_tag="ANIA_05049"
FT                   /old_locus_tag="AN5049.4"
FT                   /product="CDF divalent metal cation transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005340"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005340"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005340"
FT                   /db_xref="GOA:Q5B331"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B331"
FT                   /protein_id="CBF76201.1"
FT                   /translation="MTRNMKLSRCQCGVVSRRRGAVAEKRSQSDISGANNQPSSQYCLI
FT                   DPRMASSGRRTRPQFSVPSSPSDNESPIRPRRPSLEPQVDILSTRGQYLSSLIRRRSFS
FT                   SSQSLYRPDGYIDTERDDTGSFRHRVEGPATVRARELIGERRPPYNWRQLYERNNNLIS
FT                   QYVYIDRLLDSSLPRRLIVEYQQNRAVESAKRTNAGAHEGGYGSFENLADDEIPKKIKR
FT                   TPRNLYRIPSESSLLLPQTTDGEASPLEDVTPKGHDFVDSGARIVTVAIYVNFVANVIL
FT                   LAAKIAALLMTNSVSVLASLVDGALDFLSTTIVWITTALIRRQDRYEYPISRRRLEPLS
FT                   VLVFAVVMVTSFFQVAITSAGRLISSEHAVIQLSVPSAAIMGSTVVVKFLCWFWCRLIN
FT                   NSSVQALAQDAMTDVVFNFFSIVFPLVGGFTNIWFLDPLGGLILSIYIIWNWSRTASEH
FT                   IRHLTGAAASREDVSILLYMTMRFSRSILKIQNLRAYYAGDLLNVEVDIVLPDNSSLRD
FT                   SHDLGESLQYMLESVPTVERAFVHMDYDPWNIPSHMNQQEA"
FT   gene            161308..163267
FT                   /locus_tag="ANIA_05048"
FT                   /old_locus_tag="AN5048.4"
FT                   /product="homeobox transcription factor, putative
FT                   (AFU_orthologue; AFUA_3G12160)"
FT   mRNA            161308..163267
FT                   /locus_tag="ANIA_05048"
FT                   /old_locus_tag="AN5048.4"
FT                   /note="transcript_id=CADANIAT00005341"
FT   CDS_pept        162041..163267
FT                   /locus_tag="ANIA_05048"
FT                   /old_locus_tag="AN5048.4"
FT                   /product="homeobox transcription factor, putative
FT                   (AFU_orthologue; AFUA_3G12160)"
FT                   /note="transcript_id=CADANIAT00005341"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005341"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005341"
FT                   /db_xref="GOA:C8V834"
FT                   /db_xref="UniProtKB/TrEMBL:C8V834"
FT                   /protein_id="CBF76203.1"
FT                   /translation="MPEGDSFASDAVDKDERGQVEESSQTSVAISESPNSSQQAADSSL
FT                   VELNAMQSPIDASSNALHPNSAKRKRSGSDLGETNKESATPSMLDSLKSPPSLRLSLSF
FT                   DGEAMVRKQGELTPSPPKGRNSLRISMSADGQAVIRANGEPSPSKNRISMFPTRTPRLA
FT                   GLRRSNSAVVLGTPRSLEREKSFGRSRDPRNWESIFDTDARSALATPFSSQSTPKSALL
FT                   SGGKRSLTRSLSARHPSLLTPNSDTQGTPITQAMRQKRQKLSRTVSSLGRLESGRKALG
FT                   EKFPSTLKNSKSAKDDLELEAGDSDKENWIPGTRVSQSRRRTVSSHTHRPVLKDSNGRD
FT                   GRPHDASTSGRSRWSQPSHRKTVGPSKSLSMSGLEGDVSAFMGGNAASQEEDLDCIQGL
FT                   LSLSQGAWR"
FT   gene            complement(163436..164427)
FT                   /locus_tag="ANIA_05047"
FT                   /old_locus_tag="AN5047.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(163436..163456,163693..163728,
FT                   163775..163873,164275..164427))
FT                   /locus_tag="ANIA_05047"
FT                   /old_locus_tag="AN5047.4"
FT                   /note="transcript_id=CADANIAT00005342"
FT   CDS_pept        complement(join(163436..163456,163693..163728,
FT                   163775..163873,164275..164427))
FT                   /locus_tag="ANIA_05047"
FT                   /old_locus_tag="AN5047.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005342"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005342"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005342"
FT                   /db_xref="GOA:Q5B333"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B333"
FT                   /protein_id="CBF76205.1"
FT                   /translation="MEAEKRSLVKAKEPSMTRLLGTENALRLSSLLHLGPKLYPLSISL
FT                   YLFFAQEADNIREAPKNNPHFTGTSRKSQGQGGPTPGSSVLAKNKLVNDVVYEIPQS"
FT   gene            168819..169375
FT                   /locus_tag="ANIA_05046"
FT                   /old_locus_tag="AN5046.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(168819..169037,169102..169148,169203..169375)
FT                   /locus_tag="ANIA_05046"
FT                   /old_locus_tag="AN5046.4"
FT                   /note="transcript_id=CADANIAT00005343"
FT   CDS_pept        join(168882..169037,169102..169148,169203..169224)
FT                   /locus_tag="ANIA_05046"
FT                   /old_locus_tag="AN5046.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005343"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005343"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005343"
FT                   /db_xref="GOA:Q5B334"
FT                   /db_xref="InterPro:IPR001542"
FT                   /db_xref="InterPro:IPR036574"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B334"
FT                   /protein_id="CBF76207.1"
FT                   /translation="MQFSAIVLSAVALFGSMTFAAPAPAPDAELMARSSCQLGGIFGAG
FT                   DAACSASCIRAGTYHGGYCNDKQVCICTH"
FT   gene            complement(170186..172144)
FT                   /locus_tag="ANIA_10613"
FT                   /old_locus_tag="AN10613.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            complement(join(170186..170670,170742..171386,
FT                   171453..171829,171909..171972,172051..172144))
FT                   /locus_tag="ANIA_10613"
FT                   /old_locus_tag="AN10613.4"
FT                   /note="transcript_id=CADANIAT00005344"
FT   CDS_pept        complement(join(170186..170670,170742..171386,
FT                   171453..171829,171909..171972,172051..172144))
FT                   /locus_tag="ANIA_10613"
FT                   /old_locus_tag="AN10613.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005344"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005344"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005344"
FT                   /db_xref="GOA:C8V837"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8V837"
FT                   /protein_id="CBF76209.1"
FT                   /translation="MNSLPLLLAAASVGFLYVILTKGRREKGLPPGPPTLPFLGNLHQI
FT                   PVKGSYLKFTEWASQYGGLYSLKLGTGTAIVITDPRLVKEVIDRKSSKYSNRPESFVAH
FT                   TITGGSHLLVMQYGPLWRTMRKLVHQHFMETAVEKSHIHVQNAGAVQMLRDFCVRPDLH
FT                   MLHPKRYSNSIIMSLVYGVRTPSVHTAHMTQLYEMMVRILSLPFLCTQGMPTDRAFVLF
FT                   QENWSKVMEPGNTPPVDIYSFLHYIPQKLFGNWLSRAKEVRDEMCQLYGQYLDLVVSRR
FT                   KKIGSTGSFMDTVLDQNEKLGLTRHQLYFLGGVLMEGGSDTSSSIILAFIHAMTKWPQV
FT                   LKKAQAEIGNVIGEDRMPAWSDYGSLPYVAATVKEAMRWRPAVPLAFPHAAAEDDWIDG
FT                   HFIPKSSTIIVNGWGMHHNEARFGNPSVFDPDHYKGQTALAPELANASDYTTRDHYGYG
FT                   TGRRICPGIHVAERNLFLAISKLIWAFSIEPGVDESGKVIEPDLDPRTGYSEGFLVCAN
FT                   DFPCRIMPRSEAKRESIMREYQRAQEEVFSRFESPSS"
FT   gene            complement(172705..174058)
FT                   /locus_tag="ANIA_10624"
FT                   /old_locus_tag="AN10624.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(172705..172864,172955..173199,
FT                   173295..173513,173549..174058))
FT                   /locus_tag="ANIA_10624"
FT                   /old_locus_tag="AN10624.4"
FT                   /note="transcript_id=CADANIAT00005345"
FT   CDS_pept        complement(join(172705..172864,172955..173199,
FT                   173295..173513,173549..174058))
FT                   /locus_tag="ANIA_10624"
FT                   /old_locus_tag="AN10624.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005345"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005345"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005345"
FT                   /db_xref="GOA:C8V838"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C8V838"
FT                   /protein_id="CBF76211.1"
FT                   /translation="MTAATKPIRLVRLAHVCYTHADLTAASRFLIDFGFQELTQTVSPS
FT                   TGQRTIYYRGTTTQQPFVYCAREGPEDAFGGATFVVESREDLDYAAQTLPGSEGIVDLE
FT                   AEGVPGGGLSLTFHDPVDGFPFHLVWGQRGREEHGENQGGNGLPVLQYNFVRVSNLIPL
FT                   LSAIHRCPTEKHRPGNSTQRFKPGTYSLASRHRGIAYCIHTKLQSGPAPVHKLGHFGMC
FT                   VTDFARAYEFYTTRFNFKASDLIHDEAGNDVTAFLHLSRGRELVDHHCFFIFEGPKWHV
FT                   HHSSFETHDFDTQLLGHHWLREKGYTNCWGVGRHIMGSQIFDYWFDPSRFILEHYVDGD
FT                   LVDETYPTHRSLASPDNLHVWGESLYFHAHTRYWLWC"
FT   gene            174462..176568
FT                   /locus_tag="ANIA_05044"
FT                   /old_locus_tag="AN5044.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(174462..174621,174716..174796,174878..176308,
FT                   176381..176568)
FT                   /locus_tag="ANIA_05044"
FT                   /old_locus_tag="AN5044.4"
FT                   /note="transcript_id=CADANIAT00005346"
FT   CDS_pept        join(174462..174621,174716..174796,174878..176308,
FT                   176381..176568)
FT                   /locus_tag="ANIA_05044"
FT                   /old_locus_tag="AN5044.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005346"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005346"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005346"
FT                   /db_xref="GOA:Q5B336"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B336"
FT                   /protein_id="CBF76213.1"
FT                   /translation="MDPSFLTNSDASEAIPDTNTMSGASVDDIVETEFLIAGAGPAGAS
FT                   LACFLTSYGLKGIMISAAPGTEDTPRAHITNMAALECLRDLGLDREIRKVACDGEHMVH
FT                   TRWCHSMAGEEYARIYSWGNDPRRKVNLESEFPCALAKREGKSNMDQGDYERASPCSPV
FT                   DLPQTLLEPILVRYATWQGFTTRFDTTLLSFARDEKQRITATVRDNLSHKEYQIRTRYL
FT                   FGADGARSQIVKQLGLPLTVKPGQGLAINVLVKADLSHLVAHRKGNLHWVMQPDRDHPS
FT                   FGWMAIIRMVKPWDEWMFILFPTRGYDPASVSPSKEEYLHRVRELIGDETPAEILNISK
FT                   WYINEIVAETYSDGNNVFCLGDAVHRHPPLNGLGSNTCIQDAFNLAWKIAYVHRGIAGA
FT                   PLLSTYSAERQPVGHGIVTRANQAFRDHHQIWAALGMLGASLEERQRALEELTEPTAAG
FT                   RERRQTLQKAVAHTAHEFHGLGIEMNQRYEGPGIYDADEADPFVLPGRAAEDPVLYYEP
FT                   NTYPGCRLPHVWLNRAIPGQPVSTIDLAGHGAFTLFTGIGGFRQDWEDVYFEWERLCGV
FT                   EESGAVLVRPDRYVAWRADSVLKDAAACEEKLSAVLKAILCVD"
FT   gene            complement(177020..178484)
FT                   /locus_tag="ANIA_10623"
FT                   /old_locus_tag="AN10623.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(177020..177068,177115..178484))
FT                   /locus_tag="ANIA_10623"
FT                   /old_locus_tag="AN10623.4"
FT                   /note="transcript_id=CADANIAT00005347"
FT   CDS_pept        complement(join(177020..177068,177115..178484))
FT                   /locus_tag="ANIA_10623"
FT                   /old_locus_tag="AN10623.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005347"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005347"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005347"
FT                   /db_xref="GOA:C8V840"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C8V840"
FT                   /protein_id="CBF76215.1"
FT                   /translation="MPLDQQDTLQAMFTRRSWPCSEHTRFWVSRPKRPSNCECTTKKGL
FT                   ERQRNRHLIDTSPSTMIYFDNMMTISLFHQPSFPEKLARITSPTQLAALLAAMFAFAVR
FT                   FRPEEMDVNRRAAWFLNVALQQIDVALDECGDETPPLCLLQAYVLAAHCQLTQGVLGRA
FT                   WRTLGSCVRLAYEMNLHLVDVQGPRNAAAAVDIARWCSDEEQRRAWWAIWEMDVFATTI
FT                   RRTPTAMDWSQIEILLPVDDEHWFQCQLQESCFFEPDPIRRWKMLESCGNQSPKAWFIV
FT                   INSLMKEAQRISSPRGIPSRSQSDQVDEAHHQLEIIANAIRCFQLALPNHLKYKNQDLM
FT                   FDVRGARRLSSAVYNINMMTHLARLMVYRYDVFKGRVRVSLLSCDDQHNHDRSSSMREG
FT                   EHAAIREYFDAADKILTIIQRSSADHIQYTMPFLSSTIWLASAVQLMRSQLCRPGTLKN
FT                   VSASGTCIRPFSRA"
FT   gene            complement(179334..180422)
FT                   /locus_tag="ANIA_10612"
FT                   /old_locus_tag="AN10612.4"
FT                   /product="fumarylacetoacetate hydrolase family protein
FT                   (AFU_orthologue; AFUA_1G02370)"
FT   mRNA            complement(join(179334..179535,179625..179742,
FT                   179811..180156,180222..180422))
FT                   /locus_tag="ANIA_10612"
FT                   /old_locus_tag="AN10612.4"
FT                   /note="transcript_id=CADANIAT00005348"
FT   CDS_pept        complement(join(179334..179535,179625..179742,
FT                   179811..180156,180222..180422))
FT                   /locus_tag="ANIA_10612"
FT                   /old_locus_tag="AN10612.4"
FT                   /product="fumarylacetoacetate hydrolase family protein
FT                   (AFU_orthologue; AFUA_1G02370)"
FT                   /note="transcript_id=CADANIAT00005348"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005348"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005348"
FT                   /db_xref="GOA:C8V841"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C8V841"
FT                   /protein_id="CBF76217.1"
FT                   /translation="MAPRSTWTRLIRFVAEDDGQTHLGEVDAAQYPDIGLSVVNGERVA
FT                   VRQVTGSIFDGIVTEKTLHVARLLAPIDMEDVPLIRCMGLNYRDHAKEANMPIPDVPVL
FT                   FIKPRTALNGPHPAMINVPMIAQDGSSDYEAELSVILSRTGRDIPECDAMDYVLGYTCG
FT                   NDVSARTQQFKNSQWSFSKGLDGSCPLGPVLVAPSELDPHQLDIKAIHNGAVVQDSNTR
FT                   EMIFDIPKIIAFLSQGTTLERGTVIMTGTGPGIGAMRDPKVVLRDGDDMRVQIQGIGTL
FT                   CNRVYYE"
FT   gene            complement(182597..183710)
FT                   /locus_tag="ANIA_05042"
FT                   /old_locus_tag="AN5042.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(182597..182869,183457..183521,
FT                   183653..183710))
FT                   /locus_tag="ANIA_05042"
FT                   /old_locus_tag="AN5042.4"
FT                   /note="transcript_id=CADANIAT00005349"
FT   CDS_pept        complement(join(182597..182869,183457..183521,
FT                   183653..183710))
FT                   /locus_tag="ANIA_05042"
FT                   /old_locus_tag="AN5042.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005349"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005349"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B338"
FT                   /protein_id="CBF76219.1"
FT                   /translation="MPLTRSTSQTKEVLSREWRRISFPKVILVLQLQDDYPSLRYANDD
FT                   SSYKTATPAHPAQPPKHDYQQGPKVQQARLDGTLLDSIPPLLQEVFGPIPMLIFNNEVT
FT                   NARSSVQEPSQICLGVLGVEALSSFLL"
FT   gene            complement(187315..188880)
FT                   /locus_tag="ANIA_05041"
FT                   /old_locus_tag="AN5041.4"
FT                   /product="hypothetical aromatic aminoacid transaminase
FT                   (Eurofung)"
FT   mRNA            complement(187315..188880)
FT                   /locus_tag="ANIA_05041"
FT                   /old_locus_tag="AN5041.4"
FT                   /note="transcript_id=CADANIAT00005350"
FT   CDS_pept        complement(187315..188880)
FT                   /locus_tag="ANIA_05041"
FT                   /old_locus_tag="AN5041.4"
FT                   /product="hypothetical aromatic aminoacid transaminase
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005350"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005350"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005350"
FT                   /db_xref="GOA:Q5B339"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B339"
FT                   /protein_id="CBF76221.1"
FT                   /translation="MSRLHIHDIESLRASSAPLPLTVAPATSSEHFKSIHTRQRPVACR
FT                   LDHHFSAESRDFNGADFKKGASPIGPRKIIPLGTGRPTADYYPWESFTFHGVSPASLAS
FT                   STANDSGHSVYTVTKRDATYNLSLGMNYGHAAGSPHLLRFITEHIELVHNPPYQDWRTF
FT                   LSCGATVALEVALRIFCNRGDWILTEQYTYSGTLETATLTCARVYGVEMDADGLRSDVL
FT                   ERTLASWDTSKGRKPRVLYTIPTGQNPTGYSQSLERRAAIYAIAVKHDLIIIEDDPYYF
FT                   LRLGPYNEASTDAEEPTKISPDAFYSTGDPSYLSLDTSGRVVRLDSTSKILAPGLRAGW
FT                   VTASSQIIDKFLAYQEVSTIAVSGSSQLMLWSLLDQGWGHTGFSSWLLHLSGEYRQRRN
FT                   ILLRACQQHLPRDIAEWVPPRYGMFLWIKVNWRRHPVIGKFETKATPEEVDSRLQGLEA
FT                   QIVSDALSRGVLITKGSLFSWNKRPNGELHFRMTFAAAEKADLEEGVRLLGETLRGVFQ
FT                   TCLD"
FT   gene            190988..193361
FT                   /locus_tag="ANIA_05040"
FT                   /old_locus_tag="AN5040.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(190988..191313,191375..192105,192167..192584,
FT                   192715..192916,192975..193361)
FT                   /locus_tag="ANIA_05040"
FT                   /old_locus_tag="AN5040.4"
FT                   /note="transcript_id=CADANIAT00005351"
FT   CDS_pept        join(190988..191313,191375..192105,192167..192584,
FT                   192715..192916,192975..193361)
FT                   /locus_tag="ANIA_05040"
FT                   /old_locus_tag="AN5040.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005351"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005351"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005351"
FT                   /db_xref="GOA:Q5B340"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B340"
FT                   /protein_id="CBF76223.1"
FT                   /translation="MQSLAQLKYPFLPYTPYTPTLRLLLYPEHSGTAATAALRHFLNTA
FT                   EPRRMASRLAACEPCRKSKLACDHNRPVCTRCSNNNRKGHCVYRNAPFKRKRIDTGPAL
FT                   NPSRSTRTIADTESIVPASAPARTPNRYPNPGYTGSSSHVAIFNYISAKDNSPNSVLDG
FT                   ETTLPRTQPEDDLLTQRGADCLKQLLSTFSLQHMEDLVQSWLARGANLTLTGGIVQHCL
FT                   KGVDLPISATSSIEGWHLVNAKYLSANSSQPFETCKTMSFPGFCAQFTDQNTRWETLGI
FT                   FLSAVTRAAMDTPFFQSLYTSEEWRRTLQKFCMRVADSALEIALSLDCLNDLQLFLQYE
FT                   NWIVHTNVYGDHSYHSWRRLGDLIASIYALGYHEKLDNYPDCPPFLTELRKAVFARVYS
FT                   GDKNVAIFLGQPPRIDKRFCHFQVPSSPGAEDIWLLSGTAPGGVDIAEWRPDTRASFMA
FT                   ESRWTAMCAYLKEDILCLQREKGSDAADFQRRIASFERDFLAAVRLNHLHVMFMLSLLQ
FT                   LRTPAEPDTSTVEIAEEIISLIVDLILLRDQIVNSGTSLVWKITYYALPAAGILLLALL
FT                   NQRTSPTAPRLMGPKVLQHLTILAAELQAGSIIQPCQPNFELISKAMQTIQSFLDSVAA
FT                   DAMQVAPGFLSGTMDEWPRFANQQTLDFEIGFWQSLADHPLLNQFVDGVLFE"
FT   gene            complement(194306..196030)
FT                   /locus_tag="ANIA_05039"
FT                   /old_locus_tag="AN5039.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(194306..195186,195613..196030))
FT                   /locus_tag="ANIA_05039"
FT                   /old_locus_tag="AN5039.4"
FT                   /note="transcript_id=CADANIAT00005352"
FT   CDS_pept        complement(join(194306..195186,195613..196030))
FT                   /locus_tag="ANIA_05039"
FT                   /old_locus_tag="AN5039.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005352"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005352"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005352"
FT                   /db_xref="GOA:Q5B341"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B341"
FT                   /protein_id="CBF76225.1"
FT                   /translation="MHLSHILVMFSKGKDRLNRVQAKYRIENIPLPFVKQDIQAGQEWI
FT                   RGAMLCALVTASIGILNVILTIIAAGIAYSKKASDTHLTYAEIYEGDCSITSNWTTGMH
FT                   LVINVLSSILLAASNYVMQCLSAPSRVDIDRAHSKDRENLGGSSSLASFDQMRGYLGAR
FT                   PDFISQSSVNSFYLETQHWNYPIWSFKYKGSGDWGDLFDLCYTPWQGQNDAACYDRAID
FT                   TRTLQDFLWTENPTEMQLGNFFNTASNWRNSSWAAEISFRIDVPSDPGGGFSMLGECPC
FT                   EIEYTDGLSHNITISGCMTSDAQQHCQLYFSLPICIAVIVCNIIKVLCMYMTAKKDRKE
FT                   IFLTIGDALSSFLDKPDATTRGQSVLPANDITYGLRSWAKRALTMPFKNNLANVTIPRE
FT                   TSPQLFPKRKRWIQAASWRRWAFTYILYLPQPK"
FT   gene            197691..198414
FT                   /locus_tag="ANIA_05038"
FT                   /old_locus_tag="AN5038.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(197691..197702,197826..198104,198151..198414)
FT                   /locus_tag="ANIA_05038"
FT                   /old_locus_tag="AN5038.4"
FT                   /note="transcript_id=CADANIAT00005353"
FT   CDS_pept        join(197691..197702,197826..198104,198151..198414)
FT                   /locus_tag="ANIA_05038"
FT                   /old_locus_tag="AN5038.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005353"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005353"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005353"
FT                   /db_xref="GOA:Q5B342"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B342"
FT                   /protein_id="CBF76227.1"
FT                   /translation="MSDVSTSMSTALRDPFRTSRRSLTRTATATSDVIQQDDTCDEIAK
FT                   ANKMDSDKIADYNSLTWGWEGCNGLQRGQAICLSEGMPPFPKSVDENVCGPQPTGLALQ
FT                   LLRFRIINARAVSSVSGKNACAKGSSSAIQASGLKGSSERTGTGKAVSERLLNYLTYPI
FT                   HSLYPQSSAANPISKSAVKTW"
FT   gene            201029..201583
FT                   /locus_tag="ANIA_11455"
FT                   /old_locus_tag="AN11455.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(201029..201240,201535..201583)
FT                   /locus_tag="ANIA_11455"
FT                   /old_locus_tag="AN11455.4"
FT                   /note="transcript_id=CADANIAT00005354"
FT   CDS_pept        join(201029..201240,201535..201583)
FT                   /locus_tag="ANIA_11455"
FT                   /old_locus_tag="AN11455.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005354"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005354"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005354"
FT                   /db_xref="GOA:C8V847"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:C8V847"
FT                   /protein_id="CBF76229.1"
FT                   /translation="MVTVIMLNDGVDCNQAMRLSHQFVQQEAAQGFQKVERHLRTQSLV
FT                   VSTERSVEDAFIEGCKNVVMGLTHWRQSPSYSPSDWADLVN"
FT   gene            complement(202298..206424)
FT                   /locus_tag="ANIA_05037"
FT                   /old_locus_tag="AN5037.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(202298..203919,203962..204288,
FT                   204322..204331,204377..204513,204584..205096,
FT                   205169..205301,205353..205762,205824..205940,
FT                   206253..206424))
FT                   /locus_tag="ANIA_05037"
FT                   /old_locus_tag="AN5037.4"
FT                   /note="transcript_id=CADANIAT00005355"
FT   CDS_pept        complement(join(202298..203919,203962..204288,
FT                   204322..204331,204377..204513,204584..205096,
FT                   205169..205301,205353..205762,205824..205940,
FT                   206253..206424))
FT                   /locus_tag="ANIA_05037"
FT                   /old_locus_tag="AN5037.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005355"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005355"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005355"
FT                   /db_xref="GOA:Q5B343"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B343"
FT                   /protein_id="CBF76231.1"
FT                   /translation="MEYRPDNYPTLSHSPYQMKPEYDVVVVGSGYGAGVAASRMARAGK
FT                   SVAVLELGAEWRGLGGGSLLNAGVFLEATPETMRLSAWPAEIRDNSDALAEYYARAAAM
FT                   LQPSTFPTNLPTPRKMAHLEETAKKLDWRFSRVPLTTFFEPGRNSTGVSMCANQGSGHE
FT                   STGLNDGSKNSIPVTYLVDAWAWGAEIFCGCEVRYVERDGDSYLVHFAWHQKGRRSFAE
FT                   DGMAQLFWVRAKEFCFLGAGALGTTEILLRSKKHGLSCSPLVGRNMSGNGNLLVFGYNG
FT                   SKEINGVAGSTKPGPTITSMIDCYQKTPNGVCGSENNNKVGAFVIEDGCVPEPFAPVIE
FT                   WMFIMQTINIKHFFSSFFGCPLRQTKRTLAAIMSIVRGPYIPGGAIQRTATYLAMSHDN
FT                   NEVTLTLENDNPQLQGVGEGRGANIHSIKDALRRVLGVDGASMGYSYFYGFHQEEVSVH
FT                   PLGGANMSRDGTGREGVTNHLGQVFTGQGTDVHTGLIWLSINPLATITALAERSVALVA
FT                   GQRHIKIDLDTENGDIDTYSQPRGPHYNNSHAEPNRDYVSTGWHFTESLEGHVAVPSSC
FT                   VSYAAAELEGKGCSSTMGILLTVEIYRRVEGGTGPRYKGLCTGTVSCRSLSRRTMCVMR
FT                   GDLDFFVAGNESASTTLTYTLPLCTVEGRRLTLIGVKAIGQSAAFSIPRLWEATTTVKL
FT                   HILDFNNNSLGAGVVRIPLLSFWRQMRTFHTIGPRLSSLPVLLIFLLYFIIQLSLVFFY
FT                   PLIPFCGILSPTRAHSQAISAKQQPSEILEILTSDSAKIRLDVYDPIQPLGTESRAGKQ
FT                   SQPPILFLPGITGLNTSHSIFALPFQRCNMVKYFSSRGHRCYVLTPRWSHDGQTAKDGT
FT                   VFDSRLDIAAAIHHISSTSPTCDSSSPKPYIIAHCQGSVALAMALLTGIVKPEQLLGIT
FT                   ANSVFMNQVFGYWNSIKASSTLLIRAYEFLDGPYFPISFLERRKDLLQYILDFLLSLYP
FT                   VARRDRCTSPSCHRTSFAFGLLWNHENLDQEIHGNIETFFAGTFTRSLEHITRMGCAGS
FT                   CLNNNLEPLLTQKNLQNVRGVPILFMSGSENQVFNPESTLRDYELLRRTFGEHMYRRFL
FT                   VERYGHLDTIVGSQADKDVYWKVEGHINWCLRNKTTGAE"
FT   gene            complement(209064..210206)
FT                   /locus_tag="ANIA_05036"
FT                   /old_locus_tag="AN5036.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(209064..210206)
FT                   /locus_tag="ANIA_05036"
FT                   /old_locus_tag="AN5036.4"
FT                   /note="transcript_id=CADANIAT00005356"
FT   CDS_pept        complement(209064..210206)
FT                   /locus_tag="ANIA_05036"
FT                   /old_locus_tag="AN5036.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005356"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005356"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005356"
FT                   /db_xref="GOA:Q5B344"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B344"
FT                   /protein_id="CBF76233.1"
FT                   /translation="MASPSLFTRHPFKFLFTVYYLSTLPLRVLVAALYYLPPSNRSGRT
FT                   YRLALTTRLMRFWFYFATAVEFQLPKTLEPGADKARFVFIDPEKIEHRYSSPYVSVLAS
FT                   NPAINPAPIAGFWYEAPPPVGKTPRLVVLHFHGGAFVLGGARPADAFCSGPIALSKDLD
FT                   CPVLMPQYRLSNSRDRTTCFPAALQDAVTAYTYLLYTLDVAPENIVLSGDSAGGNLVIA
FT                   FLRYIKNEAADHHLPLPRAVLLWSPWVDLGTPGSSQYDRHRNVSTDFLFDALGDWGVRC
FT                   YIPDGWNREHPFYPYISPLGQEFQMEVPIFIQTGRAEVLYDSHVEFMTNLKKRGCRVEF
FT                   VEIDNAPHDTFVAADLFGIREQEGAIDRAAKMVIEAGTPP"
FT   gene            214306..216283
FT                   /locus_tag="ANIA_05035"
FT                   /old_locus_tag="AN5035.4"
FT                   /product="sodium ion/proton exchanger (Eurofung)"
FT   mRNA            join(214306..214488,214568..214959,215013..215061,
FT                   215109..215475,215524..215625,215673..216283)
FT                   /locus_tag="ANIA_05035"
FT                   /old_locus_tag="AN5035.4"
FT                   /note="transcript_id=CADANIAT00005357"
FT   CDS_pept        join(214306..214488,214568..214959,215013..215061,
FT                   215109..215475,215524..215625,215673..216022)
FT                   /locus_tag="ANIA_05035"
FT                   /old_locus_tag="AN5035.4"
FT                   /product="sodium ion/proton exchanger (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005357"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005357"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005357"
FT                   /db_xref="GOA:Q5B345"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B345"
FT                   /protein_id="CBF76235.1"
FT                   /translation="MAQGLCRVVIGVQLVIVGFQLPAKYQLHRWKEMLLCLIPNMTLMW
FT                   LCTSGCILLAIPNLNFLTALVIGSCVTCTDPILSQAIAKGPFADRYVARDLREIISSEA
FT                   GANDGFGFPFLMLATYLLRYTQGNPDQDHTAHAHVARSEDVGHMHGGLAKAMEMWFVET
FT                   WAYYIILGVVYGATLGYASMRLLRYTLRKKWIDGESYVLFPAALGLFLLGTCGCVGTND
FT                   LLACYFAGGALNWDGGYLAETEARHDEVNSCIDVLLNFGGFMYIGAVIPWDDFHQPDTT
FT                   GITYPRLILLGFIVLLFRRIPSTLALYRFMPKVCKNWKEALFMGYFGPIGIGAVFYAEH
FT                   TSHLFPPVGEGSAMEARLMGALKPTIYWLVLFSIFVHGLSIPLLSIAYKLLNVPPEVDP
FT                   LGPAEVRPLSFNQTLPPNSLLHAKRRSILVYNRFSRSKFPSNIGWDLPQFRSNNSSRAT
FT                   GHVPLVEEFPLQSVHDRQARVN"
FT   gene            complement(218553..219804)
FT                   /locus_tag="ANIA_05034"
FT                   /old_locus_tag="AN5034.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(218553..218979,219025..219719,
FT                   219769..219804))
FT                   /locus_tag="ANIA_05034"
FT                   /old_locus_tag="AN5034.4"
FT                   /note="transcript_id=CADANIAT00005358"
FT   CDS_pept        complement(join(218553..218979,219025..219719,
FT                   219769..219804))
FT                   /locus_tag="ANIA_05034"
FT                   /old_locus_tag="AN5034.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005358"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005358"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B346"
FT                   /protein_id="CBF76237.1"
FT                   /translation="MALVIPVEICHMVVDQVATVERDYSLCDIFPYALKQSARSELKTL
FT                   RLVSRNFCAAASSHLFKHIVAPADSSIRGRNSLQRLAEISRSKYSAHVRHLETGYCRWP
FT                   SYHSTSFGQDIQDLAGLLSLCLAQLSNLRVLKFRASSESLTREQESTAIRAIVSTLRYV
FT                   ALPRLEGLELFFPVAHDFKCFFSSGSTSLHIPMENILRRLKYLGLHVTAYTQERGQRYW
FT                   GTPVLPAHAALPNDLHAAHLLSTDVLPFGIIRFSPALRLTSLRLVRILIRFDHFRALID
FT                   QCKDHLKHIELCLVQLQSGTWHAVLTQLRQLPYLIDVCINSCGYPATGPNAHLAGILPE
FT                   PDDPKPLETMNFADHEGLYELKEFVNANRVTLGLDPFESTDSRWY"
FT   gene            complement(222137..224118)
FT                   /locus_tag="ANIA_05033"
FT                   /old_locus_tag="AN5033.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(222137..222150,222222..222393,
FT                   222470..222897,222963..222989,223063..223395,
FT                   223497..223516,223590..223738,223770..223833,
FT                   223889..224118))
FT                   /locus_tag="ANIA_05033"
FT                   /old_locus_tag="AN5033.4"
FT                   /note="transcript_id=CADANIAT00005359"
FT   CDS_pept        complement(join(222137..222150,222222..222393,
FT                   222470..222897,222963..222989,223063..223395,
FT                   223497..223516,223590..223738,223770..223833,
FT                   223889..224118))
FT                   /locus_tag="ANIA_05033"
FT                   /old_locus_tag="AN5033.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005359"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005359"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005359"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B347"
FT                   /protein_id="CBF76239.1"
FT                   /translation="MALALAATAQAKVAAEWLQENNKAGDPPPTGKVDKYQTVVLSGAR
FT                   DAYDRSQPSSCPTIMIGTAVPDGDKNDGWKELPKVTGFDVARLVVDEEANATLLPATAG
FT                   PDTWNKWNFGADMFAISQPYFIENTKDPSNIKRAVITIAGARRNGWQYCNGRDSVNADM
FT                   DRVIIAAPEWLNEDDHSAGAVQSNDVYFDNSSYQQGGPALGPGDVKLSSFEAYVEPAPT
FT                   SSMGCGRSTWNLRLTYRRLDKLVSSFWNKSVYPELETVVIASHSLGAQMTQRYAMLRPA
FT                   QPEDANITFGIMNPGSYVWPVSDRPEHEDDCEDTYNDWPYGIDDGQSYALPEYVRDEVV
FT                   GNRSMVRERYFSRNIFYGFGLDDHGDGDGHCEAQWQGDSHLERGQNFDKMLQDLSDGFP
FT                   ETQSVYYIPGVAHDNYKMFVSEPMQRKMFLFDTSNDTKDANQARDSDDSEPTSGAPYQL
FT                   TMPRFLLGSALLSVVVALAE"
FT   gene            complement(226277..227887)
FT                   /locus_tag="ANIA_05032"
FT                   /old_locus_tag="AN5032.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(226277..226354,226415..227205,
FT                   227354..227482,227536..227887))
FT                   /locus_tag="ANIA_05032"
FT                   /old_locus_tag="AN5032.4"
FT                   /note="transcript_id=CADANIAT00005360"
FT   CDS_pept        complement(join(226277..226354,226415..227205,
FT                   227354..227482,227536..227887))
FT                   /locus_tag="ANIA_05032"
FT                   /old_locus_tag="AN5032.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005360"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005360"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005360"
FT                   /db_xref="GOA:Q5B348"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B348"
FT                   /protein_id="CBF76241.1"
FT                   /translation="MSAPEKGKEDSVADDNVTSHHDEDAAVFDEKPVFRPEADYSGAQE
FT                   KTDPVEISLVRKLDMWIMPTLWLMFWLNYLDRNAIALARLNDLEEDLNLSSSEYQTCVS
FT                   ILFVGYILGQIPSNMILTRVRPSWYMAGFMALWAAVSALTALAKDFKGLLLTRFFLGAL
FT                   YMLSIFYNRKEIATRISILYTGNILATAFAGLIAAGVFHGMDNVRGVKGWQWLFILQGT
FT                   VTFVVAVLSVFTLPDDQRHTRWLSPDQRKLAYERIVADTVGARQQSSTMRGLKEAASDP
FT                   RLWLFAFMQHMHLAANGFKNFFPTAVETLGFNTTVTLVLTCPPYLIAGAGSVFWSWNSG
FT                   RMNERTWHITIAKSLAIIGFILGCATLNTAARYTAMIIFAIGTYAVNSIILGWVSSTCG
FT                   QTNEKKASSLAIVNTIANISFIWTPPLKLVPMAILRWAPVYDCHVIERSV"
FT   gene            229311..230595
FT                   /locus_tag="ANIA_05031"
FT                   /old_locus_tag="AN5031.4"
FT                   /product="conserved hypothetical protein: similar to
FT                   cytplasmic malate dehydrogenase (Eurofung)"
FT   mRNA            join(229311..229379,229443..229641,229818..230168,
FT                   230243..230595)
FT                   /locus_tag="ANIA_05031"
FT                   /old_locus_tag="AN5031.4"
FT                   /note="transcript_id=CADANIAT00005361"
FT   CDS_pept        join(229311..229379,229443..229641,229818..230168,
FT                   230243..230595)
FT                   /locus_tag="ANIA_05031"
FT                   /old_locus_tag="AN5031.4"
FT                   /product="conserved hypothetical protein: similar to
FT                   cytplasmic malate dehydrogenase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005361"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005361"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005361"
FT                   /db_xref="GOA:Q5B349"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B349"
FT                   /protein_id="CBF76243.1"
FT                   /translation="MVKIALLGAAGQIGTPLSLLCKASDLFAEISLYDIVHVPGIATDL
FT                   MHIDTRARVTGHLPDDSGLKKALTGADIVVVTAGIARKPGMTRDAQTNASIIRDIFAEI
FT                   AATCPNAVSCVVTNPVNSTLPVAAETLKKAGVFEPTRLFGITTLDVVRASTFAAHALDS
FT                   NSDPKAFKVPVIGGHSGATILPLYSQAEPPVNLDKETLAAVIHRVQFGGDEIVKSKQGA
FT                   GSATTCMAYAGFRFVKAIVAAMNGESVTEEAYVYLPGIAGGQEIAQELGVDYFALKVTL
FT                   GRTGANQVLPIGEISENESTLLKVAINDLKANIVTGVSFMAA"
FT   gene            complement(231220..232431)
FT                   /locus_tag="ANIA_05030"
FT                   /old_locus_tag="AN5030.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(231220..231953,232041..232116,
FT                   232243..232431))
FT                   /locus_tag="ANIA_05030"
FT                   /old_locus_tag="AN5030.4"
FT                   /note="transcript_id=CADANIAT00005362"
FT   CDS_pept        complement(join(231220..231953,232041..232116,
FT                   232243..232431))
FT                   /locus_tag="ANIA_05030"
FT                   /old_locus_tag="AN5030.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005362"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005362"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005362"
FT                   /db_xref="GOA:Q5B350"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B350"
FT                   /protein_id="CBF76245.1"
FT                   /translation="MQSTKPFVLFFNPVKFARPFYEQLQKVAHTEVVTSRNRTEFFQDL
FT                   QDKYRNIFAIYRTSSSGAVAGKFDTEFINRLPPSCKYICHNGADACAKRGIVVTNAPDP
FT                   VTDATADLAVFLLLGALRQLNPAMNSLRAGRFKTGVAVGNDPQGKVLGILGMGRIGRAI
FT                   KKRCDPFGLKTVYHNRTVLAPEQAAGAEYVSFDKLLAESDIISVNVPLTGQTKQLIGAA
FT                   ELAKMKRGVIIVNTARGAILDEAALADALESGHVGAAGLDVYEREPEVNEKLLKQERAL
FT                   MVPHVGTHTAETLAKMETWAMENARRAITGEALLSPVPEHQGLALQARSRV"
FT   gene            233003..234670
FT                   /locus_tag="ANIA_05029"
FT                   /old_locus_tag="AN5029.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(233003..233204,233262..234670)
FT                   /locus_tag="ANIA_05029"
FT                   /old_locus_tag="AN5029.4"
FT                   /note="transcript_id=CADANIAT00005363"
FT   CDS_pept        join(233003..233204,233262..234670)
FT                   /locus_tag="ANIA_05029"
FT                   /old_locus_tag="AN5029.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005363"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005363"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005363"
FT                   /db_xref="GOA:Q5B351"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B351"
FT                   /protein_id="CBF76247.1"
FT                   /translation="MTFMGLVGSSLATARICMILIPAFLLFGYNQSNLGGVLDYPSFTR
FT                   NFPSIDTSNTKGAVKDHNATVQALSTFSYLPTASSLGTIVAVYTLGCLVGSLGVTQLGN
FT                   RIGRRKSLIVSAVVATVGLVIQASSYSLGQLVVGRLVSGAGNGGVNAIVPVWQSECTQP
FT                   KSRGKNVVIVGVFIASGIAAAGWVNVGLSYLEESEVAWRLPLAIPILFTLPLMTLTMTF
FT                   PESPRWLISNGRREEAHAAIWALTGREESTAEMQELERVLQQTPTQERGFMDLLIPGPQ
FT                   RLFYRLCLAVGINFCAQMTGANVISYYGKTIFRDSLGLSGDKASLLNAGVLTWKIFAAI
FT                   SAYLSVDRFGRKPLFITACLGMGLSMAGLAGTVWAIENRPGSTLGASVAATFFLFLFMT
FT                   FFPLGFLGANFLLGSEIAPQDLRVHLAAVGTAAHWLFNFVIAEITPVAFTTIKYRYYIV
FT                   YAVIGVSASIMVYFFCPETKGRSLEEMDSLFSEPEAWWKVTACARINRHGDGNRNMNKE
FT                   LVLVGNEKHDVEQFETVAR"
FT   gene            complement(235511..239716)
FT                   /locus_tag="ANIA_05028"
FT                   /old_locus_tag="AN5028.4"
FT                   /product="Fatty acid oxygenasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q6IYE5]"
FT   mRNA            complement(join(235511..235845,235897..236176,
FT                   236234..236885,236934..237421,237470..237813,
FT                   237867..238194,238242..238332,238381..238521,
FT                   238576..238780,238832..239073,239127..239224,
FT                   239294..239716))
FT                   /locus_tag="ANIA_05028"
FT                   /old_locus_tag="AN5028.4"
FT                   /note="transcript_id=CADANIAT00005364"
FT   CDS_pept        complement(join(235784..235845,235897..236176,
FT                   236234..236885,236934..237421,237470..237813,
FT                   237867..238194,238242..238332,238381..238521,
FT                   238576..238780,238832..239073,239127..239224,
FT                   239294..239716))
FT                   /locus_tag="ANIA_05028"
FT                   /old_locus_tag="AN5028.4"
FT                   /product="Fatty acid oxygenasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q6IYE5]"
FT                   /note="transcript_id=CADANIAT00005364"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005364"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005364"
FT                   /db_xref="GOA:G5EAZ5"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019791"
FT                   /db_xref="InterPro:IPR034812"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="InterPro:IPR037120"
FT                   /db_xref="UniProtKB/TrEMBL:G5EAZ5"
FT                   /protein_id="CBF76249.1"
FT                   /translation="MLRRFSTFRKSKGDKTEKADRDSKANGSNANSAAAASNSSKRQSK
FT                   VPPPRRPSSDSGSSAESEDVPAVFEKYAQVLHASSRPIPHQGGEAAYLEKEHPSGLFND
FT                   LKSLGFKDFASLKDVIKTKINGELTDDKTMIMERIIQIVSSLPSNSKMRVDLTNMFLDE
FT                   LWGSLPHPPLSYMGNDYQYRSADGSNNNPTLPWLGAANTAYARSIEPLTVQPGGLPDAG
FT                   LVFDTLFARQKFTPHPNKVSSLFFDWASLIIHDIFQTDYRDYNKNKTSAYLDLAILYGD
FT                   VQEEQDLVRTHKDGKLKPDSFSEPRLQAFPAACCVLLVMLNRFHNYVVEELAAINENGR
FT                   FTKPSPDLPEEQAKKAWAKYDEDLFQTGRLITCGLFINITLYDYLRTIVNLNRVNSTWC
FT                   LDPRAQMEGSATPAGLGNQCSVEFNLAYRWHSAISANDEKWTEKVYEELIGKPGSEIST
FT                   QELLMGLGKYGASLPKDPSQRTFAGLKRQEDGTFKDEELVNILTSAIEDVAGSFGARNV
FT                   PKVLKAVEVLGIEQGRKWNVGSLNEFRKFFGLKNYETFEEINSDPEVAESLRALYGHPD
FT                   YVELYPGIVSEEAKEPMIPGVGIAPTYTISRAVLSDAVALVRGDRHYTVDYNPRNLTNW
FT                   GYNEVRYDLNINQGCVFYKLATRAFPNWFKPDSIYAHYPMTIPSENKVIMKNLGREADY
FT                   SWDRPQYQAPRASLTSYSNVKLILDQQKDFRVVWGDCTPLHSGKGGEDFWSKTLSDPQF
FT                   KKSIKEFYEKTTLELFADKSVNLAGRKQIDIVKDVGNIVPARFASKLLSLPLRSKENSK
FT                   GVFTDHEIFMALAVIYNAIFFDVDTTKSFPLRKAADAVSKELGKHVESHVKSVSSPGFL
FT                   SRVIDNFRDDHNALKDLGDQLIKRLAEGGLSVSDITYGQILPTAVELVHGQAQMFTRVV
FT                   EYYLNEGKQHLPELSLLAKQDSAETDAKLTRYALEAIRLNAGSGAYRKAETNFYFKEGD
FT                   ADINLKPGDEIFISSTQANRDPTAFPDPDEVRLDRPDESYLNYGIGSQIGLGKDATLTA
FT                   VTAMVRAAFSLEGLRPAPGVQGVLKKVVRPEGYTLYMREDHGAFSPFPTTFRVHFDGEV
FT                   VTPKKQIDSA"
FT   gene            243131..245207
FT                   /locus_tag="ANIA_05027"
FT                   /old_locus_tag="AN5027.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(243131..243370,243429..245207)
FT                   /locus_tag="ANIA_05027"
FT                   /old_locus_tag="AN5027.4"
FT                   /note="transcript_id=CADANIAT00005365"
FT   CDS_pept        join(243251..243370,243429..245207)
FT                   /locus_tag="ANIA_05027"
FT                   /old_locus_tag="AN5027.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005365"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005365"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005365"
FT                   /db_xref="GOA:C8V858"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="UniProtKB/TrEMBL:C8V858"
FT                   /protein_id="CBF76251.1"
FT                   /translation="MEAVPVGPARPVKQFVLCFDGTGNKFAGDESDSNVLKIFRMLDRS
FT                   QPHQFHYYQPGIGTYVTTNTLSHTSRFQRIKSAYQKAKDSAIGSSFDEHVMGGYKFLMR
FT                   FYNPGDEIYFIGFSRGAYIARFLAEMLDYIGLLEAGNEELTRFAWKTFAKWQQRGGDSE
FT                   EDRAEKQKLFRYMKAFRETFSRPITRIKFMGLFDTVNSVPRFESAWMQRSKFPYTARSS
FT                   ARVIRHAVGIDERRAKFRQDLISEVKPKKRTHHRHRHLREHLHRTFSRESKSDKQHDNV
FT                   PEIVLNDDQDANGKVNGISDTGSVYRGAHASHESLHPENRYRALSPSPNRRKPSLAVPA
FT                   ANGSTDDLNSVRSGISCHSAISLQVPLEGRVAEDEDDQEQDIQEVWFPGGHADIGGGWT
FT                   LGKGESWALSHAPLVWMVQAARDAGLEFDPAKMKQFECLEEFEGEYSPIRQDIKWQKSW
FT                   CEDPAHDHDHKEGEGSTHTAANMDWTQPSSSSQRFRAALYASSTEGLLHDCLSFNSGLS
FT                   PLSVLTWRLMEYLPFRRMDLQEDGSWEPIRWPLPCGEVRDIPNDAQIHVSAIRRMKKDP
FT                   NYRPGNLILGGGGRGVRRAPEEYGIGEWVVKAHEGDPVREIYVRKRVAKMCKDDHN"
FT   gene            246378..247397
FT                   /locus_tag="ANIA_05026"
FT                   /old_locus_tag="AN5026.4"
FT                   /product="hypothetical protein"
FT   mRNA            246378..247397
FT                   /locus_tag="ANIA_05026"
FT                   /old_locus_tag="AN5026.4"
FT                   /note="transcript_id=CADANIAT00005366"
FT   CDS_pept        246378..247397
FT                   /locus_tag="ANIA_05026"
FT                   /old_locus_tag="AN5026.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005366"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005366"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005366"
FT                   /db_xref="GOA:Q5B354"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B354"
FT                   /protein_id="CBF76253.1"
FT                   /translation="MEASRTRPGGLMLPSPVDSVESLASSSSNTSSRSSLSDSPGDVNN
FT                   GEPEPERSGNVMITLSLTPDPPRSTPSRQPFPRSHIRSRSLADDPGSPAMIRAHSSPGL
FT                   DSRGRYIFVNGRGSPANMAENTPKRYLPLQLSYADSFEPRMLHRKNISETISEHAELDT
FT                   SGSSSAANTDFYLSSPVLSHSTPRIGRRRPSSPLHVPQTPSIQVAGSPLSSASSSPVIL
FT                   SSRFNESFPSYSVSSASSMPSTPTSLRSRSPSISSLETIPDIPDAEAAAIEADRIAALK
FT                   AAADRADDADANSVSRRRGISDMSGPSSFANTRSGRKRWSVCGAERRQDLDLETIWED"
FT   gene            complement(247779..250357)
FT                   /locus_tag="ANIA_05025"
FT                   /old_locus_tag="AN5025.4"
FT                   /product="flavin containing amine oxidase, putative
FT                   (AFU_orthologue; AFUA_3G12150)"
FT   mRNA            complement(join(247779..247996,248186..248197,
FT                   248330..248364,248472..249627,249692..250080,
FT                   250136..250173,250232..250357))
FT                   /locus_tag="ANIA_05025"
FT                   /old_locus_tag="AN5025.4"
FT                   /note="transcript_id=CADANIAT00005367"
FT   CDS_pept        complement(join(247779..247996,248186..248197,
FT                   248330..248364,248472..249627,249692..250080,
FT                   250136..250173,250232..250357))
FT                   /locus_tag="ANIA_05025"
FT                   /old_locus_tag="AN5025.4"
FT                   /product="flavin containing amine oxidase, putative
FT                   (AFU_orthologue; AFUA_3G12150)"
FT                   /note="transcript_id=CADANIAT00005367"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005367"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005367"
FT                   /db_xref="GOA:Q5B355"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B355"
FT                   /protein_id="CBF76255.1"
FT                   /translation="MSRRPNVAIIGAGFAGLRCADILIQNGAQVTIFEARDRVGGRVHQ
FT                   CKVGGHLVDMGPNWIHGAGANPVLDIARATRTTLHDFEGSQLVFGSNGKALDERVAMKI
FT                   SEILWTTIDEAFTYSNNHEADIPAEKSLLDFIRERLQETNLTEDEKRLCIDTARLWGCY
FT                   IGDPIERQSLKFFSLEESIDGSNYFVASTYKDILAQVSSTALQHADIRLNQPIVNIHSK
FT                   PIIQGTSTRREITITTQTGERHAFDEVVVTCPLGWLKRNKEAFTPELPPRLSSAIDAIS
FT                   YGRLEKVYITFPEAFWHTKSTGNTVTLPTVSASAANGTNTKLSFAQFLTPLYYTDHPEE
FT                   VPWDQECFSLAALPKDTAHPTLLFYTYGPCATYIVNKLTSLSSTTTEVTNSHSHAPSSK
FT                   QYTFLNTLFAPFYSLLPNYIPNTKACTPTSILATTWQADPNAGHGSYSNFQVGLVDGNK
FT                   DIETLRAGMGLDRGVWFAGEHTAPFVALGTTTGALWSGERAAGQICALYRLGRVGMGVE
FT                   RDDSLPSGNGNGSMGVFSEGANGKGGSGFRVGGGSATGVRNGGEGGERDALFSQLDTRQ
FT                   YTWVAGQCKAVHERKNKQASGSNPVKQNMGNPDKQTKARSQPNPDRTQPRSKQEGQTRN
FT                   EADEDRSREALWGILIECNEDE"
FT   gene            complement(251309..252968)
FT                   /locus_tag="ANIA_05024"
FT                   /old_locus_tag="AN5024.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(251309..251368,251648..251666,
FT                   251812..252063,252116..252221,252496..252632,
FT                   252680..252813,252867..252968))
FT                   /locus_tag="ANIA_05024"
FT                   /old_locus_tag="AN5024.4"
FT                   /note="transcript_id=CADANIAT00005368"
FT   CDS_pept        complement(join(251309..251368,251648..251666,
FT                   251812..252063,252116..252221,252496..252632,
FT                   252680..252813,252867..252968))
FT                   /locus_tag="ANIA_05024"
FT                   /old_locus_tag="AN5024.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005368"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005368"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005368"
FT                   /db_xref="GOA:Q5B356"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B356"
FT                   /protein_id="CBF76257.1"
FT                   /translation="METPASSISDTQSPSKKDSPMSRTESVDIEEVALKPGSAEHPSKS
FT                   DETELSAAIEQAVNHRRLNPRQIQLTAMAGSIGAALFVGIESGVMSGPLCLFLASIFGP
FT                   LLSSLSHSAVCGYASTLRLTICFMRLEISRLTITTFATSLPRNQRIPSRSFWRSRVFAL
FT                   GKILLAAGLIIYRIGVMLGVNPMNECVRSPVAEANPNTLCSRFGFRYWKEPGLWAGAKP
FT                   SGMLMSFVDAANVAAFCMGGPDGCLCIGIALASVTGIEWKVLKHAVP"
FT   gene            254015..254972
FT                   /locus_tag="ANIA_05023"
FT                   /old_locus_tag="AN5023.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(254015..254128,254161..254215,254359..254469,
FT                   254547..254624,254848..254972)
FT                   /locus_tag="ANIA_05023"
FT                   /old_locus_tag="AN5023.4"
FT                   /note="transcript_id=CADANIAT00005369"
FT   CDS_pept        join(254015..254128,254161..254215,254359..254469,
FT                   254547..254624,254848..254972)
FT                   /locus_tag="ANIA_05023"
FT                   /old_locus_tag="AN5023.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005369"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005369"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005369"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B357"
FT                   /protein_id="CBF76259.1"
FT                   /translation="MNSPPTPEKLVHQKSGYMLASTTALSLVPGAKSQPLHRFLKESDR
FT                   HVPRTKSPIKPGYGRDPRKPPLDADRMPKFEECTYAEMEPGSALFTMGSTYHGAGENKC
FT                   EVTALWLSPLSLPSSDKAVGGVGYVEDHQIPHEFLHRDYFGAGKFGAASLAAKRIA"
FT   gene            256238..257054
FT                   /locus_tag="ANIA_05022"
FT                   /old_locus_tag="AN5022.4"
FT                   /product="homolog of p25 of dynactin (Eurofung)"
FT   mRNA            join(256238..256276,256485..257054)
FT                   /locus_tag="ANIA_05022"
FT                   /old_locus_tag="AN5022.4"
FT                   /note="transcript_id=CADANIAT00005370"
FT   CDS_pept        join(256238..256276,256485..257054)
FT                   /locus_tag="ANIA_05022"
FT                   /old_locus_tag="AN5022.4"
FT                   /product="homolog of p25 of dynactin (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005370"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005370"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005370"
FT                   /db_xref="GOA:Q5B358"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B358"
FT                   /protein_id="CBF76261.1"
FT                   /translation="MPPKAPKGEYIETETGNKVSRRSQIHGTHHISLGGKSIIMADAVV
FT                   RGDLFRSSSSQSQSQSQSQSQSGSGAGNNNIAISIGRYTFISRSAILRPPSRLSRGVHT
FT                   YTTLHIGSHVFVGERSIVEAAKVEDNVTIGKDCVIGSMAILKERCQVLDGCVVPGGMVV
FT                   PSHCVVGGQPARIVGDTPIAYGVEGLEGGLSRERYRSIR"
FT   gene            complement(257120..259628)
FT                   /locus_tag="ANIA_05021"
FT                   /old_locus_tag="AN5021.4"
FT                   /product="trehalose synthase (Ccg-9), putative
FT                   (AFU_orthologue; AFUA_3G12100)"
FT   mRNA            complement(join(257120..257930,257978..258552,
FT                   258599..258874,258923..259335,259386..259504,
FT                   259577..259628))
FT                   /locus_tag="ANIA_05021"
FT                   /old_locus_tag="AN5021.4"
FT                   /note="transcript_id=CADANIAT00005371"
FT   CDS_pept        complement(join(257215..257930,257978..258552,
FT                   258599..258874,258923..259335,259386..259504,
FT                   259577..259595))
FT                   /locus_tag="ANIA_05021"
FT                   /old_locus_tag="AN5021.4"
FT                   /product="trehalose synthase (Ccg-9), putative
FT                   (AFU_orthologue; AFUA_3G12100)"
FT                   /note="transcript_id=CADANIAT00005371"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005371"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005371"
FT                   /db_xref="GOA:C8V864"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C8V864"
FT                   /protein_id="CBF76263.1"
FT                   /translation="MLPRLRDNLFDMLGGGSPSPRRASLQQKRRLSTEHSPNSWGAATT
FT                   GNLYGGLSTVFEKDKVIFAVAIRDATYLVDFAQEELPFSESDDLDLKIGDHMMRHLYKW
FT                   CDTHLEKMIGLAIPKQLAHTCPTICSRLWLELDIIPLVLSDNSKLDFRGEDLQYGFQQS
FT                   ADWELRTLDEQAESMARKCVRLFGPEGTPLLQVGLSGLVQVDTAFHVQLTNKDNYKNSV
FT                   TANTWKAIEHYADDLRNRKVKLAFFSATPQGGGVALMRHAMVRFAHSIGTDMKWYVPKP
FT                   RPGVFRITKTNHNILQGVSAPEERLTDENWEQVTNWIQENADRYWLRPGGPLEHPSKGG
FT                   ADVIVIDDPQMPALIPLAKQKAPERPVVFRSHIQIRSDLVDQDGSPQAECWGTMWKDIQ
FT                   KADIFVSHPVKSFVPKIVPREKVGYMPASTDWLDGLNKNMRNEDIAYYGRIFNSWVRNS
FT                   GMPVIDYPADEYIVQIARFDPSKGIPHVIESYEKFHQRMQDYCPDKPIPKLLICGHGSV
FT                   DDPDGSIIYDLAVRYIEDSIPDLADQICVVRLGPSDQVLNALMSKAKVALQLSTREGFE
FT                   VKVSEAIHKGRPVIATRAGGIPLQVIDKGNGFLVDVGDTDAVAKHLFDLCTDDVLWKKM
FT                   HEFALAHVCDEVSTVGNSLNWLYLASKLSKGGVIKPNERWLNDMAREDAGIPYQEGEDR
FT                   LKRELEVQKMG"
FT   gene            260102..261288
FT                   /locus_tag="ANIA_05020"
FT                   /old_locus_tag="AN5020.4"
FT                   /product="ADP ribosylation factor (Eurofung)"
FT   mRNA            join(260102..260249,260355..260612,260671..260829,
FT                   260882..261028,261080..261192,261244..261288)
FT                   /locus_tag="ANIA_05020"
FT                   /old_locus_tag="AN5020.4"
FT                   /note="transcript_id=CADANIAT00005372"
FT   CDS_pept        join(260519..260612,260671..260829,260882..261028,
FT                   261080..261192,261244..261288)
FT                   /locus_tag="ANIA_05020"
FT                   /old_locus_tag="AN5020.4"
FT                   /product="ADP ribosylation factor (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005372"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005372"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005372"
FT                   /db_xref="GOA:Q5B360"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041838"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B360"
FT                   /protein_id="CBF76265.1"
FT                   /translation="MGGSVSKIMGKIFGTKEMRILMLGLDAAGKTTILYKLKLTNQDVT
FT                   TIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVVDSSDTARMDEA
FT                   RSELHKIINDREMKDALLLVFANKQDVPGHLSPDEVISALKLHSLKDKTWYVAPSVATE
FT                   GTGIFEGLAWLSNNVKVQQPQK"
FT   gene            262442..263935
FT                   /locus_tag="ANIA_05019"
FT                   /old_locus_tag="AN5019.4"
FT                   /product="Methionine synthase, vitamin-B12 independent,
FT                   putative (AFU_orthologue; AFUA_3G12060)"
FT   mRNA            join(262442..262530,262578..262816,262899..263315,
FT                   263364..263935)
FT                   /locus_tag="ANIA_05019"
FT                   /old_locus_tag="AN5019.4"
FT                   /note="transcript_id=CADANIAT00005373"
FT   CDS_pept        join(262442..262530,262578..262816,262899..263315,
FT                   263364..263935)
FT                   /locus_tag="ANIA_05019"
FT                   /old_locus_tag="AN5019.4"
FT                   /product="Methionine synthase, vitamin-B12 independent,
FT                   putative (AFU_orthologue; AFUA_3G12060)"
FT                   /note="transcript_id=CADANIAT00005373"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005373"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005373"
FT                   /db_xref="GOA:Q5B361"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B361"
FT                   /protein_id="CBF76267.1"
FT                   /translation="MARLILAPHSFSLVSFRNTLLSLLTSTFTWIIVSQNFTMSLHRCP
FT                   PFRVEHLGSLLRTKELLDVKTAYENGKATKEQLEAVEKKDIKDVVELQKKLRYSALSDG
FT                   EYCRHMFWGSFFPGLEGFDEVSDPSPEVFRPYAPDVAAFLEAGHKPGESVFCTGKIKHV
FT                   GSTYVDQFKFLASLVAPEEVKNLKLTLAAPNWYHLRYREGYAYPKEVYANVDEYFADIA
FT                   KAYQDELKILYDAGCRNVQFDDPNLVYFCSEKMLQGWKEDPLNTLSADETFEKYIKLYN
FT                   DCLATRPKDFHVGVHLCRGNFVGSRHFSEGGYDRIATKLFKELNVDTYYLEYDTPRAGG
FT                   FEPLKEVPRHKSVIFGVVTSKFPQLEDKEEMKKRVYDAAKFIAEGNGITLEQALDQVGV
FT                   SPQCGFASHREGNAIDREGMIKKLELVRAIADDIWPGQL"
FT   gene            266781..268304
FT                   /locus_tag="ANIA_05018"
FT                   /old_locus_tag="AN5018.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(266781..266811,267199..267323,267420..268304)
FT                   /locus_tag="ANIA_05018"
FT                   /old_locus_tag="AN5018.4"
FT                   /note="transcript_id=CADANIAT00005374"
FT   CDS_pept        join(266781..266811,267199..267323,267420..268304)
FT                   /locus_tag="ANIA_05018"
FT                   /old_locus_tag="AN5018.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005374"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005374"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005374"
FT                   /db_xref="GOA:Q5B362"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B362"
FT                   /protein_id="CBF76269.1"
FT                   /translation="MVETERIILSYFQPHPVPPFPANGSYTANLESSECAFAPSDCVNV
FT                   SGYSSSLTIRLTLNNGSLLANNVSIFPPSLPTRFQVERHWAVDSKPGSGSEIVTVAYKT
FT                   DVQSIPPSQRLNTLPERGRSTFYRLKLSLFDLQGRPATKRPVSVGLVRTQARPGNESGI
FT                   GVETGSESGTLQVVQIEETVHRVYHHHLHTSQNRNPDGTWSWWRMKSWKSYFISNNREA
FT                   SESSGQAETATSRLPHLDTTSGMTGKSKGPAHWIGNRHSWHLSKLVLVPGFLELAIAVL
FT                   CSVTGYLMGIAIVAVYEYFCESDTACSKGPDPERPPGDDVIFDSDTEKRRLSIISSDSS
FT                   ESEAYI"
FT   gene            269325..270641
FT                   /locus_tag="ANIA_05017"
FT                   /old_locus_tag="AN5017.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(269325..269689,269746..270641)
FT                   /locus_tag="ANIA_05017"
FT                   /old_locus_tag="AN5017.4"
FT                   /note="transcript_id=CADANIAT00005375"
FT   CDS_pept        join(269395..269689,269746..270443)
FT                   /locus_tag="ANIA_05017"
FT                   /old_locus_tag="AN5017.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005375"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005375"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005375"
FT                   /db_xref="GOA:Q5B363"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B363"
FT                   /protein_id="CBF76271.1"
FT                   /translation="MLSRRFGVSLLQSSVPKLARSSCRAQYNRVGFIKPPTPVVWAART
FT                   MAGPANLKEKLPEKDGNQRFREFMLEGKVFAVTGGARGLGLTMAEALVEAGGEVYCLDR
FT                   LPEPDDEFYAAQKRANPDFGGALHYRRMDVTDDANTEAILDDIASKKDRLDGLIAAAGV
FT                   NHVKDAFDLTPEMVDKLIHINYTGVFRSAVAAARAMTARKCPGSILLVASMSGLIANKG
FT                   MASAIYNSSKAAVVQLSRSLAMEWSESRKDGTGGIRVNALCPGHIETSMAQMVMEKDPE
FT                   TRVIWESENMMKRLARPEEFRGITLLLMSDASSFMTGSTVVVDGGHTAW"
FT   gene            271561..273316
FT                   /locus_tag="ANIA_05016"
FT                   /old_locus_tag="AN5016.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(271561..271836,271881..272282,272345..273316)
FT                   /locus_tag="ANIA_05016"
FT                   /old_locus_tag="AN5016.4"
FT                   /note="transcript_id=CADANIAT00005376"
FT   CDS_pept        join(271561..271836,271881..272282,272345..273316)
FT                   /locus_tag="ANIA_05016"
FT                   /old_locus_tag="AN5016.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005376"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005376"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005376"
FT                   /db_xref="GOA:Q5B364"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B364"
FT                   /protein_id="CBF76273.1"
FT                   /translation="MWTFIAGLLTLSLGISATSFPRDNAGAPTARVKNGTYEGVYSPEY
FT                   DQDFFLGVPFAQPPVNDLRFRLPQSLNATWEGTREAKDYSLLCVGYGLDQTFYNQSEDC
FT                   LYLNIVRPAGYDQEKLPVGFWIHGGGFSNGGGGDQRYNLSFIVKQSVKIGKPIIGVSIN
FT                   YRLNLWGFLHSNEVVGEGITNLGLRDQRLALYWVQENIATFGGDPGKVTIFGESAGAAS
FT                   VGFHVATTSSSAPQYYSLVIPYSTEPKMERSARKPPSRRSYPRLDAPRPGTGSNVSREV
FT                   SFLTLNATYDSINGSFAPTIDGDFIRTYGSKQLLDGQFVRVPIITGTNSDEGASMSPTG
FT                   INTTEDFKATLSSFLPVSFQDAILKAYPDDLSVNVIASLGDQRPVAPYGAQFRRSASFW
FT                   GDYYFIASRRQTAKTWAAHGIPAYAYRFNAIPAGVPPEVGVGHYKEIGFMFNNLEGVGY
FT                   RPDIKPFEGKGQNYIDLADLMSSTWASFIHDLDLNNYTGRDTNIPDWPRYDVLEPRDFV
FT                   FDANVTSYTEDDTYRAEGIALINDHAAGVLHR"
FT   gene            complement(273410..274002)
FT                   /locus_tag="ANIA_05015"
FT                   /old_locus_tag="AN5015.4"
FT                   /product="conidiation-specific protein 10 (Eurofung)"
FT   mRNA            complement(join(273410..273726,273807..274002))
FT                   /locus_tag="ANIA_05015"
FT                   /old_locus_tag="AN5015.4"
FT                   /note="transcript_id=CADANIAT00005377"
FT   CDS_pept        complement(join(273604..273726,273807..273932))
FT                   /locus_tag="ANIA_05015"
FT                   /old_locus_tag="AN5015.4"
FT                   /product="conidiation-specific protein 10 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005377"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005377"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005377"
FT                   /db_xref="GOA:Q5B365"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B365"
FT                   /protein_id="CBF76275.1"
FT                   /translation="MADNQNPGNFANRPHEEVENIARKGGQSSHSGGFASMDSEKQRNI
FT                   ASQGGHASSGSFQPGDERAREAGRKGGKATGHHEPEE"
FT   gene            276710..277716
FT                   /locus_tag="ANIA_05014"
FT                   /old_locus_tag="AN5014.4"
FT                   /product="60S ribosomal protein L22, putative
FT                   (AFU_orthologue; AFUA_3G12300)"
FT   mRNA            join(276710..276790,276986..277221,277288..277716)
FT                   /locus_tag="ANIA_05014"
FT                   /old_locus_tag="AN5014.4"
FT                   /note="transcript_id=CADANIAT00005378"
FT   CDS_pept        join(276779..276790,276986..277221,277288..277414)
FT                   /locus_tag="ANIA_05014"
FT                   /old_locus_tag="AN5014.4"
FT                   /product="60S ribosomal protein L22, putative
FT                   (AFU_orthologue; AFUA_3G12300)"
FT                   /note="transcript_id=CADANIAT00005378"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005378"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005378"
FT                   /db_xref="GOA:C8V8L0"
FT                   /db_xref="InterPro:IPR002671"
FT                   /db_xref="InterPro:IPR038526"
FT                   /db_xref="UniProtKB/TrEMBL:C8V8L0"
FT                   /protein_id="CBF76277.1"
FT                   /translation="MAPAVARGRKAQKVTQKFIINASQPANDKIFDVSAFEKFLHDRIK
FT                   VEGRVGNLGDKVVISQVGDGKVEVVAHIPFSGRYLKYLTKKYLKKQQLRDWLRVVSTSK
FT                   GVYELRFYNVASEEADEDEE"
FT   gene            complement(277804..279953)
FT                   /locus_tag="ANIA_05013"
FT                   /old_locus_tag="AN5013.4"
FT                   /product="RNA exonuclease 3 (EC 3.1.-.-)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B367]"
FT   mRNA            complement(277804..279953)
FT                   /locus_tag="ANIA_05013"
FT                   /old_locus_tag="AN5013.4"
FT                   /note="transcript_id=CADANIAT00005379"
FT   CDS_pept        complement(277804..279720)
FT                   /locus_tag="ANIA_05013"
FT                   /old_locus_tag="AN5013.4"
FT                   /product="RNA exonuclease 3 (EC 3.1.-.-)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B367]"
FT                   /note="transcript_id=CADANIAT00005379"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005379"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005379"
FT                   /db_xref="GOA:Q5B367"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR034922"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B367"
FT                   /protein_id="CBF76279.1"
FT                   /translation="MFAPLGLFRDIPCPQREECSLIACLFSHRDLNSAPAAQDQVLEQK
FT                   EPAKLPPKRLKLEPRPEAKETPKDDLRHVSDSGRSTPVKKTTAPATNAENISPVSRQPN
FT                   IPKNTATAPIKRELNANTGSSIPPRRAPKEALNPRMIQKSPATYNVRMAILKKLHGTLC
FT                   SLNDQLAKDKALEDKCLILTPDELITMALDEEEKVAKESPTVYSNVVKLRIVKLSRMSK
FT                   EDWAKELKDYLNKKYYKIKAEPVQKEPKPFKTDLSVEEEIAVASQLITPLQGLEDFGYV
FT                   TRVPTAEEIEIAKRGVAEAKGWEKCERCNARFQVFPGRREDGTLTSGGTCTYHPGKSFY
FT                   PPRKKTDHITGTMREGYFTCCNQKLGESSGCTTGATHVYKVSETKRLASILQFEKTPEN
FT                   PDLHNPTPICFDCEMGYTTLGMELIRLTAVSWPEGKKVLDVLVRPLGEVLDLNSRFSGV
FT                   FPEHYTNALPYSTAPTKSSAPSSSSPSQLQLVSSPAAARTLLFNLLTPSTPLIGHAIDN
FT                   DLNACRIIHPTVIDTAILYPHPGGGLPYRMSLRTLAKKHLDREIQTGGASGKQGHDSVE
FT                   DALATGDLVRVKAGLVWGRLKEKGWIVEEGRLVAPDSSSNTVSMQTKLGEGAGAKRARE
FT                   GTS"
FT   gene            complement(281068..286437)
FT                   /locus_tag="ANIA_05012"
FT                   /old_locus_tag="AN5012.4"
FT                   /product="exoinulinase InuD (AFU_orthologue; AFUA_5G00480)"
FT   mRNA            complement(join(281068..282522,282590..283046,
FT                   283212..283368,283427..283508,283574..283578,
FT                   283650..283708,283747..283984,284064..284153,
FT                   284465..284653,284700..285579,285631..285752,
FT                   286072..286148,286403..286437))
FT                   /locus_tag="ANIA_05012"
FT                   /old_locus_tag="AN5012.4"
FT                   /note="transcript_id=CADANIAT00005380"
FT   CDS_pept        complement(join(281302..282522,282590..283046,
FT                   283212..283368,283427..283508,283574..283578,
FT                   283650..283708,283747..283984,284064..284153,
FT                   284465..284653,284700..285579,285631..285752,
FT                   286072..286148,286403..286437))
FT                   /locus_tag="ANIA_05012"
FT                   /old_locus_tag="AN5012.4"
FT                   /product="exoinulinase InuD (AFU_orthologue; AFUA_5G00480)"
FT                   /note="transcript_id=CADANIAT00005380"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005380"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005380"
FT                   /db_xref="GOA:Q5B368"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B368"
FT                   /protein_id="CBF76281.1"
FT                   /translation="MVGGDHRSLIESIYNAPANLLSVVACSGSAVGQCLSPAKFDILVP
FT                   TSSRIASTKLPTSANTSPTLISSNCYGKTAAKQKMAARPQTAKKSKRDRKKAWKKDPWK
FT                   GKVADLSHPPYRKAKMEGKLPGPNPDEHVRPSVPTSNHVARAAQRMKYWPERQRLSPIQ
FT                   SPELDAPTLVNGKELGLPELNRDAKPALNPVDRIPPTRFPRVYVGDNAPTPRWLIRPVR
FT                   PVTNHESAHNSSSESGSAASGFSSASGSSRLLPLGRLRWEFDPGPAAKHGQDEARLHEY
FT                   AYRYLQNSLRDPIVREEMRNMIWNSPYALVVANVEDPLPIPPPPPHFKDQRPSDYAALR
FT                   EAISASNPDDYHFKYPDYARPSLAARTYGHQDTYKSRKSSVDSQSSAVSHGSSSTGESS
FT                   RTRASSSSSISIVHKELSPVYQHEFDDDTNHYLKRGQKVGFKAKIKTKEKNQTESFLSK
FT                   PPRRGRGRPTKSDIDFLDVPTLEELSSAEPPRKKRAGVEKPARDMWRPLSETFSEEEDI
FT                   ITPKAPKITSKNAAKAKMDGAILNKRTGGWLVSVYAEYESCLPCWQELISFPTLEDTKS
FT                   GQIPADYAKHDLGTYLVCAEVAKRQEQLALGWLSASVIHPHGFLPTRRPGYSEGVIPRE
FT                   YSALLLGSRGQTLRAVSDITKMRARTLLLRVSIFSAALALQPSAPGPAPYTEPYRPQYH
FT                   FTPAQNWINDPNGLLYHNGTYHMFYQYNPGGVAHEAMSWGHATSQDLTHWDERPVALTA
FT                   RGFPGKNISEQFFSGSAVYDVDNSSGYGNGMGTAAPMVAMYTSFYVYGQTLPSGKKVRA
FT                   SQQSQSLAYSLDSGETWTTDDAVNPILLQPPHPYESQYKEWRDPNVFWHAPTKKWILTT
FT                   ALSDLHKLLIYTSTDLKNWTLASEFGPYNAVGGVWECPSFFPLPVDNDESNVKWVAIIG
FT                   LNPGGPPGTVGSGNQYILGQFNGTHFLPDAESLHEQGEANWLDYGPDFYAALVYNGLPE
FT                   FQRTVIAWMSNWQYAEKVPTTVWRNAMTIPRRLGLKTINGKVLVVQEPEANWAAIMSKP
FT                   QTTRILSLPANSTRNLGSLGKTLAANLTFSAGEQNGSSFGISLLATQNFTTQTLIGYNF
FT                   ATKHIFVDRRASGNTSFDETFASVYRAPLEPADDGTVTLRIFADWSSVEVFGGQGETTL
FT                   TAQVFPPEGATHARLFANGAGVEDVLLSVSKVGSVWN"
FT   gene            complement(287442..290661)
FT                   /locus_tag="ANIA_05011"
FT                   /old_locus_tag="AN5011.4"
FT                   /product="integral plasma membrane protein, putative
FT                   (AFU_orthologue; AFUA_3G09740)"
FT   mRNA            complement(join(287442..287600,287655..289508,
FT                   289561..289645,289700..289738,289842..289968,
FT                   290023..290569,290623..290661))
FT                   /locus_tag="ANIA_05011"
FT                   /old_locus_tag="AN5011.4"
FT                   /note="transcript_id=CADANIAT00005381"
FT   CDS_pept        complement(join(287442..287600,287655..289508,
FT                   289561..289645,289700..289738,289842..289968,
FT                   290023..290569,290623..290661))
FT                   /locus_tag="ANIA_05011"
FT                   /old_locus_tag="AN5011.4"
FT                   /product="integral plasma membrane protein, putative
FT                   (AFU_orthologue; AFUA_3G09740)"
FT                   /note="transcript_id=CADANIAT00005381"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005381"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005381"
FT                   /db_xref="GOA:Q5B369"
FT                   /db_xref="InterPro:IPR019402"
FT                   /db_xref="InterPro:IPR027317"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B369"
FT                   /protein_id="CBF76283.1"
FT                   /translation="MAPKFKDGDAVATLNGKWVSWAHTAVAYTAFLSALFVGMSLHFNK
FT                   IVQNEHYGYPDEWFPSVSATIGDRYPERSFFQVFIAITSGPRFALVFLWYLVTARPNST
FT                   LPKFVAGVGIFRTFTCGGWTYVTSTDDHDWHDIFMISYLVATLPWTIGCLALSPNNRRA
FT                   VKYRKILASLFFGTLVPLIYYFIQHKVHKVPGAYTRYAFFEWSLILFDVGFDAVTALDF
FT                   EAFEIVVKDVKGISRGQLKNTADSVLEKEKGKPVGNTFGQGFFWSEVFDAAADVYNGFV
FT                   YWTNWTGLPVLVWYFPLWHMGISGYEVVILSYVAPVLLAIPALKSLAIKNPRIFHFLSL
FT                   SGFLAYKVQNPANRLFVSTFAVACSSITFAATLYGDRAQHTKLESRVFAWGLGLILSSI
FT                   AKFAGKTNNPFWPIMHAENGGWNKLGLLLAILAGIRSFRVPASSGGDYFPSTGKKGSSL
FT                   LAGLGLGSMIFLMHYLLSDSSTMIAWVWEGYPVRGPIAVPHGALTIFAMGAGLAFGLFY
FT                   PNVAGSWTAFGIGSVGAAFLTGTSHWSGFYGALTISFYLMAVSPVMISSAVRHSPAITF
FT                   GLAFFVYVFLLLFHVWVVAYAFVPGGPLVREHTDWLMTVAMLFIGAGVFSAAVSRSSGP
FT                   RTNAISPNGRRLRSYYVYVLVALQLLSVSIAYLRFPTNDYTPYHKEEKAVTAGIWTVHF
FT                   GLDNDMWASERRMRDVIQELEIDVLGLLESDNQRIIMGNRDITQFIAEDLGMYADFGPG
FT                   PNKHTWGSALLSKFPIVNSTHHLLPSPVGELAPAIHATLDMYGELVDVVVFHSGQEEDP
FT                   EDRRLQTEYLSKLMGSSPRPLILLSYLVTKPLEGNYNTYVSELSGMKDIDQTDWDRWCE
FT                   YILYKNLKRTGYARVSRDSITDTEIQVGKFVIGEPEPENEMMIPEEMVPQGLRFPAMFR
FT                   GQGVRGHRYHVFNEPRYWQ"
FT   gene            291051..292301
FT                   /locus_tag="ANIA_05010"
FT                   /old_locus_tag="AN5010.4"
FT                   /product="rRNA processing protein Utp6, putative
FT                   (AFU_orthologue; AFUA_3G09750)"
FT   mRNA            join(291051..291151,291209..292301)
FT                   /locus_tag="ANIA_05010"
FT                   /old_locus_tag="AN5010.4"
FT                   /note="transcript_id=CADANIAT00005382"
FT   CDS_pept        291507..292301
FT                   /locus_tag="ANIA_05010"
FT                   /old_locus_tag="AN5010.4"
FT                   /product="rRNA processing protein Utp6, putative
FT                   (AFU_orthologue; AFUA_3G09750)"
FT                   /note="transcript_id=CADANIAT00005382"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005382"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005382"
FT                   /db_xref="GOA:C8V8L4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C8V8L4"
FT                   /protein_id="CBF76285.1"
FT                   /translation="MDALRLHPTKADLWIYAAHYSVEDHADMSQARTYMQRGLRFCKTS
FT                   RKLWIQYAKLELIYITKLVARQRILGLDEKPEGPKQQVSEDDLNADMIMMPQITEEDIN
FT                   PKARDDTIDEAALKTLNSTPALTGAIPLAIFDSAIKTFDYNDCFAHEFFDMVFEFEDVP
FT                   CLQKILSHILDVMQESKPNSPHTLICYIKYPTAGVRVTSAEFPRALGAALSRLQEHRQK
FT                   PQVAKEVIDWLRPVEKTKDLDPSIQKVIAATIHKAELVLQEA"
FT   gene            294068..296995
FT                   /locus_tag="ANIA_05009"
FT                   /old_locus_tag="AN5009.4"
FT                   /product="RNA-binding protein (Nab3), putative
FT                   (AFU_orthologue; AFUA_3G09770)"
FT   mRNA            join(294068..295319,295375..295554,295612..296095,
FT                   296148..296277,296326..296368,296418..296995)
FT                   /locus_tag="ANIA_05009"
FT                   /old_locus_tag="AN5009.4"
FT                   /note="transcript_id=CADANIAT00005383"
FT   CDS_pept        join(294068..295319,295375..295554,295612..296095,
FT                   296148..296277,296326..296368,296418..296995)
FT                   /locus_tag="ANIA_05009"
FT                   /old_locus_tag="AN5009.4"
FT                   /product="RNA-binding protein (Nab3), putative
FT                   (AFU_orthologue; AFUA_3G09770)"
FT                   /note="transcript_id=CADANIAT00005383"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005383"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005383"
FT                   /db_xref="GOA:Q5B371"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034167"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B371"
FT                   /protein_id="CBF76287.1"
FT                   /translation="MTPDSPDEALHFRGKTLTPESPRPLHVPEPTSIPVLQNQMDPVFN
FT                   DTSTYGQAEDLPGNSYRTQSSEQYMRSSEAGWHTDSARRGQEHPPPQQQSHIQGSLQSG
FT                   PPLMNDGLADSDTTSPSTLATSAALPTSPNPVPSSEPSSVGKAMDSSLTAHAPSDPSSL
FT                   EAYPVPDAHPYPSHAARNNSFANEVDHSIGTLQAQTASQGRLDAEGKLEGNSAGNGVDF
FT                   QNLLDNLPSSSTSAPALTVSTTAMAADHASSQAAADEAHQSSLGLPPRPPPQEKPSIHP
FT                   NYNPTVDIRSYHQLPAHNASTSSNPYAAQPSNYQSNVGVPSLAAGAPGTSSTAGTLPPP
FT                   PVASFQQPSTSPAENQEPPAPATQKNGRVDRQPLRSDDDAPWGPEVQKKYDAFLHDERV
FT                   YVTEGLWDRFPYGSRLFVGNLPTERVTKRDLFHIFHSYGKLAQISIKQAYGFIQFLEAS
FT                   SCKRALEGEQGAIVRGRKVHLEISKPQRNTRPAPAPSEPSRVTSARRSRSPDYGRGGPS
FT                   SNRSSRVPGDRYDRPHEPARLPFSDFRDEPSHRRREDYRPPRSPSPRGYRREGYRSRDR
FT                   TPERFDRRDRRRSRSPYGRDRRYRSPSPRGRATYDSDVDIPVPRRAPRDVPDVQILVLE
FT                   ELDRNFIYHVESSFRNRGLRVDVLALGARIPLDAAVKRQASEGVLAVIFDRSAGVDNVR
FT                   SIEYPDLEPHMAAEIVVQAQTLQRTAPNVPLPSPAYGVPQLPSAPLHPAGPALPTQPNL
FT                   ANAISHLDGAGLQSLLAALQQRPAVPATQQPIPPVPNPVPTPDLASLLNAATRQPAPLS
FT                   APQPSVPQQSLTQTLPQQPLASQPFPLHGHGASPISDPNLLSLLAKGLGGHHPQGQPPM
FT                   APHQVQNLMSQLGKWKQ"
FT   gene            complement(297455..297894)
FT                   /locus_tag="ANIA_05008"
FT                   /old_locus_tag="AN5008.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(297455..297577,297670..297894))
FT                   /locus_tag="ANIA_05008"
FT                   /old_locus_tag="AN5008.4"
FT                   /note="transcript_id=CADANIAT00005384"
FT   CDS_pept        complement(join(297455..297577,297670..297894))
FT                   /locus_tag="ANIA_05008"
FT                   /old_locus_tag="AN5008.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005384"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005384"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005384"
FT                   /db_xref="GOA:Q5B372"
FT                   /db_xref="InterPro:IPR003213"
FT                   /db_xref="InterPro:IPR036549"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B372"
FT                   /protein_id="CBF76289.1"
FT                   /translation="MGWFPWSSSDSNKASDGGRIAPDRTSRQRCWIGRDQFFACLDDND
FT                   IVDSIKGDKEARKKCAKEIAEFEAACSSTWVKYFKEKRVMEYNRDKTIERIKKEDAATV
FT                   RDLKSQGWSPK"
FT   gene            299510..300726
FT                   /locus_tag="ANIA_05007"
FT                   /old_locus_tag="AN5007.4"
FT                   /product="class II aldolase/adducin domain protein
FT                   (AFU_orthologue; AFUA_3G09800)"
FT   mRNA            join(299510..299810,299879..300139,300199..300331,
FT                   300384..300552,300652..300726)
FT                   /locus_tag="ANIA_05007"
FT                   /old_locus_tag="AN5007.4"
FT                   /note="transcript_id=CADANIAT00005385"
FT   CDS_pept        join(299510..299810,299879..300139,300199..300331,
FT                   300384..300552,300652..300726)
FT                   /locus_tag="ANIA_05007"
FT                   /old_locus_tag="AN5007.4"
FT                   /product="class II aldolase/adducin domain protein
FT                   (AFU_orthologue; AFUA_3G09800)"
FT                   /note="transcript_id=CADANIAT00005385"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005385"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005385"
FT                   /db_xref="GOA:Q5B373"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B373"
FT                   /protein_id="CBF76291.1"
FT                   /translation="MSTTTATLTNPSPAQVAVAPNPELSNENSTIKNIPPAATDKVFQA
FT                   TARGNRAGTLKPRGIPTFSDPYAERQWIKEHMAAAFRVFGKQGFNEGISGHISVRDPVL
FT                   KDHFWINPFGKHFSAMKASDLVLVDAEGYVTEGGAQQAINEAGFMIHSEIHKARPDVMA
FT                   AAHTHGIYGKTWSIFGKPIEMLTQDACNFYGKLAVYEDHGGVALAQDEGRAIAKALGKE
FT                   NIACILQNHGLLTVGSTVDEAAWLFVSLDSACHAQLMAEAAAANGIPKRIIPDEVAQYT
FT                   ADAAQNAHYFYHEFQPEFDLVVEESNGRVLQ"
FT   gene            complement(301647..304001)
FT                   /locus_tag="ANIA_10611"
FT                   /old_locus_tag="AN10611.4"
FT                   /product="N-acetylglucosaminyl transferase component Gpi1
FT                   (AFU_orthologue; AFUA_3G09860)"
FT   mRNA            complement(join(301647..301985,302042..302124,
FT                   302177..302488,302684..303818,303873..304001))
FT                   /locus_tag="ANIA_10611"
FT                   /old_locus_tag="AN10611.4"
FT                   /note="transcript_id=CADANIAT00005386"
FT   CDS_pept        complement(join(301647..301985,302042..302124,
FT                   302177..302488,302684..303818,303873..304001))
FT                   /locus_tag="ANIA_10611"
FT                   /old_locus_tag="AN10611.4"
FT                   /product="N-acetylglucosaminyl transferase component Gpi1
FT                   (AFU_orthologue; AFUA_3G09860)"
FT                   /note="transcript_id=CADANIAT00005386"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005386"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005386"
FT                   /db_xref="GOA:C8V8L8"
FT                   /db_xref="InterPro:IPR007720"
FT                   /db_xref="UniProtKB/TrEMBL:C8V8L8"
FT                   /protein_id="CBF76292.1"
FT                   /translation="MSDGLLRVFWPYDLPRSSAPGVIVGWRNSELDLFVLAVLEDVEPR
FT                   NVDNALRAGILFRNSPHPVPRIFSLCGRSSMHVLGSTNMRDPPTAFNASHLIVTTRPSC
FT                   KVPKIYCPPETGLSIQVIMFHRPDPTRMEYMSLNPISLALEDKMLAADKSDGVLDTIET
FT                   EEGAQKARAQRLVDKLRLHTVVKHLPSHKELALPFIINQINCAYEMGKLIEKNSSLIGI
FT                   RVKRSMSVSERVVESATTVWDLFVLGVSYVFWQWIWPVITRIFVIGLVFHRVIADFVLQ
FT                   VLEWRARPDAAALKDISATAQQVDIRLQQFCYWPTQYVKLRQRKDDWESVTTYHAHYIR
FT                   FYNSLWLVANDVIIGIALGSYIIDNANWVAYQINYILSGWTVEGLQRTISWLMDWPAGL
FT                   KLNNELAAFLGDLFLWVIENWAARIFNWQLTIIISLFHLFRGKKRNVLRNRIDSCDYDL
FT                   DQLLLGTILFTVLFFLLPTVIVFYLAFTSARMLIISLKAALDTWLAFLNHFPLFALMLR
FT                   VKDSRRLPGGIRFELREEHDTLPNSVDSTIHYIHLESIPLTLRAMFDQYFQLAHRLRKH
FT                   YLSPQVIFCLFTGRFVPPIHRRSLYSMQYSMLPDVRPSLAQVWSELTQPARKSSGGGSG
FT                   GVSGQGGNSIGIGIMGMKMGGLAERRRGYR"
FT   gene            complement(304832..308038)
FT                   /locus_tag="ANIA_10621"
FT                   /old_locus_tag="AN10621.4"
FT                   /product="DNA mismatch repair protein Msh2, putative
FT                   (AFU_orthologue; AFUA_3G09850)"
FT   mRNA            complement(join(304832..307781,308015..308038))
FT                   /locus_tag="ANIA_10621"
FT                   /old_locus_tag="AN10621.4"
FT                   /note="transcript_id=CADANIAT00005387"
FT   CDS_pept        complement(join(304968..307781,308015..308038))
FT                   /locus_tag="ANIA_10621"
FT                   /old_locus_tag="AN10621.4"
FT                   /product="DNA mismatch repair protein Msh2, putative
FT                   (AFU_orthologue; AFUA_3G09850)"
FT                   /note="transcript_id=CADANIAT00005387"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005387"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005387"
FT                   /db_xref="GOA:C8V8L9"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR011184"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032642"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C8V8L9"
FT                   /protein_id="CBF76294.1"
FT                   /translation="MIGQDYFDVDDEVGFIRFYRSLASDDSHNNETIRIFDRGDWYSAH
FT                   GKEAEFIARTVYKTTSVLRNLGRSETGGLPSVTMSITVFRNFLREALFRLNKRIEIWGS
FT                   AGTGKGHWKKVKQASPGNLQDVEEELGAMGMEGSNGAPIIMAVKLSAKAGEARNVGVCF
FT                   ADASVRELGVSEFLDNDVYSNFEALVIQLGVKECLVVQDVNRKDVEVAKIRAICDNCGI
FT                   AISERPASDFGVKDIEQDLTRLLRDERSAGTLPETELKLAMGGAAALIRYLGVMSDATN
FT                   FGQYQLYQHDLAQYMKLDAAALRALNLMPGPRDGSKSMSLFGLLNHCKTPVGSRLLAQW
FT                   LKQPLMDLAEIEKRQRLVEAFVVSTELRQMMQEEHLRSIPDLYRLAKRFQRKQANLEDV
FT                   VRVYQVAIRLPGFVNSLENVMDEEYQTPLETEYTAKLRNHSASLAKLEEMVETTVDLDA
FT                   LENHEFIIKPEFDDSLRIIRKKLDQLRHDMYLEHKAVARDLDQEMDKKLFLENHRVYGW
FT                   CFRLTRNEAGCIRNKKAYQECSTQKNGVYFTTSTMQSLRREHDQLSSNYNRTQTGLVSE
FT                   VVNVAASYCPVLEQLAGVLAHLDVIVSFAHASVHAPTAYTKPKIHPRGTGNTVLKEARH
FT                   PCMEMQDDISFITNDVSLIRDESSFLIITGPNMGGKSTYIRMIGVIALMAQIGCFVPCT
FT                   EAELTIFDCILARVGASDSQLKGVSTFMAEMLETSNILKSATSESLIIIDELGRGTSTY
FT                   DGFGLAWAISEHIVTEIRCFGLFATHFHELTTLADRYPKSVKNLHVVAFIGDGTTANEE
FT                   DEKEKRKTRQKVTLLYRVEPGICDQSFGIHVAELVRFPEKVVNMARQKAEELEDFTSAD
FT                   SAGNAASATIDKYSQEEVEEGSALLKALLVKWKSAIEEPGRELTLEEKRQVMRDLVKGD
FT                   EKLQANRVFQGIQAL"
FT   gene            complement(308249..309835)
FT                   /locus_tag="ANIA_05005"
FT                   /old_locus_tag="AN5005.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(308249..309835)
FT                   /locus_tag="ANIA_05005"
FT                   /old_locus_tag="AN5005.4"
FT                   /note="transcript_id=CADANIAT00005388"
FT   CDS_pept        complement(308249..309835)
FT                   /locus_tag="ANIA_05005"
FT                   /old_locus_tag="AN5005.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005388"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005388"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005388"
FT                   /db_xref="GOA:Q5B375"
FT                   /db_xref="InterPro:IPR032054"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B375"
FT                   /protein_id="CBF76296.1"
FT                   /translation="MPRTSTLTRSRSARLPQAQTQPQLGIQSFARATKPGCSSVAEGKK
FT                   DLEAKRSTLPVSPSKKRKLHELQNVDFVVREQGQGKEALQDTEENQENNNVDLLTLTPS
FT                   KSLKFSSLSVSSPRSGHYVACSTSPSISPSRSTRSTRSTQDAVIREDDSVPSTPTKRVT
FT                   APAPVTQRAKTTAPSPRSCPSSRSATRPACVEEIISLHSAFLKALTIHAAHRGVAAPAD
FT                   LREFLPSIQRIWKKRKVVVKDLQRLLWIWRQGPGCVFRIANHGLGRVCLERAAGRTEQI
FT                   DDEAKMQGRFEEAVSLLYRQASEQAEGEGEVDFLATLGLASIEESLTPFTALRKGQQRL
FT                   QDLKGGVIKVKMDVLLAEAAGDEASGITPARMRDATTSRRQGLFDRIKNKELRQSKLPP
FT                   PPSKEVLLRRAAAGRVEEVASVLALLRPAGYVGSGPTARTVAQRTPFCLETIVRNVQDS
FT                   TRNPISEQEVEACLEILSREDVAGHWVSIVIVNQLKSVVLRSCGDVQLKDIGAKVAQLK
FT                   PGWEETPKLII"
FT   gene            complement(310293..311162)
FT                   /locus_tag="ANIA_05004"
FT                   /old_locus_tag="AN5004.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(310293..310686,310746..310846,
FT                   310916..311162))
FT                   /locus_tag="ANIA_05004"
FT                   /old_locus_tag="AN5004.4"
FT                   /note="transcript_id=CADANIAT00005389"
FT   CDS_pept        complement(join(310465..310686,310746..310846,
FT                   310916..311036))
FT                   /locus_tag="ANIA_05004"
FT                   /old_locus_tag="AN5004.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005389"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005389"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005389"
FT                   /db_xref="GOA:Q5B376"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B376"
FT                   /protein_id="CBF76298.1"
FT                   /translation="MAAAPKSRAGLYAGLGALGAGAYYFYRAGGDPKAAKDEMKHDINK
FT                   ARAKAPGTETGERAGERAGLETNLNIDEAANNPTTKNTDLASQAQRKLDDLSQAGKDQA
FT                   ARAQRKLDDLSQAGKEEANKLSHDVEAKASEAKSTVSGWFGRK"
FT   gene            complement(312219..314009)
FT                   /locus_tag="ANIA_05003"
FT                   /old_locus_tag="AN5003.4"
FT                   /product="C2H2 transcription factor, putative
FT                   (AFU_orthologue; AFUA_3G09820)"
FT   mRNA            complement(312219..314009)
FT                   /locus_tag="ANIA_05003"
FT                   /old_locus_tag="AN5003.4"
FT                   /note="transcript_id=CADANIAT00005390"
FT   CDS_pept        complement(312219..314009)
FT                   /locus_tag="ANIA_05003"
FT                   /old_locus_tag="AN5003.4"
FT                   /product="C2H2 transcription factor, putative
FT                   (AFU_orthologue; AFUA_3G09820)"
FT                   /note="transcript_id=CADANIAT00005390"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005390"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005390"
FT                   /db_xref="GOA:Q5B377"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B377"
FT                   /protein_id="CBF76300.1"
FT                   /translation="MSFLPVNNISSPPDRAMEDVSATSATPRPLSNSIPTTQDAGTSNN
FT                   STTETQMPDESRGSTSTHSISDETIQAESEGEGSDHGSERKEHAPPTKKKKGQRFYCTD
FT                   FPPCNLSFTRSEHLARHIRKHTGERPFQCHCSRRFSRLDNLRQHAQTVHVNEEIPDSSL
FT                   AATGTRFQRQVRTDRVRPQGRARAGTGGSQATHTRGHSRNLSTSSIASTTSTFSQPPEL
FT                   RRRPPPLIMANDATTRSRLGLDPMIDAPTTPPAQVRGFHAPPSGSPYTPSQIYPSNGSP
FT                   MPGAAQVTGFWDGKTAARRLSVPSGANPFAPVQYTHPYPAANYAAPGEVYASPVSGKYP
FT                   VERDYQPTEAELRRRTWHYSTWPAPSRTDYSGIPSSQASESLPPAIGGNESADRPPRLP
FT                   GIESFDKFAAKRSLTPPVRRPSPMQVDSKPPPSYNFSGGFNYAPPPGRPAPPISGPGHR
FT                   RGHVSWDMSLHTNLTGLHIRDKPTPQRDASNWGQQTISELRSIGSRPSSSYQQQVQEFR
FT                   GQHTHGPPSFSTTASSSHAARTSPEDSSSSEGVHTPSTASLEYHPAIVQNNGFVEPHHP
FT                   PLSSDPSQTVRPPLYTEGQR"
FT   gene            complement(318446..319096)
FT                   /locus_tag="ANIA_05002"
FT                   /old_locus_tag="AN5002.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(318446..318530,318610..318789,
FT                   318993..319096))
FT                   /locus_tag="ANIA_05002"
FT                   /old_locus_tag="AN5002.4"
FT                   /note="transcript_id=CADANIAT00005391"
FT   CDS_pept        complement(join(318446..318530,318610..318789,
FT                   318993..319096))
FT                   /locus_tag="ANIA_05002"
FT                   /old_locus_tag="AN5002.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005391"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005391"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005391"
FT                   /db_xref="GOA:Q5B378"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B378"
FT                   /protein_id="CBF76302.1"
FT                   /translation="MYLRLGALKDSQGLARQMAIASEQEVALDELIFTRYQPASNTRWQ
FT                   QQRLRSQENGTRDTATVGLQITTAQQLTIALPLPAQRWSRRRQREPPVRNTWSQLAVIG
FT                   YKTLGTEVASFHRLVGGQ"
FT   gene            complement(319891..320063)
FT                   /locus_tag="ANIA_11454"
FT                   /old_locus_tag="AN11454.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(319891..319951,320044..320063))
FT                   /locus_tag="ANIA_11454"
FT                   /old_locus_tag="AN11454.4"
FT                   /note="transcript_id=CADANIAT00005392"
FT   CDS_pept        complement(join(319891..319951,320044..320063))
FT                   /locus_tag="ANIA_11454"
FT                   /old_locus_tag="AN11454.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005392"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005392"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005392"
FT                   /db_xref="UniProtKB/TrEMBL:C8V8M4"
FT                   /protein_id="CBF76304.1"
FT                   /translation="MPDDKDACSSEEANREEEALNVAATK"
FT   gene            complement(320356..324857)
FT                   /locus_tag="ANIA_05001"
FT                   /old_locus_tag="AN5001.4"
FT                   /product="exosome complex exonuclease Rrp6, putative
FT                   (Eurofung)"
FT   mRNA            complement(join(320356..321992,322546..324857))
FT                   /locus_tag="ANIA_05001"
FT                   /old_locus_tag="AN5001.4"
FT                   /note="transcript_id=CADANIAT00005393"
FT   CDS_pept        complement(join(320411..321992,322546..324857))
FT                   /locus_tag="ANIA_05001"
FT                   /old_locus_tag="AN5001.4"
FT                   /product="exosome complex exonuclease Rrp6, putative
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005393"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005393"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005393"
FT                   /db_xref="GOA:Q5B379"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012588"
FT                   /db_xref="InterPro:IPR019465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B379"
FT                   /protein_id="CBF76306.1"
FT                   /translation="MDPSTGFAPFQERVQTSLMDVTRTVGALAVNDLNFHRTSSANVSE
FT                   GLDEESGRLLSLTSSLLKAATAGTDISAPVLSDEDSIEDNWRGIVDVIDALLEKADACL
FT                   DEFTGVIKKLSPSQDKDAEARGAAASNMRRAQNFPTIYDYGPSKIPKPQLQFEHQVDPT
FT                   DTSPFRPLLKTKPHAIEPLEQSLTPSIDAPHGSRNPYETEIRAAKYPSSVYTVSPPIDY
FT                   LPFETTAATFVDTLDGVKEMLAELKSAREIAIDLEHHDVHSYHGLVSLMQISTREKDWV
FT                   VDTLKPWREELQMLNEVFADPNILKLFHGSSMDIIWLQRDLGLYVVGMFDTYHAACALN
FT                   YPKKSLKYLLHKFVNFEADKQYQMADWRIRPLPSGMFNYARSDTHYLLYIYDNLRNELL
FT                   TNSTPEDNLVDYVLEKSKTEALQRYERPVYDAATGQGAGGWYDLMTRSPAILSSEQFAV
FT                   LKAVHEWRDRVAREEDEGVQCVFPKHILFRVAQAMPQDLGTLFRTMSPMTPIAKDRAPD
FT                   LLQVIKTAKAEGATGPEWRDVYVKPTRGLPQVEAPPSPPTAQDGSFPTASRYETSQFWG
FT                   AVLDTQTPPLSPEYSLAASAEALRLSLPIPPMPRTVAEVQVAQPPKPTSPTPAPKKEEE
FT                   DKNKIFTVKELGGPRKRKAAPQPPAEVETSSQSEEPQAELDLDEIPIEIGSPPSKKQRR
FT                   KEKREKKKAKQNQSQNAEDSTPFNYDTADSILNANPQPTSGLPSKRPFDPYKKALEAPR
FT                   TGVKKEKKELPGRSFTFSSAGFAGYTKWPLKASISLIPFIWLSDTGPEPPIRVILTGLK
FT                   ADNRDSMASEPSYIDYEAFLDPAFSPAAFANSLVVATNNATDTPLDLSTPLSRVLFDLQ
FT                   EIDTHIHTLTTKSALPLLTHTGDQTAAAGKILKETDEQIVAVSQGYERLEREVLRRWEA
FT                   AEEARVAAENSLATVRLARAVARCIALGRQLDSQMVEVTGRGGLSGPSSGIGSGPGGEI
FT                   ASSGTGPAPGRDDARALERAASTIVTLRRLLSDTGAGEEGYGLDRVKVIRTLKSDLLMP
FT                   AENLVRARAQQAINRFSISSTSTSNGVSSQSGYKLARDARARLVSGVNTLYLLSPLPPK
FT                   SSSPKDFTPDLLLSTLQGYIQTTMVASLNNLSRALTMLPTLDKTLSDISARCQDIHSLE
FT                   AILSTIKPPSHPSLPQVSKSQDSTESVTASRNNLLIPLLNTLDTSSLPSYFWRSLASSL
FT                   SPRVQEIASRGGVSARTLRSNRDRLKKEIRECVLRGSQLPASLGLEKHSQAHAQGNWER
FT                   EAAVMVGSVVGVL"
FT   gene            325066..325739
FT                   /locus_tag="ANIA_10622"
FT                   /old_locus_tag="AN10622.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(325066..325164,325223..325260,325315..325385,
FT                   325467..325739)
FT                   /locus_tag="ANIA_10622"
FT                   /old_locus_tag="AN10622.4"
FT                   /note="transcript_id=CADANIAT00005394"
FT   CDS_pept        join(325124..325164,325223..325260,325315..325385,
FT                   325467..325559)
FT                   /locus_tag="ANIA_10622"
FT                   /old_locus_tag="AN10622.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005394"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005394"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005394"
FT                   /db_xref="GOA:C8V8M6"
FT                   /db_xref="InterPro:IPR007918"
FT                   /db_xref="UniProtKB/TrEMBL:C8V8M6"
FT                   /protein_id="CBF76308.1"
FT                   /translation="MAASIAPECNDLKEKYDTCFLKWYSEKYLRGNTGSTECEELFAKY
FT                   KSCLTKTLKERGIDTMLEEARKNTPETDAEYNRRS"
FT   gene            complement(326015..326850)
FT                   /locus_tag="ANIA_05000"
FT                   /old_locus_tag="AN5000.4"
FT                   /product="hypothetical membrane protein, putative
FT                   (AFU_orthologue; AFUA_3G09890)"
FT   mRNA            complement(join(326015..326097,326137..326270,
FT                   326332..326548,326630..326850))
FT                   /locus_tag="ANIA_05000"
FT                   /old_locus_tag="AN5000.4"
FT                   /note="transcript_id=CADANIAT00005395"
FT   CDS_pept        complement(join(326015..326097,326137..326270,
FT                   326332..326548,326630..326840))
FT                   /locus_tag="ANIA_05000"
FT                   /old_locus_tag="AN5000.4"
FT                   /product="hypothetical membrane protein, putative
FT                   (AFU_orthologue; AFUA_3G09890)"
FT                   /note="transcript_id=CADANIAT00005395"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005395"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005395"
FT                   /db_xref="GOA:Q5B380"
FT                   /db_xref="InterPro:IPR007482"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B380"
FT                   /protein_id="CBF76310.1"
FT                   /translation="MASQSPTARIYLLLYNSINALLWLRILITVLRAYSQNLDVISLPT
FT                   LYTVLEPQVRWTQTLAVAEILHAAIGLTRSPVFTTFTQIFARSVQVWAINYGFPAVTAS
FT                   SRAYAAMLFAWAVADAVRYSYFVVLLAGLHVPSVLRWLRYSLFIVLYPIGISAEWWLMY
FT                   RAAGVTSSSLVAGIFYFCLGLYAPVFYPADKSGSIMMYSYMLRQRRKTLAK"
FT   gene            327658..328664
FT                   /locus_tag="ANIA_04999"
FT                   /old_locus_tag="AN4999.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(327658..327669,327801..327876,328155..328277,
FT                   328349..328664)
FT                   /locus_tag="ANIA_04999"
FT                   /old_locus_tag="AN4999.4"
FT                   /note="transcript_id=CADANIAT00005396"
FT   CDS_pept        join(327658..327669,327801..327876,328155..328277,
FT                   328349..328557)
FT                   /locus_tag="ANIA_04999"
FT                   /old_locus_tag="AN4999.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005396"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005396"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005396"
FT                   /db_xref="GOA:Q5B381"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B381"
FT                   /protein_id="CBF76312.1"
FT                   /translation="MRQATNSRTERYYAISNTLLTIATDSRLYSEKAITAIEAIKLVPL
FT                   SALTTATRTEVDALILTPLKRSQKDGSYPRFSGKSWSISLSIACCCRAAKFFAEDRGAT
FT                   CTKYCVESVVSEFNTEMTSVVVESQYREPVRKNTA"
FT   gene            331248..333610
FT                   /locus_tag="ANIA_04998"
FT                   /old_locus_tag="AN4998.4"
FT                   /product="Putative uncharacterized proteinRas-GAP ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5JC47]"
FT   mRNA            join(331248..331365,331419..331552,331607..333610)
FT                   /locus_tag="ANIA_04998"
FT                   /old_locus_tag="AN4998.4"
FT                   /note="transcript_id=CADANIAT00005397"
FT   CDS_pept        join(331248..331365,331419..331552,331607..333610)
FT                   /locus_tag="ANIA_04998"
FT                   /old_locus_tag="AN4998.4"
FT                   /product="Putative uncharacterized proteinRas-GAP ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5JC47]"
FT                   /note="transcript_id=CADANIAT00005397"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005397"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005397"
FT                   /db_xref="GOA:G5EAT1"
FT                   /db_xref="InterPro:IPR000593"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="UniProtKB/TrEMBL:G5EAT1"
FT                   /protein_id="CBF76314.1"
FT                   /translation="MSSHDTRSLRQSKRMSVTALYLSMSAKDRDLEISDDLARAQKFLR
FT                   ELKSKISSQSKKNFVLEKDVRYLDSRIALLIQNRMALEEQNEVANRLDDTVDPQEGFFP
FT                   NDEKTQKYGNLLFLLQTEPRHIAHLCRLVSMSEIDSLLQTVMFTIYGNQYESREEHLLL
FT                   TMFQSVLTYQFDNTPEYSSLLRQNTPVSRMMTTYTRRGPGQSYLKQVLAEQINALIELR
FT                   DVDLEINPLKVYETMVRDIEEETGSLPDHLPRGVTGEVAAENPQVQAIIAPRLKKLTEI
FT                   ANSFLTTIINSVNQAPYGIRWICKQIRSLSRRKYPDAHDQTICTLIGGFFFLRFINPAI
FT                   VTPRSYMLIDATPTDKPRRTLTLIAKMLQNLANKPSYAKEPYMAKLQPFIQQNKERVNK
FT                   FMLDLCEVQDFYESLEMDNYVALSKRDLELQITLNEMYATHALLEKHNAALAQDQHSHL
FT                   QEILQELGPAPPQLPRKENRTITVPLFSRWETALDDLTSALDITQEEVFFMEAKSTFVQ
FT                   ILRSLPPHSSVARRPLRLDRIAEAAATLKNDAVMVRKGIRTMELLSQLQEMGVIDRSDE
FT                   FSLLRDEVEQELVHLGSLKEKVMEETRQLESVYATIRDHNAYLVGQLETYKSYLQNVRS
FT                   QSEGKSRKTQKQQELGPYKFTHQQLEKEGVIHKSNVPENRRANIYFMFKSPLPGTFVIS
FT                   LHYKGRARGLLELDLKLDDLLEMQKDNLEDLDLEYVQFNVSKVLTLLNKRFSRKKGW"
FT   gene            334435..335960
FT                   /locus_tag="ANIA_04997"
FT                   /old_locus_tag="AN4997.4"
FT                   /product="putative phosphatidylinositol transporter
FT                   (Eurofung)"
FT   mRNA            join(334435..335068,335141..335264,335334..335960)
FT                   /locus_tag="ANIA_04997"
FT                   /old_locus_tag="AN4997.4"
FT                   /note="transcript_id=CADANIAT00005398"
FT   CDS_pept        join(334836..335068,335141..335264,335334..335960)
FT                   /locus_tag="ANIA_04997"
FT                   /old_locus_tag="AN4997.4"
FT                   /product="putative phosphatidylinositol transporter
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005398"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005398"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005398"
FT                   /db_xref="GOA:Q5B383"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B383"
FT                   /protein_id="CBF76316.1"
FT                   /translation="MAAPAEKQSSKYDDYDFPTTAPEAQPGHPGHTTPEQDAKVEQLRS
FT                   ELEQEGYTERLDTLTLLRFLRARKFDVAAAKAMFIASEKWRKEFGTDDLARTFEYTEKP
FT                   EVFKYYPQYYHKTDKDGRPVYIEKLGNINIAELQKITTDERMLKNLVTEYEKLADPRLP
FT                   ACSRKAGKLLETCCSIIDLKGVGITSAPSVYGYLKMTSAVSQNYYPERLGKLYLINAPW
FT                   GFSTVFSVVKSFLDPVTVNKIHVLGSGYQSELLKQVPKENLPQQYGGTCQCEGGCEYSD
FT                   MGPWREPEWAREPKWANPKGNKGDVPAENPVAEKPTEAPEAPQPAA"
FT   gene            complement(336662..337592)
FT                   /locus_tag="ANIA_04996"
FT                   /old_locus_tag="AN4996.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(336662..337336,337416..337592))
FT                   /locus_tag="ANIA_04996"
FT                   /old_locus_tag="AN4996.4"
FT                   /note="transcript_id=CADANIAT00005399"
FT   CDS_pept        complement(join(336662..337336,337416..337592))
FT                   /locus_tag="ANIA_04996"
FT                   /old_locus_tag="AN4996.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005399"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005399"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005399"
FT                   /db_xref="GOA:Q5B384"
FT                   /db_xref="InterPro:IPR013950"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B384"
FT                   /protein_id="CBF76318.1"
FT                   /translation="MDSSHYRKIELQSAADFTYLHSNTVALSRQKLDLHLPPSAAPNNE
FT                   PDPMRERVRELVDDFITRTFTSASASVSINGLDSSSPEFPFPAAFTAPTELETVEYEPF
FT                   DGKLAARVASLYAQLESLTTTVAQLRRDAPRRAAREYAKELGRIIEEEDKEFNNEEDDA
FT                   DVGMNDADADRNQDQLQTQPEEDVANINEGERRRRGKVSRKEWNLDIPLGTEQEAERWR
FT                   NGEMAEVYEDTLRTLLRLQGEPVPGNDDAMSRSDGVDGNALASTVGKAERAGRAVEFVE
FT                   KI"
FT   gene            338007..339621
FT                   /locus_tag="ANIA_04995"
FT                   /old_locus_tag="AN4995.4"
FT                   /product="putative microbody (peroxisome) proliferation
FT                   protein peroxin 23-like (Eurofung)"
FT   mRNA            join(338007..339137,339187..339621)
FT                   /locus_tag="ANIA_04995"
FT                   /old_locus_tag="AN4995.4"
FT                   /note="transcript_id=CADANIAT00005400"
FT   CDS_pept        join(338007..339137,339187..339621)
FT                   /locus_tag="ANIA_04995"
FT                   /old_locus_tag="AN4995.4"
FT                   /product="putative microbody (peroxisome) proliferation
FT                   protein peroxin 23-like (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005400"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005400"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005400"
FT                   /db_xref="GOA:Q5B385"
FT                   /db_xref="InterPro:IPR006614"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B385"
FT                   /protein_id="CBF76320.1"
FT                   /translation="MASNIKLIDNTAPAERPAPDDASFSEITTTTSSVSRLWSRPSIRA
FT                   ERAKRRYAKWQPERLGVVASGSNDIAEPGSVQPSSSSDDGELLRARTDTNTLTNTSAIP
FT                   ENKSHVNDGNDESKNPQRIATEQIQQYDFGTGNEAESGAERSTTHQSKNHPKICGLKPG
FT                   SELDILYENQRGWFFFGVPLYSSQSLLNTDPAPWVNATGKRSFVDITNAQVPDPSWEWA
FT                   WKTWHVDMSGDVDEQGWQYAFSFLRSSSWHGTHPFWHSFVRRRRWVRLRIKKASTERNR
FT                   RSRTGLEMAHTLNEDYFTIHSALKQKRGTSSERASRGTSGNIGKLFTDTQEYVEEIRDI
FT                   PTLMYAIRVAIVDREKLNAVRKFVDEGVEELYYLEGKIPEIMTRFVYRTSRWQFLTYLN
FT                   ETMQSLDQQQKELETTGQTQPDLESNIQNLRRKQEYLSRAISTAERHLIGPTVLRVQEL
FT                   EPTENQKHASTSAAELLDLTAGNRRNSLISRVSSRFTFKPMDNGGRIKGIPKEAEIGHD
FT                   FHIY"
FT   gene            340347..342494
FT                   /locus_tag="ANIA_04994"
FT                   /old_locus_tag="AN4994.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            340347..342494
FT                   /locus_tag="ANIA_04994"
FT                   /old_locus_tag="AN4994.4"
FT                   /note="transcript_id=CADANIAT00005401"
FT   CDS_pept        340347..342494
FT                   /locus_tag="ANIA_04994"
FT                   /old_locus_tag="AN4994.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005401"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005401"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005401"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B386"
FT                   /protein_id="CBF76322.1"
FT                   /translation="MSTTQTDAADIAKSSSEEEHRKVDGGTGSESDADSKLKFIRDFWE
FT                   KYAERKLPAPSWIAARNGMHKSRALVRPLRRSVGPGRKIRRNARDPRRHGSSLYHKTVR
FT                   LLESAEKRATDKSGFARPNFYSASLVDNPDVQSKEILIPDETVAFFAGVLEKFSQSENI
FT                   WFMRLHGGCRVHILPTTESSGQDRKVVISGSPRAVEVTIQRIMVVKKRQERGDPLVDIQ
FT                   KPPLPILRSHLALGENGRTVTSMNAVRGVWGYVSRPGADFDTLVASWPSLTTVRQFAEH
FT                   VEQLTKSERSPGHHTPHRQRVAMALRDLFSHADKEHLISTLALNTAVTYLLKQHYRDFV
FT                   RGILNRAGHVATTETFNIILKSVARNQNIVSFRTVVVVMRRLRIAPDARTWLAFLDSLV
FT                   SPLNKAHLVRVLERKGYLQDRSIVRTLLQVMVKDLFKAHLRDGRTVREFFYKTIMVAGS
FT                   NWFPPSLIKQMFTVTVQLRNVHAMQELLKVCKENQLQLPSAVAYEVIHLFPQDTFSAVH
FT                   YVLQCLDSPHAELDKETYEQLFVNAFQNKHFNICRVLWRYACMNESTTKPMRSTLNFLL
FT                   TQNKASNRFSEWDQRWWTTAGKVIAGVCLHLPKYPLKDDLLRVIPPEFHDSPLSAFVNS
FT                   GTVEGKERARQRTAAKAIVRHDYQIGAWYRPKYSVTHMLEAALALDKEWGSVPRPANWF
FT                   LQNALDIPIELDLRKRKRHKR"
FT   gene            complement(344109..344847)
FT                   /locus_tag="ANIA_04993"
FT                   /old_locus_tag="AN4993.4"
FT                   /product="acetyltransferase, GNAT family, putative
FT                   (AFU_orthologue; AFUA_3G09940)"
FT   mRNA            complement(join(344109..344366,344464..344847))
FT                   /locus_tag="ANIA_04993"
FT                   /old_locus_tag="AN4993.4"
FT                   /note="transcript_id=CADANIAT00005402"
FT   CDS_pept        complement(join(344109..344366,344464..344847))
FT                   /locus_tag="ANIA_04993"
FT                   /old_locus_tag="AN4993.4"
FT                   /product="acetyltransferase, GNAT family, putative
FT                   (AFU_orthologue; AFUA_3G09940)"
FT                   /note="transcript_id=CADANIAT00005402"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005402"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005402"
FT                   /db_xref="GOA:Q5B387"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B387"
FT                   /protein_id="CBF76324.1"
FT                   /translation="MASTTHRPFDDPSSIRYIRYNPAHEDAYVAAMRQLISKDLSEPYS
FT                   IYVYRYFLYQWGDLCFLAMDTNSTTGEEQMIGVVVSKLEPHRHGPMRGYIAMLAVQEEY
FT                   RGKGVATKLVRMAIDAMEKRGADEIALETEITNTAAMKLYERLGFLRSKRLHRYYLNGN
FT                   SAYRLVLYLKEGVGLMRTSFDPYAPPPDYAHDHLPPPPALPAPLLSENGA"
FT   gene            345163..347147
FT                   /locus_tag="ANIA_04992"
FT                   /old_locus_tag="AN4992.4"
FT                   /product="Phospholipid:diacylglycerol acyltransferase,
FT                   putative (AFU_orthologue; AFUA_3G09950)"
FT   mRNA            join(345163..345483,345538..346945,347005..347147)
FT                   /locus_tag="ANIA_04992"
FT                   /old_locus_tag="AN4992.4"
FT                   /note="transcript_id=CADANIAT00005403"
FT   CDS_pept        join(345163..345483,345538..346945,347005..347147)
FT                   /locus_tag="ANIA_04992"
FT                   /old_locus_tag="AN4992.4"
FT                   /product="Phospholipid:diacylglycerol acyltransferase,
FT                   putative (AFU_orthologue; AFUA_3G09950)"
FT                   /note="transcript_id=CADANIAT00005403"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005403"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005403"
FT                   /db_xref="GOA:Q5B388"
FT                   /db_xref="InterPro:IPR003386"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B388"
FT                   /protein_id="CBF76326.1"
FT                   /translation="MIRRRQAKDNSDDVQAPAPADSSPEKQLPPAVAKPKNERKQSFIT
FT                   KPKSKRRNGLIFLLGGVFGIFCAVFFAQQQDVISLDSLMDLNIDSLMDVIPQSIMRDAR
FT                   EFSQHERDTVSYDAFSVGLHLRSQGVEAKHPIIMIPGVISTGLESWGTSPTSLMYFRRR
FT                   LWGSWSMMRALVLDKTEWKNHIMLDKETGLDPPGIKLRAAQGFDATDFFITGYWIWNKI
FT                   LENLASIGYDPTNAYTAAYDWRLSYLNLEARDHYFSRLKSYIETAVQVRGEKVTLASHS
FT                   MGSQVVLFFFKWVENPAHGKGGSDWVNRHIANWINISGCMLGAAKGLTAVLSGETRDTA
FT                   LLNSFAVYGLEKFLSREERAEIFRAMPGISSMLPKGGEAVWGNSTWAPDDQPGQKITYG
FT                   NILNFRETNSTFTQKNLTVPESLDYLLDQSEPWYRDQVLGSYSHGVAHTTAEVEANEND
FT                   PRTWLNPLEARLPLAPDMKLYCFYGVGKPTERSYFYQEERDPLVNLNVSIDTTVTTADG
FT                   TDHGVVLGEGDGTVNLLSTGYMCAKGWHIKRYNPSGIKIKVYEMPHEPDRFSPRGGPNT
FT                   GDHVDILGRASLNDLILRVAGGRGDEIEDTFVSRIKEYAERVKIYEE"
FT   gene            complement(348267..350404)
FT                   /locus_tag="ANIA_04991"
FT                   /old_locus_tag="AN4991.4"
FT                   /product="Aureobasidin-resistance protein
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9Y744]"
FT   mRNA            complement(join(348267..349506,349563..350404))
FT                   /locus_tag="ANIA_04991"
FT                   /old_locus_tag="AN4991.4"
FT                   /note="transcript_id=CADANIAT00005404"
FT   CDS_pept        complement(join(348609..349506,349563..349984))
FT                   /locus_tag="ANIA_04991"
FT                   /old_locus_tag="AN4991.4"
FT                   /product="Aureobasidin-resistance protein
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9Y744]"
FT                   /note="transcript_id=CADANIAT00005404"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005404"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005404"
FT                   /db_xref="GOA:C8V8N6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C8V8N6"
FT                   /protein_id="CBF76328.1"
FT                   /translation="MNQTLPTWKDRTQNQFGKLQIQVPWRSIQLLVPHRMRRKLRSKLR
FT                   SRASPTSSIASLQTSLSPADTLRSLQSHRWTVYDFQYLLLLIVGIFSLTVIESPGPLGK
FT                   TAIFSMLLFSLLIPMTRQFFLPFLPIAGWLLFFYACQFIPSDWRPAIWVRVLPALENIL
FT                   YGANISNILSAHQNVVLDVLAWLPYGICHYGAPFVCSLIMFIFGPPGTVPLFARTFGYI
FT                   SMTAVTIQLFFPCSPPWYENRYGLAPADYSIQGDPAGLARIDKLFGIDLYTSGFHQSPV
FT                   VFGAFPSLHAADSTLAALFMSHVFPRMKPVFVTYTLWMWWATMYLSHHYAVDLVAGGLL
FT                   AAIAFYFAKTRFLPRVQLDKTFRWDYDYVEFGESALEYGYGAAGYDGDFNLDSDEWTVG
FT                   SSSSVSSGSLSPVDDHYSWETEALTSPHTDIESGRHTFSP"
FT   gene            complement(354709..355639)
FT                   /locus_tag="ANIA_04990"
FT                   /old_locus_tag="AN4990.4"
FT                   /product="Vacuolar Fe2+/Mn2+ transporter, putative
FT                   (Eurofung)"
FT   mRNA            complement(join(354709..355244,355309..355639))
FT                   /locus_tag="ANIA_04990"
FT                   /old_locus_tag="AN4990.4"
FT                   /note="transcript_id=CADANIAT00005405"
FT   CDS_pept        complement(join(354709..355244,355309..355639))
FT                   /locus_tag="ANIA_04990"
FT                   /old_locus_tag="AN4990.4"
FT                   /product="Vacuolar Fe2+/Mn2+ transporter, putative
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005405"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005405"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005405"
FT                   /db_xref="GOA:Q5B390"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B390"
FT                   /protein_id="CBF76330.1"
FT                   /translation="MSLSSLSSLKGLLSPTTESEYDVEKDSHDLSRSEDVGSTNGEIKP
FT                   REAKESKLIDGRVISDAIIGLSDGMTVPFALTAGLSALGDTKVVVFGGFAELIAGAISM
FT                   GLGGYLVRESYHATLKETTKQTLTSPATVSDTIHEIFTPYDLPDHLLAQLTTHLTSSPH
FT                   LPSFLMTFHHTLPEPSGSRALTCALTIALSYFLGGFVPLLPYFFVGPDQAFLALKWSIA
FT                   TMAIALFVFGYGKTCFVSGWAGSKNIKKGAWGGLQMVIVGGVAAGCAMGLVRGFQALGE
FT                   SDPGQNT"
FT   gene            complement(356923..357972)
FT                   /locus_tag="ANIA_04989"
FT                   /old_locus_tag="AN4989.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(356923..357187,357257..357385,
FT                   357466..357972))
FT                   /locus_tag="ANIA_04989"
FT                   /old_locus_tag="AN4989.4"
FT                   /note="transcript_id=CADANIAT00005406"
FT   CDS_pept        complement(join(357175..357187,357257..357385,
FT                   357466..357674))
FT                   /locus_tag="ANIA_04989"
FT                   /old_locus_tag="AN4989.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005406"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005406"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005406"
FT                   /db_xref="GOA:C8V8N8"
FT                   /db_xref="UniProtKB/TrEMBL:C8V8N8"
FT                   /protein_id="CBF76332.1"
FT                   /translation="MANRLIPLVVLLIVVVVLAVIGFVAYSIIQEVSDKTRSKMEKRNV
FT                   MFTKDGMKVGVREVGEEEYVDRSQSILVNIWNHTSFPAYKSRLWNMTGSTGSASGTGNG
FT                   EFRAEHRKGRSN"
FT   gene            complement(359024..360940)
FT                   /locus_tag="ANIA_04988"
FT                   /old_locus_tag="AN4988.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(359024..360361,360641..360776,
FT                   360861..360940))
FT                   /locus_tag="ANIA_04988"
FT                   /old_locus_tag="AN4988.4"
FT                   /note="transcript_id=CADANIAT00005407"
FT   CDS_pept        complement(join(359213..360361,360641..360776,
FT                   360861..360883))
FT                   /locus_tag="ANIA_04988"
FT                   /old_locus_tag="AN4988.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005407"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005407"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005407"
FT                   /db_xref="GOA:Q5B392"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B392"
FT                   /protein_id="CBF76334.1"
FT                   /translation="MGSYTFRWPYNANEVFVTGTFDDWGKTIRLERKGDIFEKEVHLPV
FT                   TGDKVHFKFVVDGNWTTDNRLPQEDDGSSNINNILYPDQIQADSVAALQNGAQDMATVS
FT                   GVTPNATTAGLAGGVSKESNLAPGSTTAGLDKDVPLEQRANVPGEFPADTPLSEYSVNP
FT                   IPASSGIGNPIHLKPGEKVPDPSTFNPNTVQSTVRTNDTNESRPQDSSGLKSSFSVPPA
FT                   SNTMIPESSLPMGSGTNPAPADPGVTVQSAAPTSTTAALAANVPFENKKQPDKTGPVED
FT                   VPAIVRESISKAHRDPEAAAQQEVVDEKKELEHELQQKVQVANSVGEPAPTTTAATTET
FT                   APRASVAEPSSAEMSPRTGTPSGAKASTTGAQQPGESTTGAPVTGASTTGGETKKSTTP
FT                   ANDSKISEVPSSGSPGKEDKKKKRSSIFAKLKEKFK"
FT   gene            363199..364878
FT                   /locus_tag="ANIA_04987"
FT                   /old_locus_tag="AN4987.4"
FT                   /product="cAMP-dependent protein kinase regulatory subunit
FT                   (PKA regulatory subunit)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:O59922]"
FT   mRNA            363199..364878
FT                   /locus_tag="ANIA_04987"
FT                   /old_locus_tag="AN4987.4"
FT                   /note="transcript_id=CADANIAT00005408"
FT   CDS_pept        363199..364437
FT                   /locus_tag="ANIA_04987"
FT                   /old_locus_tag="AN4987.4"
FT                   /product="cAMP-dependent protein kinase regulatory subunit
FT                   (PKA regulatory subunit)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:O59922]"
FT                   /note="transcript_id=CADANIAT00005408"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005408"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005408"
FT                   /db_xref="GOA:O59922"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012198"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/Swiss-Prot:O59922"
FT                   /protein_id="CBF76336.1"
FT                   /translation="MSNYSHSSNNPFLKVSTKEDKPSSFHKIAEDEEYEVTSPTDATFR
FT                   ASKNADNSAGGNNPLESGRAGESGDGIRFGRDPFGNFQGGAEGQDESSIDPNGFRPTGG
FT                   PDHGFPNNYALGRRTSVSAESLNPTSAGSDSWTPPSHPKSEEQLARLKTAVSNNFLFSH
FT                   LDDEQSRTVLDALVEKPIPAKDIKVISQGDAGDYFYIVEEGHFDVYINPSGSVQPGPDG
FT                   AGTKISTIGPGGSFGELALMYNAPRAATIVSTEPKSTLWALDRITFRRILMDSAFQRRR
FT                   MYEAFLEEVPLLSSLKPYERAKIADALDTIKFPAGEYIIKEGDPGDAFYLLESGEAEAF
FT                   MEGVEEPVKSYKRGDYFGELALLDDKPRAASVRAKTEVKVAKLGRDGFKRLLGPVENIM
FT                   RRTEYSSRPSTAT"
FT   gene            complement(364923..365815)
FT                   /locus_tag="ANIA_04986"
FT                   /old_locus_tag="AN4986.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(364923..365209,365335..365815))
FT                   /locus_tag="ANIA_04986"
FT                   /old_locus_tag="AN4986.4"
FT                   /note="transcript_id=CADANIAT00005409"
FT   CDS_pept        complement(join(364923..365209,365335..365815))
FT                   /locus_tag="ANIA_04986"
FT                   /old_locus_tag="AN4986.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005409"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005409"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005409"
FT                   /db_xref="GOA:Q5B394"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B394"
FT                   /protein_id="CBF76338.1"
FT                   /translation="MPKSKPSKKDHHPSQSLSHQQPPNWPPLRPLVPSSDLYLDPLLPD
FT                   QIYLIRNFLPASLCKTYVSFLASLPLTTTPGKPKKGDAVRVNDRFQIQDATFAENLWRG
FT                   TALKELVTNPVSVDDGVGEYSDGGRSMKEIWGGEPLGLNANIRVYRYSPGQFFAQHYDD
FT                   SNTLSFLSPSMPPKPARTTWTLLIYLSTCTGGETVFYPQRTRSDPNPEPISVAPEMGMA
FT                   LLHRHGDQCLLHEGKEVTHGEKWVLRSDLVVAR"
FT   gene            366137..369421
FT                   /locus_tag="ANIA_04985"
FT                   /old_locus_tag="AN4985.4"
FT                   /product="putative forkhead transcription factor
FT                   (Eurofung)"
FT   mRNA            366137..369421
FT                   /locus_tag="ANIA_04985"
FT                   /old_locus_tag="AN4985.4"
FT                   /note="transcript_id=CADANIAT00005410"
FT   CDS_pept        366137..369421
FT                   /locus_tag="ANIA_04985"
FT                   /old_locus_tag="AN4985.4"
FT                   /product="putative forkhead transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005410"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005410"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005410"
FT                   /db_xref="GOA:Q5B395"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B395"
FT                   /protein_id="CBF76340.1"
FT                   /translation="MTAPAVGHHPSEAGPGVSSLYDYTRSQHSPENDHHLPSPQSTTRN
FT                   DSAPDHSSSSNGLSTLSDMVAVKSKAEDQASHALSTGQEFQSDLRRQSAASALLAQLLG
FT                   GQQAPNTDSDQAMEGLEVSDKQDTEQKQQFGDESNGNWETKQGVDVPPSGAEPKNGDQS
FT                   QPAEPQHQTEDMAFQQSGLPFSTTEQNDNVLARTDPIDNLTDPLLFAKPNLDHSDLFPP
FT                   IDFTAPGTPMEGLQQNDMVNSAYYSQNANLSALGYTEGGTHNGSGSVAGSEPRIQAFAK
FT                   LEFDDGHFYCNTYSFILGRDVRAARAAHQREFQARQAMRYSRAKSSSGGNASRTPTRVK
FT                   HEGSGIIGSVVSDRGGIMGFDPDVPSHMQSHVSRRSSNASDGDAGGLLHATPAQLQATT
FT                   DYNALAMQSLQESNGNGDAKPVDALALLPSPDACPTIPIHPPATNDGSVAGHRGISRKH
FT                   VKIAYNFDKNLFEMEVLGRNGAFIGADWLSPSQIRPLHSGDYIQIGGVRIRFLLPDVPI
FT                   GETGADIEEEQLPEPQQKVETSVSVESQENAEKKDDSKATKLVLKTKVEEPARPVSSIE
FT                   GDAQQPQRRRGPGRPPKDGIMSKRERAELAREQKLAARREANGGVTPPPQSKPKAGKTT
FT                   ATTGGLAPPVPAEGESPNSKPEKRKYTKRKKDGMMDIPIPSTEGGQFPMEHQPQEYVKP
FT                   PPVKKRKPSRSPSPNYPPESAYTPEDLAKPPYNYAVLIFDALTEASTPMTLKQIYRALK
FT                   LKYPYFRFKCETEGWTSSVRHNLNGNGHLFMHAERDGKGWSWQLRPGASVEKEKKRRPS
FT                   PPPPPAQPAQAPPSSVTPQYMPPPTNSYSNQPNGQSGMANPQFQNFSSMPSNPFPTSAA
FT                   PPAPTPPLQHSTPYPPPAPPTASSPFPIPSPIRNNLPPAFAQTTPTTYTSPYASDPPPQ
FT                   LLQYQQSQQAQAQTQHMQPPPPPQHSTPYPPQNTQPLPPNNNPPQSYPSNPGPPQHQPQ
FT                   HQHQQHNQQQQQPYNMGGQNPGPVPMDTSSDEASFNERANKAIDDFEAVLLEDYEDKDY
FT                   IKGVLKSARARALGEATESSFPGGEPPDEAVLLDALKNMIKGLRGE"
FT   gene            372623..374735
FT                   /locus_tag="ANIA_04984"
FT                   /old_locus_tag="AN4984.4"
FT                   /product="cyclin, hypothetical (Eurofung)"
FT   mRNA            join(372623..373189,373263..374735)
FT                   /locus_tag="ANIA_04984"
FT                   /old_locus_tag="AN4984.4"
FT                   /note="transcript_id=CADANIAT00005411"
FT   CDS_pept        373320..374735
FT                   /locus_tag="ANIA_04984"
FT                   /old_locus_tag="AN4984.4"
FT                   /product="cyclin, hypothetical (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005411"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005411"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005411"
FT                   /db_xref="GOA:Q5B396"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B396"
FT                   /protein_id="CBF76342.1"
FT                   /translation="MPSFYNTGLPAYPLTPPHITGAGRMENEPPFYVLGHSAAFPPRYT
FT                   QSGCEFIEQYSQQSHCYAKPPMNAQQPMHSMRTGRDMTALSQSMFGPVPAANVLPPIRN
FT                   NVQLPPMDHAVPPQYRRQDPIAQPEQALKEEKPTGGVAAYLDYEMDQMSDFVAEMAQGM
FT                   YDLYITKINLSDIDFARSVYPGSSVPPQFRKYVFQILSSTRLPSSTILLGLYYLSCRMR
FT                   MLSSAKIYNAGSGQVYRMLTVALLLGSKFLDDNTFQNKSWAEVSNISVSDLNSMELEWL
FT                   FAFEWKIHDRIYDQQDGFASWLSHWEKWRAKSSIRAHEPRRSLAPIDTNITRSNRVSKP
FT                   LLSPEGPIPPQYQRNNQYENSWLNPAASEYSPPSAPHSGPTTPDYYSVGPWGYSSNPPP
FT                   PYSSTWMPHHQYMPPPRSQPPSYHHTPSYGFPFPHGGWTTGHGASCGCSYCAKHMEHYM
FT                   CANLGSMQPILAA"
FT   gene            complement(375936..378601)
FT                   /locus_tag="ANIA_04983"
FT                   /old_locus_tag="AN4983.4"
FT                   /product="phosphoglycerate mutase family domain protein
FT                   (AFU_orthologue; AFUA_3G10050)"
FT   mRNA            complement(join(375936..377743,378006..378118,
FT                   378475..378601))
FT                   /locus_tag="ANIA_04983"
FT                   /old_locus_tag="AN4983.4"
FT                   /note="transcript_id=CADANIAT00005412"
FT   CDS_pept        complement(join(376028..377743,378006..378118,
FT                   378475..378601))
FT                   /locus_tag="ANIA_04983"
FT                   /old_locus_tag="AN4983.4"
FT                   /product="phosphoglycerate mutase family domain protein
FT                   (AFU_orthologue; AFUA_3G10050)"
FT                   /note="transcript_id=CADANIAT00005412"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005412"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005412"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B397"
FT                   /protein_id="CBF76344.1"
FT                   /translation="MRSTFRDSRMIFFRCSRVAFSAALLYFEENQTAFSSSFGIPSLVA
FT                   DERVLINGDKGCTEAEAATNAALGGANEAQDIRHYMIILIRHAQSEGNKNREIHQTIPD
FT                   HRVKLTPEGHRQARDAGTRLRGLLRPDDTIHFFTSPYRRTRETTEGILESLTADTPSPS
FT                   PFPRHTIKVYEEPRLREQDFGNFQPCSAEMERMWLERADYGHFFYRIPNGESAADAYDR
FT                   VSGFNESMWRLFGEKDFASVCVLVTHGLMTRVFLMKWYHSFVEYFEDLRNINHCEFVIM
FT                   KLNEDSGKYVLQNQLRTWSELRMEKERERQQEQAAKGLPASSTPSETPVPVRRKWGGCP
FT                   NGCNHGVSRMSYQRTSRTHDGDPRKEHDSHHKASQDATRNSQTSQSTNQFNNANTANEG
FT                   QTIEAPEPAIGDKAAELPLKTLPPKAQYSSTPEPTTPTQPHNTTHHHHYQASPKHSRDL
FT                   LDQDHSHPNYNLIHLVGRDGGGTLSGAGSVAASEDEHDTYRSHHHRHHNLHEPSRSGLK
FT                   RHKPRPSQDLENDGDDEGSGRQAPKLRRTRSSHHRYHASPTRTDKTLTQTRTQDQAPAA
FT                   EKNAITRTIPNTGGETEKALPGGQPSENPDAAQGQKAPESMRETGREDEEENESENVKT
FT                   LEQAQKEDQSLRGSVY"
FT   gene            380232..382018
FT                   /locus_tag="ANIA_04982"
FT                   /old_locus_tag="AN4982.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            380232..382018
FT                   /locus_tag="ANIA_04982"
FT                   /old_locus_tag="AN4982.4"
FT                   /note="transcript_id=CADANIAT00005413"
FT   CDS_pept        380472..381821
FT                   /locus_tag="ANIA_04982"
FT                   /old_locus_tag="AN4982.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005413"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005413"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005413"
FT                   /db_xref="GOA:C8V8P5"
FT                   /db_xref="InterPro:IPR019194"
FT                   /db_xref="UniProtKB/TrEMBL:C8V8P5"
FT                   /protein_id="CBF76346.1"
FT                   /translation="MAASTLSAGGMIDPSKHAEYPIILGERLARRTDKTYSQLINIQYN
FT                   YKPKSATPQQRSIITNSPHSRDHFNLTITDQAPNSDQNVLTYSYQGSVDPAQSASDSQE
FT                   HELVLVFDAAKKAFVLEPVATQLNFNLRSAPAKTQKQLIQQYPQLRTLQEDHTSGDDRA
FT                   PDQASGNDDGPADDENPYDYRHFLAKDKDNLDDDKSASGNATPEPYTTTSKAATPLITA
FT                   TKTAPSPQPRSKPQTNPLRQKKLATDAPRTSTAASAKPKLSSPAKVVERHTANDTVTKR
FT                   ENHDDVEKFVFDSSKSPSPSETGAGAVSSQKTVPSPGSNIIIDGDLIIDMGSPPPARPF
FT                   KVNPAHFSSNNTPSNDEDEEDGDENEDIEDLRLPSPVPTTQRPEPGSGIQVEGDNGGTE
FT                   EEEMEDEDDLLAAEMEAAFEEEARSQQSQAHIPANQYVLSEDESEVSEEE"
FT   gene            382543..384084
FT                   /locus_tag="ANIA_04981"
FT                   /old_locus_tag="AN4981.4"
FT                   /product="cyclin, putative (AFU_orthologue; AFUA_3G10070)"
FT   mRNA            382543..384084
FT                   /locus_tag="ANIA_04981"
FT                   /old_locus_tag="AN4981.4"
FT                   /note="transcript_id=CADANIAT00005414"
FT   CDS_pept        382543..384084
FT                   /locus_tag="ANIA_04981"
FT                   /old_locus_tag="AN4981.4"
FT                   /product="cyclin, putative (AFU_orthologue; AFUA_3G10070)"
FT                   /note="transcript_id=CADANIAT00005414"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005414"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005414"
FT                   /db_xref="GOA:Q5B399"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B399"
FT                   /protein_id="CBF76348.1"
FT                   /translation="MASQPPVKRPPPAPSNPVLLAAQKQWLFTDEELTRSPSQLSGMTV
FT                   ENENLHRSKGVNFITQVGIMLKLPQPTLATAAVYLHRFFMRYAIADKPERPGIHPYPIA
FT                   ATSLFLATKVEENVRRMKELVIAVCRVAQKKPDLVVDEQSKEFWKWRDTILHHEDILLE
FT                   ALCFDLQLEQPYRILYDFICFFRVNDNKHIRNSSWAFLNDSMYTVLCLQFPARVIAAAA
FT                   FYAAASHCDIGFEDDEFGRSWWEQIDVDIAQVRRACTRMAELYESNSQHRHSQYYPPVP
FT                   LAWKEGAEKTRIPRPGGSLDAPPDPSSRKRSREPEDSSKSSQQPSQDTASLKKEEASQN
FT                   GARSPKRPRVGSDADQPRSAAGSLPQGGTHPHPPTTSPQSPQASSSFSHDRPPNGHHAH
FT                   QSQRYQHPLPSAPRTTFPPRRNSETKNVDTIQQRIDQIVQQNSVPPKRATADKYRERDR
FT                   DDEDAYQKRRPSYSSSTRNEHPPPPPPEHRQQPPPPPPPEPEPDDEGGGSEEGEL"
FT   gene            complement(384746..386760)
FT                   /locus_tag="ANIA_04980"
FT                   /old_locus_tag="AN4980.4"
FT                   /product="serine/threonine protein kinase, putative
FT                   (Eurofung)"
FT   mRNA            complement(384746..386760)
FT                   /locus_tag="ANIA_04980"
FT                   /old_locus_tag="AN4980.4"
FT                   /note="transcript_id=CADANIAT00005415"
FT   CDS_pept        complement(384937..386760)
FT                   /locus_tag="ANIA_04980"
FT                   /old_locus_tag="AN4980.4"
FT                   /product="serine/threonine protein kinase, putative
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005415"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005415"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005415"
FT                   /db_xref="GOA:Q5B3A0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3A0"
FT                   /protein_id="CBF76350.1"
FT                   /translation="MSPNTAQDDLSVGDVFSPQADMCHSKIEEECNTVSQQTGFRMSAR
FT                   SPERRPGLFTKSDTNPLTAKGDRRKKKKKQAQIDAGPALSTVRGFTPRGSGDEDSDFST
FT                   TSSRATSTQPRPLAGSNGASPMLQPVSGGGISALRLQLESMDLSGNSSRRKAADGLCSA
FT                   TPSNASVYSDSDETEILTSYEVPLDHDYVSADAVAEEKKQDEQSQNDMSTQDVRNQLCR
FT                   KMTTDDFEPLLCLGKGSFGTVLLVRHALTGKLYAQKQFKKASITVHKKLVEQTKTERAI
FT                   LESVNRHPFVVKLFYAFQDHERLYLVLEYAQGGELFTHLAMERMFDEDAAAFYMAEMVL
FT                   ALEHLHQNVGVIYRDLKPENCLLDREGHLLLTDFGLSKIAVGDDDRCNSSLGTIEYMAP
FT                   EVIQGKPYGKACDWWSLGALGYDLLTGSPPFKANNHAKLQEKILKQKLVLPYYLGPDAK
FT                   DLLTRLLRKEPSKRLGYHMPKDLQTIKSHRFFRKIDWRALESRSLTPPIVPVVTDPALA
FT                   ENFSTDFTALPLSPVEGPSFFSEHYAAQHRGSGVRSDSHSGMSTGMGVPTSHDGAEHDS
FT                   NPFGGFSFVAPSSLLDHAVGGSGASPMTAGY"
FT   gene            complement(387667..388803)
FT                   /locus_tag="ANIA_04979"
FT                   /old_locus_tag="AN4979.4"
FT                   /product="dihydroneopterin aldolase domain protein
FT                   (AFU_orthologue; AFUA_3G10090)"
FT   mRNA            complement(join(387667..387852,387908..388803))
FT                   /locus_tag="ANIA_04979"
FT                   /old_locus_tag="AN4979.4"
FT                   /note="transcript_id=CADANIAT00005416"
FT   CDS_pept        complement(join(387667..387852,387908..388786))
FT                   /locus_tag="ANIA_04979"
FT                   /old_locus_tag="AN4979.4"
FT                   /product="dihydroneopterin aldolase domain protein
FT                   (AFU_orthologue; AFUA_3G10090)"
FT                   /note="transcript_id=CADANIAT00005416"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005416"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005416"
FT                   /db_xref="GOA:Q5B3A1"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3A1"
FT                   /protein_id="CBF76352.1"
FT                   /translation="MAEQRVNVHIPSRPAVLDSVRLRNIQLPLPAAPDPWHRNGKPQPC
FT                   TASLKLSYSSAVAAANADDVSLSLDYGKLYRRLEEDIRNMTAGSKPSGTTPGQHMISVD
FT                   GSRREEMMRAELGQDVRLTAGIVANCGLGLLDETAAGVRRMAHVHQSRRRSSASASEAR
FT                   AANFNSSTSSSSTGGPIDDVYGQCEVWLHLPKALLRAENGLHYRSSTVWGYRQGSTAGS
FT                   DVSSSERCPVVLEEGFRIEGIRCYCILGVNSHERVEKQAVIISLEFKGPGQLAWGSTVV
FT                   DTYQAMTRAVAERVEETSFQTVEALATFVARIVTVDYANERVTVRVEKPSALAFVEASG
FT                   VEVTRSQAFFERTA"
FT   gene            complement(389477..391721)
FT                   /locus_tag="ANIA_04978"
FT                   /old_locus_tag="AN4978.4"
FT                   /product="pre-RNA splicing factor Srp2, putative
FT                   (AFU_orthologue; AFUA_3G10100)"
FT   mRNA            complement(join(389477..389848,389908..390004,
FT                   390059..390132,390515..390675,390730..390735,
FT                   390786..390914,391266..391721))
FT                   /locus_tag="ANIA_04978"
FT                   /old_locus_tag="AN4978.4"
FT                   /note="transcript_id=CADANIAT00005417"
FT   CDS_pept        complement(join(389477..389848,389908..390004,
FT                   390059..390132,390515..390675,390730..390735,
FT                   390786..390914,391266..391317))
FT                   /locus_tag="ANIA_04978"
FT                   /old_locus_tag="AN4978.4"
FT                   /product="pre-RNA splicing factor Srp2, putative
FT                   (AFU_orthologue; AFUA_3G10100)"
FT                   /note="transcript_id=CADANIAT00005417"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005417"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005417"
FT                   /db_xref="GOA:Q5B3A2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3A2"
FT                   /protein_id="CBF76354.1"
FT                   /translation="MTEVSSTRLYLGNLPRNVTKQDIEEHFSTHGTGKITEIKLMNGFG
FT                   FIEYEDAMDARDIVPAFHGSDFKGERLTVQFARGPRRKENFPVPTDRPNLPRPRRTIFR
FT                   MIISGLPETSWQDLKDFARQSGLDVVYSETGREPGRGIVEFETANDLKTAVEKLDGREF
FT                   KGTRVTCVPDIQPYDDRPYRDPYRSRSPRRGYPPMDEYDRRYSVPRGYSPRSHYRERSP
FT                   IPMRRDYYGDGYGRRTPPRPRMEDYPPPRRPYEDPYGPPPPPRYDDPYAAPPRPYGRPR
FT                   SPPRGDYAPYDRRYW"
FT   gene            complement(392146..394385)
FT                   /locus_tag="ANIA_04977"
FT                   /old_locus_tag="AN4977.4"
FT                   /product="electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase (AFU_orthologue; AFUA_3G10110)"
FT   mRNA            complement(join(392146..392323,392380..393898,
FT                   393982..394385))
FT                   /locus_tag="ANIA_04977"
FT                   /old_locus_tag="AN4977.4"
FT                   /note="transcript_id=CADANIAT00005418"
FT   CDS_pept        complement(join(392224..392323,392380..393898,
FT                   393982..394264))
FT                   /locus_tag="ANIA_04977"
FT                   /old_locus_tag="AN4977.4"
FT                   /product="electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase (AFU_orthologue; AFUA_3G10110)"
FT                   /note="transcript_id=CADANIAT00005418"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005418"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005418"
FT                   /db_xref="GOA:Q5B3A3"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3A3"
FT                   /protein_id="CBF76356.1"
FT                   /translation="MASRGVVLRLLRRETRPSPSRLSRPSSSLCISSRGSIATSGRRAS
FT                   VRCSAHSRPIQVRAFSQSISRNLTDENGHFDPRQVERESDEVDVCIVGGGPAGLSAAIR
FT                   LKQLANEAGNEEFRVIVLEKAGEIGAHVLSGNVLEPSALEELFPDWLSEDNPSRFEGAT
FT                   PAKEDKMRFLTKNSSIPIPAPPQMNNHGNYIISLNELTKWLGERAEELGVEVYAGFAAS
FT                   EIVYNSDGSVKGVATNDLGVARDGQAKDTFERGMEFHARVTLLGEGCHGSLTKQVTKRY
FT                   DLRRDSQPQTYGIGIKEVWEIQPEKFKSGEITHSMGYPLPKDTYGGAWMYHFGENMVSI
FT                   GLVVGLDYPNPWLSPYGEFQKLKHHPLYREVLEGGKCISYGARALNEGGYQSIPKCAFP
FT                   GGALIGDSAGFLNVPKIKGTHTAMRSAILAAESTFAALRNDAGGTVFLFDYEDSLRKSS
FT                   IWKELYEVRNMRPSFSTPLGIYGGILYSGLEAYIFRGHTPWTLKHHGTDAAATKLASEC
FT                   EKIEYPKPDGKISFDILTSVSRTGTNHEEDQPVHLQVEDWDKHTDIAWPKYKGVENRFC
FT                   PAGVYEYVEDSSKPHGVRFQINAQNCIHCKTCDIKVPTQDINWQTPQGGEGPKYFKT"
FT   gene            395893..397562
FT                   /locus_tag="ANIA_04976"
FT                   /old_locus_tag="AN4976.4"
FT                   /product="TATA-box-binding protein (TATA-box
FT                   factor)(TATA-binding factor)(TATA sequence-binding
FT                   protein)(TBP)(Transcription initiation factor TFIID TBP
FT                   subunit) [Source:UniProtKB/Swiss-Prot;Acc:Q12731]"
FT   mRNA            join(395893..396421,396514..396857,396922..397009,
FT                   397080..397562)
FT                   /locus_tag="ANIA_04976"
FT                   /old_locus_tag="AN4976.4"
FT                   /note="transcript_id=CADANIAT00005419"
FT   CDS_pept        join(396571..396857,396922..397009,397080..397559)
FT                   /locus_tag="ANIA_04976"
FT                   /old_locus_tag="AN4976.4"
FT                   /product="TATA-box-binding protein (TATA-box
FT                   factor)(TATA-binding factor)(TATA sequence-binding
FT                   protein)(TBP)(Transcription initiation factor TFIID TBP
FT                   subunit) [Source:UniProtKB/Swiss-Prot;Acc:Q12731]"
FT                   /note="transcript_id=CADANIAT00005419"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005419"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005419"
FT                   /db_xref="GOA:Q12731"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR030491"
FT                   /db_xref="InterPro:IPR033710"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12731"
FT                   /protein_id="CBF76358.1"
FT                   /translation="MDSLTTHPATAQQARAFTSPSSLSFPGGTAFPGGADLTPPSDKDA
FT                   NMATNGQSANGNVNGQQQGANAANGNGVMPATPAATPGASAPGSGIVPTLQNIVATVNL
FT                   DCRLDLKTIALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLA
FT                   SRKYARIIQKLGFNAKFTDFKIQNIVGSCDIKFPIRLEGLASRHHNFSSYEPELFPGLI
FT                   YRMMKPKIVLLIFVSGKIVLTGAKVREEIYQAFELIYPVLSGKLPTFDIRTPANFGTDF
FT                   RKV"
FT   gene            complement(398232..399905)
FT                   /locus_tag="ANIA_04975"
FT                   /old_locus_tag="AN4975.4"
FT                   /product="fructosyl amino acid oxidasesarcosine oxidase,
FT                   putative (AFU_orthologue; AFUA_3G10130)"
FT   mRNA            complement(join(398232..398618,398682..399666,
FT                   399762..399905))
FT                   /locus_tag="ANIA_04975"
FT                   /old_locus_tag="AN4975.4"
FT                   /note="transcript_id=CADANIAT00005420"
FT   CDS_pept        complement(join(398327..398618,398682..399666,
FT                   399762..399810))
FT                   /locus_tag="ANIA_04975"
FT                   /old_locus_tag="AN4975.4"
FT                   /product="fructosyl amino acid oxidasesarcosine oxidase,
FT                   putative (AFU_orthologue; AFUA_3G10130)"
FT                   /note="transcript_id=CADANIAT00005420"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005420"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005420"
FT                   /db_xref="GOA:Q5B3A5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3A5"
FT                   /protein_id="CBF76360.1"
FT                   /translation="MSLPDNILIVGGGVFGLSTALSLSKRHPNSKVTLLEASPTIPNPH
FT                   GSSVDSSRIIRADYSNPTYAKLASEAVDLWRTTEWGHEGRYTQNGLLLVYPDGNSTAKD
FT                   YTTKSYHNVKQLGENAQFLPTKADVLKAAPAYGETLQVAGGYVNWSSGWADAEAGVRFA
FT                   KQKLDKEGKVRFVHGEVSRLLFSPIDNRTVTGVVLKDFKNTTMTADLVILATGAWTAGL
FT                   VDLRGRAVSTGQAIAYMRISDEEQRRLEHMPTILNFATGIFIIPPRNNILKIARHAYGY
FT                   HNPKAVPVPGATPTGETMHVSLPEKGVPIPLEGETAFRTALKQLLPSFADRPFLNTRIC
FT                   WYTDTPRGDFIITHHPSHPHLVLATGGSGHAYKFFPLIGEKVVDALEGKLAPELRALWD
FT                   WPEAVDEAHFDGTEDGSRSGDKRLLLLDELAKGQKAKRESAL"
FT   gene            400137..401244
FT                   /locus_tag="ANIA_04974"
FT                   /old_locus_tag="AN4974.4"
FT                   /product="ubiquinone/menaquinone biosynthesis-related
FT                   protein (AFU_orthologue; AFUA_3G10140)"
FT   mRNA            join(400137..400249,400302..401244)
FT                   /locus_tag="ANIA_04974"
FT                   /old_locus_tag="AN4974.4"
FT                   /note="transcript_id=CADANIAT00005421"
FT   CDS_pept        join(400137..400249,400302..401244)
FT                   /locus_tag="ANIA_04974"
FT                   /old_locus_tag="AN4974.4"
FT                   /product="ubiquinone/menaquinone biosynthesis-related
FT                   protein (AFU_orthologue; AFUA_3G10140)"
FT                   /note="transcript_id=CADANIAT00005421"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005421"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005421"
FT                   /db_xref="GOA:Q5B3A6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3A6"
FT                   /protein_id="CBF76362.1"
FT                   /translation="MSASRIGRSAVKAAKGQAPGPLRAPKTTKTSPAPRQTSPRLLKRA
FT                   NPHLQNLSSDSATALQARMSPRAMTVLGVSALVISTYCGYLYASYRREVNQAQSLTVPE
FT                   DVSDRYNHTARTFDADVELSEKLMRLGAKRRDLVRQARGNVLEVSCGTGRNLEYYELGE
FT                   KRGIIDEKSQVGVRGCRTVTFVDLSPEMVAIARAKFEKLYPGFIGSEKVQFRAQDARDV
FT                   PPPSLSASGSVLPSESQGQGQGKGQGYYDTIVQTMGLCSMPDPAGALRHLGTITEPQHG
FT                   RILLLEHGRSHYDWLNRVLDNLAPAHADRHGCWWNRDIGQIVRDSGLEIVEEERYHFGT
FT                   TWRFVLRPKRT"
FT   gene            403972..406150
FT                   /locus_tag="ANIA_04973"
FT                   /old_locus_tag="AN4973.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(403972..404587,404651..406150)
FT                   /locus_tag="ANIA_04973"
FT                   /old_locus_tag="AN4973.4"
FT                   /note="transcript_id=CADANIAT00005422"
FT   CDS_pept        join(404163..404587,404651..405758)
FT                   /locus_tag="ANIA_04973"
FT                   /old_locus_tag="AN4973.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005422"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005422"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005422"
FT                   /db_xref="GOA:Q5B3A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3A7"
FT                   /protein_id="CBF76364.1"
FT                   /translation="MPYNTRRKSLSLPLLGIHLPNTSRRSPSTSKPPHATDENTPPSKK
FT                   VKRSHDSASTSPEPTDRGSNPSRPSATVRPSGRRATLEQTPPQSPTDGGVASKIDLDGI
FT                   NDDIVVGVIEQLEKTANRPHLVKELAAVLITSNDNVANSANPAALLSSRLSAYMKRPWT
FT                   ALAPCPLAKELIPIHPRKVYYYLTTQARQPIPESSDDVIIPGIDGKVLTPSASSVDDDE
FT                   DVMARQRSPSPEVDLSSPDFEDGDIDLDGSSSAAHSSSFSDHRHARLFHSHRATSPPLE
FT                   GDEKEFTQTASAVRERASEQKASQLAQAKGGYSALTEALQGLDDMSMSISGTPVDDSPL
FT                   SSFGDDQMAHTQTNYLSEEHQEQSRLQQHLQQQDLCENAAAAAALFGTSPSPSLTSVAL
FT                   SISSGTSAPSDDGSDIESGPGSLGTAPRIALPEDPSLARMSTLKRSIDMLDDELPDLDM
FT                   RMSDLADADDKIAVNAMMPLNPPSEMALDSWRELQSPESVNVDELDEMFDEI"
FT   gene            406676..409919
FT                   /locus_tag="ANIA_04972"
FT                   /old_locus_tag="AN4972.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(406676..407052,407111..407222,407277..408004,
FT                   408062..409919)
FT                   /locus_tag="ANIA_04972"
FT                   /old_locus_tag="AN4972.4"
FT                   /note="transcript_id=CADANIAT00005423"
FT   CDS_pept        join(406676..407052,407111..407222,407277..408004,
FT                   408062..409532)
FT                   /locus_tag="ANIA_04972"
FT                   /old_locus_tag="AN4972.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005423"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005423"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005423"
FT                   /db_xref="GOA:C8V8Z9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8V8Z9"
FT                   /protein_id="CBF76366.1"
FT                   /translation="MERPSGLPQPDAGRRSGQPPLQPQSNSHPNIIPVSKPPSLPGVSL
FT                   YNPRGAPHSAVTTGKKHMSSKVAIPRQKSAAPRYSRRVPLACETCRVRKTKCSGDTPIC
FT                   RQCLELRVECRYPVSWRERTKGQISKLSAKSDDYEKLLREISQIVDGRAAERIRYTLDK
FT                   YSESGAEQHNDQPSANSDPASGIDEGIDPEVESLPSSIGSLDAIDRVDEDLNRSPNAQA
FT                   TGYMGKNSEVTWLQRLGREADNRARNLSGLAEPRPDRELSIHSVNYHLDDVDITPPGPV
FT                   HLYWMPPRNIADKLFEDYLDTVHPVFPIISRSLFSAQYRNFFDNSARPGDKWLAILNLI
FT                   FAISSSHAHLMQASWRGVGRDHFVYLARARALSMNSDTLFSHPDLQQVQVEALTAFYLL
FT                   ATNQINRAWRIASLALRSGISLGLNLRNTSEVTPDTSKEARYRVWWCLYTLEHMLGTMT
FT                   GRVTGISDGVCTTPMPLPVDEDRFNDPAAAELLSSLELRQERVELALASCYVRQMPQNV
FT                   RRNREPNDAGKSADVARLQSLPPSTALFFLYYVDLAVISQEIFNRIYSLDCILTPWGEI
FT                   EDRMTELRSRIEYWLSNLPEAYDWTRGNQQNLELLRGSLCLAFLYYSVRITLGRPCLCR
FT                   RDVRSSESPGESTAFSHAISVSVLESAQRLIALIPDMPDASRIYLLCPWWCILHYLMQA
FT                   TTVLLLEISFGSVHLPAEEKSILEAAKKGIRWLFAMSEFSLASRRAWELCDRNLRQLAD
FT                   AGGSTIDMSDMPTADYQFDTNNKQQNHSQHPHVNSRPPVTTAVTQFPTLASTPSFHISP
FT                   PNNNHKQGQSPSSQHQMTALALQQSHTAPLTQSSRNEGRLHFPYDATTSAGFSNDIYFP
FT                   YDPITGEFIRSFFPNSNEEESWEH"
FT   gene            complement(410569..414072)
FT                   /locus_tag="ANIA_04971"
FT                   /old_locus_tag="AN4971.4"
FT                   /product="C6 transcription factor, putative
FT                   (AFU_orthologue; AFUA_3G10160)"
FT   mRNA            complement(410569..414072)
FT                   /locus_tag="ANIA_04971"
FT                   /old_locus_tag="AN4971.4"
FT                   /note="transcript_id=CADANIAT00005424"
FT   CDS_pept        complement(410569..414072)
FT                   /locus_tag="ANIA_04971"
FT                   /old_locus_tag="AN4971.4"
FT                   /product="C6 transcription factor, putative
FT                   (AFU_orthologue; AFUA_3G10160)"
FT                   /note="transcript_id=CADANIAT00005424"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005424"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005424"
FT                   /db_xref="GOA:Q5B3A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3A9"
FT                   /protein_id="CBF76368.1"
FT                   /translation="MTRCPSPVRLLCLHCRSSLRPPFAVVRSPWPATPRSGWKLQWSKQ
FT                   YSVGAKRSVFDSEFLKDLNRLNPPERRVPEWHRKRVKPWITFLEEFLRRNPKSAEAHSA
FT                   SNQSSGITRKSFAETIDLARHLNAARTELDRDLLAHTGYKLNNWSMVYAILNGLLDAAE
FT                   AVAAASSSRRGVVEDRAISLGISLDKLTDVDLFSSPFPRTSDIVGLETLDSLTYRPFSR
FT                   DYYMLLMAEVWKSLGIITIYAADTSPAKSKLAMSVVYRILARLHHSGLVSERVYKYTTP
FT                   DTYQATFRPPGMYLLSTHIMDVLSDAAWTVHEAEVAAEAAAAGKDAPFLPAKINIKELG
FT                   HEIWLEFILWCCVEHGHINEGTWLLERLIRRKGWKFQSWTPLLHEEKALRNTIINREVS
FT                   TWPSPESANVASEPPKRTDPPSLFHGLGKQTISVEIVTALLDNLPNLIHMGMGTGGVPA
FT                   PEILRHIDNLKFAITSATTSESEFLSTTKTVNWFTTRVIESGGLIPEVDPQTFDNLLKL
FT                   TPHVVPPWSNGMCPVEEDTLAALDQSQLYDDTCAFTGLIEYNLKYHSSHRFTGNALNLF
FT                   ARLQAVMDTCKMRRLDDFFSSRLKDDRANLPFTYDGLLSFESSIPQLSNVTLAHLFDLI
FT                   TVSRAFAFGEWLLLSDDIDGPTVPVNAYGDQALAPSLLRFAAATKNDNIGESVVRSLSQ
FT                   PVSLNTLRAILNYRITMHQWDQVISTLKYIRDNRIKTWAHSNIAAIAAEIIRLDHALIM
FT                   SSEKSNSPSTSNSDIEINLAEAKKVLYRILFGEFDENPWRKRRNPNFQAHTLISFTRLF
FT                   RHLPSPSLHEIAGSVFESEYVPMYRLPYIPSPPFHTILAAIAETQGTAAAKKVYKRFCV
FT                   SYNSPEFSRLVVGGITRFYEKAERDFRRGDPNFDAEYFHHLQKKLVLPNPNTVRILTQA
FT                   AIREYQAATVEMEAEVRSWSESLIPSSEGTAAEQYYDRTLSPRSTDAGASLSSNGTPPP
FT                   LSPRERKDEAEKTLIFCIKRFKVFHMSDAEIAREVGEEFYSNYQRANADRREWDRRTKS
FT                   DLKRNLERREKLKERLEEAEETLEDIKKDARAKRKERRKLWQKTQKLKEKLKKSEKAQN
FT                   DVKLNVLLNMTRRERDRACDGNQEQKRQPLFLPRARSEMRRMRRERGIMRRESWRGQTP
FT                   R"
FT   gene            complement(414893..415303)
FT                   /locus_tag="ANIA_04970"
FT                   /old_locus_tag="AN4970.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(414893..415174,415232..415303))
FT                   /locus_tag="ANIA_04970"
FT                   /old_locus_tag="AN4970.4"
FT                   /note="transcript_id=CADANIAT00005425"
FT   CDS_pept        complement(join(414893..415174,415232..415303))
FT                   /locus_tag="ANIA_04970"
FT                   /old_locus_tag="AN4970.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005425"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005425"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005425"
FT                   /db_xref="GOA:Q5B3B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3B0"
FT                   /protein_id="CBF76370.1"
FT                   /translation="MKSLTILGAVSALFLGRATAQITVTIPPFPDLPTMSIPTLTLPTS
FT                   ISLPSLPSIAIPTLPTSLPESVCFAVPTIPTSISVPTLMAAAPTAGPDSNTTQVLNDQF
FT                   ERMHPRQIAPLGA"
FT   gene            complement(416262..418548)
FT                   /locus_tag="ANIA_04969"
FT                   /old_locus_tag="AN4969.4"
FT                   /product="Probable kinetochore protein ndc80
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B3B1]"
FT   mRNA            complement(join(416262..418433,418504..418548))
FT                   /locus_tag="ANIA_04969"
FT                   /old_locus_tag="AN4969.4"
FT                   /note="transcript_id=CADANIAT00005426"
FT   CDS_pept        complement(join(416262..418433,418504..418548))
FT                   /locus_tag="ANIA_04969"
FT                   /old_locus_tag="AN4969.4"
FT                   /product="Probable kinetochore protein ndc80
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B3B1]"
FT                   /note="transcript_id=CADANIAT00005426"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005426"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005426"
FT                   /db_xref="GOA:Q5B3B1"
FT                   /db_xref="InterPro:IPR005550"
FT                   /db_xref="InterPro:IPR038273"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3B1"
FT                   /protein_id="CBF76372.1"
FT                   /translation="MSQDTGLFSIKRPRETLGSVQNFSSLPQPSSALKRTSSIGYQNPP
FT                   FTSQHTRSMSLLNSVGRPQQPNFQRSSSGGFGADPGLSSVRRSVSSNVFHGTSAGRPSF
FT                   APGSMSSNPASQSLQRRSSVFSRPSTGGAMGHQSFFTQVPSAAGVPRDPRPLRDRSFQA
FT                   RIAQELLEYLTHNNFELEMKHSLGQNTLRSPTQKDFNYIFQWLYHRIDPGYRFQKAMDA
FT                   EVPPILKQLRYPYEKGITKSQIAAVGGQNWPTFLGMLHWLMELAQMMDRFAMGEYDEAC
FT                   AEMGVDVSGDRIIFRFLTGAYHDWLQGGEEEDDDAAAQRLIPHIELMAQEFEKGNEKYV
FT                   QEMQVLDAENRALRDQIEELEKNAPDMAKLDKQFRILEDDKRKFEDYIQNVQGKIEKYE
FT                   SRIAFLEDEIRKTESELQAAEEERAGLQASVDQQGLTIQDIDRMNTERDRLQRSLDDAV
FT                   SRLEETHARVMAKESEASAKLEDLEELVKTYNTLGYQNSLIPSTAVNANGQEYELGLNV
FT                   NERSFSTSQIGGIPSRISPEADRLLAEPFTGYHPAHLLNLDLRGIVRSNLQALRKEINE
FT                   RRKRGIDADLERRNLLDNIKEAMDEKRSEVEALEHKRRTAEEEFERLKEVTTTQKLASD
FT                   AQIEKMEKELAKMRATMSESVQLMEQREMNTNIEYEQLTLRANALREELHTNVESMLND
FT                   VIRFKVHIQKGLEDYENFVVDEVEQELGGDTQLDEDAPMSTEEL"
FT   gene            418989..420401
FT                   /locus_tag="ANIA_10610"
FT                   /old_locus_tag="AN10610.4"
FT                   /product="microbody (peroxisome) biogenesis protein peroxin
FT                   14 (Eurofung)"
FT   mRNA            join(418989..419072,419136..419142,419203..419455,
FT                   419523..419607,419660..420401)
FT                   /locus_tag="ANIA_10610"
FT                   /old_locus_tag="AN10610.4"
FT                   /note="transcript_id=CADANIAT00005427"
FT   CDS_pept        join(419043..419072,419136..419142,419203..419455,
FT                   419523..419607,419660..420361)
FT                   /locus_tag="ANIA_10610"
FT                   /old_locus_tag="AN10610.4"
FT                   /product="microbody (peroxisome) biogenesis protein peroxin
FT                   14 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005427"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005427"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005427"
FT                   /db_xref="GOA:C8V903"
FT                   /db_xref="InterPro:IPR006785"
FT                   /db_xref="InterPro:IPR025655"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C8V903"
FT                   /protein_id="CBF76374.1"
FT                   /translation="MVREELISSAVTFLQDPSVASAPIEKRISFLQSKNLTKEEIDVAL
FT                   ARAGEDPSPAAAASSAASGYQSAPQQVVYRPPPSSPQGYGYPPYGQWQPPPEPPKRDWR
FT                   DWFIMATVMGGVSYGLYFVAKRYITPLIAPPTPPQLEQDKQHIDEQFNRAFALIEQLST
FT                   DTAALKTAEEARTEKLDATLRDVETLVADLKTASRRRDDETRRINDEVNALKDTIPKAL
FT                   EGAREGNENRLRELGTELKSLKTLLGNRLGGGASPSPVTPRAPDTTAPNTESTPSSTPP
FT                   ATNGTTPTASQPETPSGSAQAPSANSANPTNPLSRFSKSPSIPAWQLAAANRSKPASSS
FT                   TQASSENSGADQSSAPAS"
FT   gene            420742..422021
FT                   /locus_tag="ANIA_10620"
FT                   /old_locus_tag="AN10620.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(420742..421151,421239..421513,421555..422021)
FT                   /locus_tag="ANIA_10620"
FT                   /old_locus_tag="AN10620.4"
FT                   /note="transcript_id=CADANIAT00005428"
FT   CDS_pept        join(420742..421151,421239..421513,421555..422021)
FT                   /locus_tag="ANIA_10620"
FT                   /old_locus_tag="AN10620.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005428"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005428"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005428"
FT                   /db_xref="UniProtKB/TrEMBL:C8V904"
FT                   /protein_id="CBF76376.1"
FT                   /translation="MPPTESRRRSTSPSRTRSRSPTRSSNGHSRHRHHEGKDQDRGHDR
FT                   DRERRLRHRHSHSHSRSHSHRHDRDRRTEPRHRHETRVAISLPFQARELRKRDLETYEP
FT                   IFAMYLDIQKGKILEDLSEEEVKGRWKSFLGKWNRGELAEGWYDPATLEKARSANAVVP
FT                   GLGNSYKVVGEEIHQGIVPSPSGGTDELQRDDDDDEYGPMPQYGSTRERALGPSIPTMQ
FT                   DLELRKANRVLTPAETAMEEAIATRHDVRQQYRAEIRSHKSTLRHMEDEVAPRAEPGTH
FT                   ERRIEKRREAAASNRAFAESRRGGSPIDAAPDDELMGSGENDLEAYKAAKEREQRKKNE
FT                   REIRREEILRARAAEREERVRQYREKEEATIGWLKTLAKQRFG"
FT   gene            complement(422064..424690)
FT                   /locus_tag="ANIA_04967"
FT                   /old_locus_tag="AN4967.4"
FT                   /product="acid phosphatase, putative (AFU_orthologue;
FT                   AFUA_3G10220)"
FT   mRNA            complement(join(422064..423464,423596..423655,
FT                   423706..424601,424656..424690))
FT                   /locus_tag="ANIA_04967"
FT                   /old_locus_tag="AN4967.4"
FT                   /note="transcript_id=CADANIAT00005429"
FT   CDS_pept        complement(join(422159..423464,423596..423655,
FT                   423706..424601,424656..424667))
FT                   /locus_tag="ANIA_04967"
FT                   /old_locus_tag="AN4967.4"
FT                   /product="acid phosphatase, putative (AFU_orthologue;
FT                   AFUA_3G10220)"
FT                   /note="transcript_id=CADANIAT00005429"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005429"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005429"
FT                   /db_xref="GOA:Q5B3B3"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR004344"
FT                   /db_xref="InterPro:IPR027746"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3B3"
FT                   /protein_id="CBF76378.1"
FT                   /translation="MHILVVNDDGPPSNESSPYVHSFVHTLQSAGHTVSVVLPHQQRSW
FT                   IGKAHLIGAAVKPTYFRPGTLHKDDGTTHEYPRGDNDPDGDEWILINSTPASCVQIGLY
FT                   HYFQDRGPVDLVVSGPNYGRNTTALFAMSSGTIGAAMEGAACGKRSIALSYAFSSRNHD
FT                   PVIIAEASRHSVRVIEYLAKNWDEGVDLYSVNVPLEPGVSESKVMYTEMLDNRWSSGSC
FT                   FDAVDAEVPVENPEQREQTLRDQEEKLEEDPTANPNAKSGRKSRIAHKHFIWAPKFTDV
FT                   YRSVEESAPGNDGWTVKEGMTSVTPLKANFMHTPGIKGEIKLSDNEEPAFYSIVDCDDP
FT                   YVQELVEQALRFSMGSRCRSVSSISELPSRSTPVFQYREYERLDFEHAMTNPTTSLINA
FT                   YIIRKALIRKHYLANTVSNWVTKHPESVLAKHVKVSVDFELDYAEFLDDALLEAYELRE
FT                   CFEENESRPDSEKVWWILKPGMSDRGQGIRLFNSEDQLREIFEEWEPDSEDEEEDECGE
FT                   DDGNDETDKAATSGVVTSQLRHFIAQPYIDPPLLLPSLNNRKFHIRTYVLATGSLKVYV
FT                   FKEMLALFASKPYVSPTSQNNETEDSIADLTRHLTNTCFQDKSLPESETVRRFWCLPSI
FT                   PPPNTHLTATWKEDIYEQICAVTGELFTAAARGMMIHFQTMPNAFEVFGVDFLVDDTGN
FT                   VWLLEVNAFPDFGQTGEELRDVVVGGLFKGVIGVAVKGFFGEEGKTEENGMRLVAELDL
FT                   GRKN"
FT   gene            complement(424874..426217)
FT                   /locus_tag="ANIA_04966"
FT                   /old_locus_tag="AN4966.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(424874..425321,425373..425828,
FT                   425903..426087,426152..426217))
FT                   /locus_tag="ANIA_04966"
FT                   /old_locus_tag="AN4966.4"
FT                   /note="transcript_id=CADANIAT00005430"
FT   CDS_pept        complement(join(424874..425321,425373..425828,
FT                   425903..426087,426152..426217))
FT                   /locus_tag="ANIA_04966"
FT                   /old_locus_tag="AN4966.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005430"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005430"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005430"
FT                   /db_xref="GOA:Q5B3B4"
FT                   /db_xref="InterPro:IPR009617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3B4"
FT                   /protein_id="CBF76380.1"
FT                   /translation="MDSDNSSDEGVQTGPSFAAKATDTLLEPLRVLVSRNALTAYLSTF
FT                   MFFATAICMIFVSALAYGVFYYNFIPRVGLERIVHLQFGDGHPWGIAALESGLISSQAY
FT                   DVHVELELPRTPSNLATGNFMLDLTLLSQSSTSARTVGEITAPPISHSRRPAILTYASP
FT                   LVDISSKVSFMPLYVLGWKREAERLAVPMMERVEFSRGTHNVPDTLRLEIQSEEKMQFY
FT                   SAKVKFTASFTGLRWIMYHWRIPSFFVFSFMFWSVSMLSFSLCWILLACLSNKDVKTEE
FT                   EEEEEEGGVKEEEDSGTEPTIKEEQSEKLGLLDIESTAETSDRESETDSDDGVNHLYDV
FT                   GRKRRITTAESGPLEAAGSGTGTESAGPSGVQRRQSRLFKEEDS"
FT   gene            complement(426960..434057)
FT                   /locus_tag="ANIA_04965"
FT                   /old_locus_tag="AN4965.4"
FT                   /product="Ccr4-Not transcription complex subunit (NOT1),
FT                   putative (AFU_orthologue; AFUA_3G10240)"
FT   mRNA            complement(join(426960..426965,427000..432911,
FT                   432968..433292,433347..434057))
FT                   /locus_tag="ANIA_04965"
FT                   /old_locus_tag="AN4965.4"
FT                   /note="transcript_id=CADANIAT00005431"
FT   CDS_pept        complement(join(426960..426965,427000..432911,
FT                   432968..433292,433347..434057))
FT                   /locus_tag="ANIA_04965"
FT                   /old_locus_tag="AN4965.4"
FT                   /product="Ccr4-Not transcription complex subunit (NOT1),
FT                   putative (AFU_orthologue; AFUA_3G10240)"
FT                   /note="transcript_id=CADANIAT00005431"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005431"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005431"
FT                   /db_xref="GOA:Q5B3B5"
FT                   /db_xref="InterPro:IPR007196"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR024557"
FT                   /db_xref="InterPro:IPR032191"
FT                   /db_xref="InterPro:IPR032193"
FT                   /db_xref="InterPro:IPR032194"
FT                   /db_xref="InterPro:IPR038535"
FT                   /db_xref="InterPro:IPR040398"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3B5"
FT                   /protein_id="CBF76382.1"
FT                   /translation="MTFPPPPPSSQSSIASGTDKSSSTRPTRSQQSPWGPPVSQSSVRR
FT                   GLTPLATNLSNPSVSGRGQPQSNSPGPGVSTSSPLTSSFSAVLSSSRGHPLGRGVPSPA
FT                   STPGPFASYQSGSQQPQSLPSQSLSSPKIRAHTPSSGSHLASAAGSVAGGGGSGGGGGG
FT                   TGSSRGATFSPLLSGTTVNSPTGFPPDKPGSVAAHGSQSSLAKISIAQVFLLLDSITEK
FT                   EGREKWETKAAQIHKLVESNGMEVFSKYFRRLLTGNAPQIFPGLNKSVENAGNYPLLVQ
FT                   EMQKVSQDIEQAQKIAETVDASEGDIFRDFDLSTFLDHFKLDPIVKVSLALTFKTANKS
FT                   DLRVKADAILANSITPFLQSLASPSDASKDFNNSFIGITIERFILYPPRNFTDDVKSKL
FT                   LYAASLRYQALGVDMPFEVASALQMFNFVNPKYALVRQLHSRGPRATSSSDAVNDTVSA
FT                   AGPEFWSEEHIASALLFLVLSQYWREYSLETFLAAVRFHYGGKQINWSLIFRHFDREGL
FT                   RLDARQFAKLYAALSPIAAEDSTLDVQQLWGGEWEHRDTQMSFLTAFINSRTDASQIPN
FT                   LRATFPHDFFSDGPEPVRLQGERAAKSPLRSLDATRAIFDLALYSQAAWAAAESQMLIK
FT                   AVVQYDLPVFLCSALALPQPWTSVQQSFLLRTLAVFIMKQEEGYQLALHGAWRQDKQWV
FT                   ADQLFAMFTQDPTSTAAIYEHAIEYNWLEYLLGYTNGLAMDLACYAHRKGPFELEQWVR
FT                   NAASKGLMDMGTLLSKYLRIKADDELRVQRREQLAPQMVSLSVKTVFTLLSVLEEYVGD
FT                   PQNLTPVQRICIQTYPRLINYGEGFDDIIDANGESGNALPEPVDKKMQELFGKMYHEEL
FT                   SLREILELMRQYKSSRDPAEQDLFACMVHGLIDEYHCYHEYPLEALTKTAVMFGGIINF
FT                   RLVDGITLKVGLGMILEAVREHDIHDPMYKFGVEAIEQLINRLPEWVGFCHLLLQIPSL
FT                   QGSPIFQKAEEVLREQGSQVRDENGRQDNTTGGSITNGNVDESAAPDGANRKFVSIHVD
FT                   PPLRPEIYQDPDEEVQDKILFVLNNVSEQNIDEKLRDLTDVLKDPHHQWFASYLVEERA
FT                   KLQPNFQQLYLDLLDRIDDKILWVEVLRETYASTSKLLNSEATLGSSTERGHLKNLGSW
FT                   LGSLTIAKDKPIKHKHIWFKGLLLEAYDSQRLTIVIPFTCKVLVQATKSTVFKPPNPWL
FT                   MDIIALLMELYHFAELKLNLKFEIEVLCKDLEIDHKAIEPSVIIRDRSTTIEESLSTAN
FT                   IPEGLEAFEDMALTSISQSIRNERLSPAAILSTLPSLDKILVLPPSASSMVDSNVLRQI
FT                   VHSAVERAIAEIITPVVERSVTIASISTVQLVSKDFAMELDEEKFRHAAANMVRQLAGS
FT                   LALVTCKEPLKVSMTNYIRMIQQEYSDQPMPEGLILMCVNDNLDAACGIVEKAAEEKSL
FT                   PEIEKVIESQLEARRRHRAARPSEPFIDPSMTRWGLFIPEPYRQTPGGLNKEQLAIYEE
FT                   FARQARGPGTTHAQNVSTDSGRQLPDVLQEPYPPIPNLSTPAEQPAVPHRTPQPQQDTR
FT                   LQQSALVGTSSQLNGFLETQNPRDRVESLVSDLQQAARNATEEHVKDLGRDSAVLQEYN
FT                   QALRSIVASPNGEEVARLTALKACTSLYSQTKSTLEIEVLVHLLAKLCDMSALVARYTW
FT                   TVLAEVDDEHMFNVPVTVALIDAGLLDIRRVDMILSRLILQKNAAALDVLAELMDQILF
FT                   NEEPSALRSDFSGSLEAMSKWLAEDSGLARAKEIIKKLRDSGIPEVVNPLLSDKARSKR
FT                   DQMEYIFTEWIGIYKAPGAVDRTYYAFLKDMHQRQVMANQEDSALFFRLSIDISVARFE
FT                   HESQNPSGSLDEAFLYIDALAKLVVLLVKFQGEGTGPVKTSKSAYFNSILSVLLLVLNH
FT                   HQVMRGEAFNQRVFFRLFSSILCEYSMSGLQHSDQHQEMMFTLANKLLSLQPKYYPSFV
FT                   YGWFSLVSHRFFMSSMLNMPDRAGWGPYCEIMQVQLSYIGEQLKSTTMTLVTMDLYRGM
FT                   LRILLILHHDFPEFVAENHFQFCNVIPAHCAQLRNLVLSAYPSSFQKLPDPFREGLKVE
FT                   RLEEMREAPRIAGDTAGPLLRAGIKNVIDNALQSNNVSDSVIQQIRDAVYDTESKESGL
FT                   FHAPININLLLVNALALYVGQGAVSVNESKGNTRAAFESSAHSALLEKLAKILRPEARY
FT                   YLLSAMANQLRYPNSHTYFFSFAILRLFGTDYTEQDESDIRQQIIRVLLERLIVHRPHP
FT                   WGLIITLQELLQNSSYAFFHLPFIQAAPEL"
FT   gene            complement(435007..436058)
FT                   /locus_tag="ANIA_04964"
FT                   /old_locus_tag="AN4964.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(435007..435966,436014..436058))
FT                   /locus_tag="ANIA_04964"
FT                   /old_locus_tag="AN4964.4"
FT                   /note="transcript_id=CADANIAT00005432"
FT   CDS_pept        complement(join(435007..435966,436014..436058))
FT                   /locus_tag="ANIA_04964"
FT                   /old_locus_tag="AN4964.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005432"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005432"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005432"
FT                   /db_xref="GOA:Q5B3B6"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3B6"
FT                   /protein_id="CBF76384.1"
FT                   /translation="MSASEAPASSLRYADVAVTFTADQFKGIYRGGKAYHEPDIAEVIQ
FT                   RAKEYGCEKIMLTTMSLPLAHENLALVRQFPETCTMTLGVHPYHAKEIYVSEASGAGGR
FT                   TTADGARYLQELRNFARTILAEQGVAGESPLVAFGEIGLDYEYITRSDKATQQRAFRDQ
FT                   LAIAVELQLPLFLHVRESCADFISIIKPFLADLPRRGLVHSFAGTKEEMIQLTALGFDI
FT                   SVNGICFRTEEQLEMVRSIPLDKLQLETDAPWCEIQEGDDRIKQYLEGARSLPGSRKHG
FT                   KFRLGEMVKGRNESCTIERVAMVVAGLKGIEVAEVATAAWENSVRMFGLGVKS"
FT   gene            437007..440542
FT                   /locus_tag="ANIA_04963"
FT                   /old_locus_tag="AN4963.4"
FT                   /product="cell division control protein (Cdc15), putative
FT                   (AFU_orthologue; AFUA_3G10250)"
FT   mRNA            join(437007..437049,437104..437208,437265..437551,
FT                   437621..437812,437865..437963,438023..440300,
FT                   440373..440542)
FT                   /locus_tag="ANIA_04963"
FT                   /old_locus_tag="AN4963.4"
FT                   /note="transcript_id=CADANIAT00005433"
FT   CDS_pept        join(437007..437049,437104..437208,437265..437551,
FT                   437621..437812,437865..437963,438023..440300,
FT                   440373..440542)
FT                   /locus_tag="ANIA_04963"
FT                   /old_locus_tag="AN4963.4"
FT                   /product="cell division control protein (Cdc15), putative
FT                   (AFU_orthologue; AFUA_3G10250)"
FT                   /note="transcript_id=CADANIAT00005433"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005433"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005433"
FT                   /db_xref="GOA:Q5B3B7"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR031160"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3B7"
FT                   /protein_id="CBF76386.1"
FT                   /translation="MPGTVSEGPTVALSFANNFWGKDDAGVAPMLERMQAAKLSCDELK
FT                   TWYNIRAAIEDEYARKLLTLCRKPLGAHETGSLRESFDTVRAETEAIAKAHAAIAGQMK
FT                   RELEEPLIAFAGGNKERRKIIQNGIERIHKTKMQQTHTVNKDCLRIKGYLAQGHMVMGQ
FT                   EERKNKAKLEKTQIQLASSSSEYDAAVKVLADTTERWNKEWKAACDKFQDLEEERIDFT
FT                   KSSLWTYANIASTVCVSDDASCERIRLSLENCEVEKDIIHFIKERGTGQEIPAAPKFIN
FT                   FSRGDVNDASSDVSEEEGYSVAQFQRTINPAFRSSSPQPSTYESHHEAPPVDLAQNGPS
FT                   TPSSREPTVPLQKPTQPPMQPPTQAPMQAPMQSPIQQQPPPLDFRRGGHLPPNYDPNQH
FT                   GEISAVPHNAYPTDGMTMFCRTGPPSERSSGTTSGYRPSSQDSHSEVSNATSISSQEPP
FT                   SARQSPTKPINGVALPGIGSGEVQPAQKKKFFSNSPFRRKSRHDKDRNSGPSQLPSRRT
FT                   WDSPSKQTTPIKAPTPQKPQQPQPPITKAADDIARSASPEPVDPRANFQLNVGNNVFDV
FT                   ASPDKPKPTNGAEPANDGEDTDPIARALADLKVAGKQSATRVSADRYHGIATPVPSAPA
FT                   SNFTANSVATPPPAYNDASVKRLDAPQPAFTSKQMQKTTQQYTGKTHNMLRGKANPVSV
FT                   SSRSPRQSQEATRAPSPAAPRRSVSPQPQPQQQPATRGESRMSQYSRAASPNTSQYQSS
FT                   SVKSRHSQSPSVSTPPQRPSDSPYSPHDFAKRSSASAAPSPTTTTAPRAPSPKEFAKRS
FT                   SQSSASRAASPQPQFKQQASVPRAVSPQPQYRQQASAPRAVSPQPQYRQQASAPRAVSP
FT                   QPQYRQQASAPRAVSPQPQYRQQTSIPRAVSPNDFAKRPSQNSMPRAVSPQPQFRQQAR
FT                   PSSAGGMELQLSQPDMYGSSGDGYASPQRESRRPMSYYDGGSQRSRSRSRSMAVADPGR
FT                   QFSRDGRPILHFARALYSYTAAIPEELGFQKGDVLSVIRLQDDGWWEAEVTTTRLRTGL
FT                   VPSNYLQII"
FT   gene            complement(441298..443111)
FT                   /locus_tag="ANIA_04962"
FT                   /old_locus_tag="AN4962.4"
FT                   /product="UPF0132 domain protein (AFU_orthologue;
FT                   AFUA_3G10255)"
FT   mRNA            complement(join(441298..441870,442651..442693,
FT                   442744..443111))
FT                   /locus_tag="ANIA_04962"
FT                   /old_locus_tag="AN4962.4"
FT                   /note="transcript_id=CADANIAT00005434"
FT   CDS_pept        complement(join(441298..441870,442651..442693,
FT                   442744..443111))
FT                   /locus_tag="ANIA_04962"
FT                   /old_locus_tag="AN4962.4"
FT                   /product="UPF0132 domain protein (AFU_orthologue;
FT                   AFUA_3G10255)"
FT                   /note="transcript_id=CADANIAT00005434"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005434"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005434"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3B8"
FT                   /protein_id="CBF76388.1"
FT                   /translation="MNFAPYQDESPEVERAFSPSLENRSKSPVVRSPLHSPSIPGFTSA
FT                   GGLPSPSQFASSGHIDTSGHGNTGYGRGDVESGRWNLGAFETSLPIRMDVEAMLAYLLL
FT                   PPAGGVFLLLLEHKSDYVRFHAWQSSMLFTVMFTCPTPSKTDSVLSPKEQSHIYSAPSC
FT                   LANTHPPWRESQTREAKMCQVQRVTNSCGHINDHVLMSCYLAKDVTPSPPPSHLSFTIT
FT                   NFQESYNSASATFAIYTSQRERQLQSEDKDQGKDESSSIWSGKSRTSGSLSQGPNSNKN
FT                   KKDEEDMIQRFGFEARNQPYCKLTVPKVLNSPEGFKCMVYACGRAD"
FT   gene            complement(443344..444157)
FT                   /locus_tag="ANIA_04961"
FT                   /old_locus_tag="AN4961.4"
FT                   /product="DASH complex subunit Duo1, putative
FT                   (AFU_orthologue; AFUA_3G10260)"
FT   mRNA            complement(join(443344..443811,443864..444157))
FT                   /locus_tag="ANIA_04961"
FT                   /old_locus_tag="AN4961.4"
FT                   /note="transcript_id=CADANIAT00005435"
FT   CDS_pept        complement(join(443344..443811,443864..444157))
FT                   /locus_tag="ANIA_04961"
FT                   /old_locus_tag="AN4961.4"
FT                   /product="DASH complex subunit Duo1, putative
FT                   (AFU_orthologue; AFUA_3G10260)"
FT                   /note="transcript_id=CADANIAT00005435"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005435"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005435"
FT                   /db_xref="GOA:Q5B3B9"
FT                   /db_xref="InterPro:IPR013960"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3B9"
FT                   /protein_id="CBF76390.1"
FT                   /translation="MAPYSTAEEMDRLQLSDSDSDELWDSPSKRGKKKLNQAAVKQENS
FT                   PPPADTDRDEETLFDRQEAREAALRNELRIVRNVNQVIEGLLGSLDKAKGNMETVSRTV
FT                   NSASTLLNTWTRILSQTEHNQRVILNPSWQGASQDMADLENEELLRQQAAERRERELQQ
FT                   QREAAARKAEEDERKRAQSTSTRGTRIVSRGRVIRSGIGRSPSVSHSKTSTSGTRTTSK
FT                   TSGTNPSTTTTRRPVSGIARGPGVTRGRGRQ"
FT   gene            444454..446067
FT                   /locus_tag="ANIA_04960"
FT                   /old_locus_tag="AN4960.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(444454..445426,445479..446067)
FT                   /locus_tag="ANIA_04960"
FT                   /old_locus_tag="AN4960.4"
FT                   /note="transcript_id=CADANIAT00005436"
FT   CDS_pept        join(444711..445426,445479..446067)
FT                   /locus_tag="ANIA_04960"
FT                   /old_locus_tag="AN4960.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005436"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005436"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005436"
FT                   /db_xref="GOA:Q5B3C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3C0"
FT                   /protein_id="CBF76392.1"
FT                   /translation="MATTPPPASFLRIPPTPRHGNGYDQYEPYSTRQSARLATQKASAE
FT                   SRTTPPPSFPISKGRGTSRSTKKQKTTETESLSPPGSPMSPRKTMLGRRVATQIDDEDP
FT                   FNDAKLAHSHRSRLFRTTMTEGMLPTPAKTPRKKPVDNAGSTARVLFPQPGQKKKKKQT
FT                   GFSLDSFSDDPSQGDSIQIYTDSRDRIPEVDESEENPFYQKPSTNTKPRPSRPMTRSRD
FT                   KEVNEALKREDGMVYVFRGKKMFRKFSDDVFGSDDEDDDDDLGLLASRPDLLDSGILEN
FT                   ARPLTRSSIKPRVLFPSAREHVAGENNEEEEAATDIEDQFLDHTEAADDLDLIANVHPE
FT                   QRLDTPPPKSDVSTPPSPGVSVRSLRSRSKRELGARQTPTASDPTKKPSPFDGWLRKKQ
FT                   TPPVIAAKTKKRDAESAGGPAPKKTRGNRAIISPS"
FT   gene            complement(447035..449452)
FT                   /locus_tag="ANIA_04959"
FT                   /old_locus_tag="AN4959.4"
FT                   /product="DNA replication protein, putative
FT                   (AFU_orthologue; AFUA_3G10280)"
FT   mRNA            complement(447035..449452)
FT                   /locus_tag="ANIA_04959"
FT                   /old_locus_tag="AN4959.4"
FT                   /note="transcript_id=CADANIAT00005437"
FT   CDS_pept        complement(447035..449452)
FT                   /locus_tag="ANIA_04959"
FT                   /old_locus_tag="AN4959.4"
FT                   /product="DNA replication protein, putative
FT                   (AFU_orthologue; AFUA_3G10280)"
FT                   /note="transcript_id=CADANIAT00005437"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005437"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005437"
FT                   /db_xref="GOA:Q5B3C1"
FT                   /db_xref="InterPro:IPR015408"
FT                   /db_xref="InterPro:IPR040184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3C1"
FT                   /protein_id="CBF76394.1"
FT                   /translation="MRRNRTLLASPLKNSATTPNSRTKATQLLSDGLGEDEGDDTEEDE
FT                   ETLQLKLAAIQARLKLKQLQKNRGKAGTPHAERQQGADALSRPASSVSFSSFTQNQAPK
FT                   SKFLQETKNQDGSGDIQVPLSPTRRSRPQLEPTSPGRYRLGIDKGLKGSDVSLRRPPSS
FT                   RGVETRPTSRLGSRDGPISHLRDTLAPQSHSFEDRRPKSFSERMAEGRAAEKARRERDV
FT                   KVEQIRAKRSSAFEYDKAEMEALKAAAAERRPNSPSKPTTRSGRTDSFSRDDIMRSINN
FT                   IKPSLKRSQTTPSLRRTEETETKSFLQRRSQKPEAQSFPPQPGSSRTNSFTDEASNEAE
FT                   RVLEKPPDASKYEPFSQLHLSNRILPHSFMDRTLKDKKVLRIPDLLRIIKGPPFELPED
FT                   IDTDYVVFGIVASKSDTKQVKEAKSVTAQAADPFDDGLNNRNQYMAITLTDLKWTIDLF
FT                   LFDTAFPRYYRLSEGTLIAILNPTILPPPKGKLDTNRFSLSISSSDDTILEVGSARDIG
FT                   YCKAVRKDGKICQVWVDGRKTEFCDFHVDLQLRRAQADRMGVNNGTGLFGPGGRSGYRT
FT                   GFYGGQKRSTQKGSGEGLLRADGAHYDHGTQSLYYVAPSLKPNNTNKSLFHHLHPGQSA
FT                   ASLIDADVDDPFLAAGMMGRGAENKGERFRRRLVEKQKEKEITQMITSTRAGGVAGEYL
FT                   RAQNNENTRITDSTRSGAQHGRTDSRDLKPQLSSLAGDKPLGMNFRRAEAVRLSPKKRA
FT                   HDGDRPYGSGVKKTRFITSKGIKEAGRDSLGGVSNATPRTDDYDDDDELEIV"
FT   gene            450088..451347
FT                   /locus_tag="ANIA_04958"
FT                   /old_locus_tag="AN4958.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            450088..451347
FT                   /locus_tag="ANIA_04958"
FT                   /old_locus_tag="AN4958.4"
FT                   /note="transcript_id=CADANIAT00005438"
FT   CDS_pept        450088..451347
FT                   /locus_tag="ANIA_04958"
FT                   /old_locus_tag="AN4958.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005438"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005438"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005438"
FT                   /db_xref="GOA:Q5B3C2"
FT                   /db_xref="InterPro:IPR019024"
FT                   /db_xref="InterPro:IPR040456"
FT                   /db_xref="InterPro:IPR041195"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3C2"
FT                   /protein_id="CBF76396.1"
FT                   /translation="MRTRSAPPPKQSASEKQAQPEPSKATMKPSKAFILPTSASSDARF
FT                   VTLPNPRTGDLTRYFFCPKLGVYEFTVVASQSPRSILYTSKSVSGKPQGSISKTAELLV
FT                   ATPIDILFFAIPLLCSVSSSNEGKRLFQPLDDIIDSHDDLPEHLRYILYNDTFRSTLLR
FT                   RVEAVCDSVEAGDERVFRVSETKLLQELLAKAERMAVQGLPKSLEERFVKQALAVPLVS
FT                   VTRTDVATSSAPAKEDHNGIESQESNDTQSTSATTSNSSVSRTSTPAESAPTPATEELP
FT                   EQQACPDSIVRLQRLSVALAFLKTSYISAAVCAKIDELLSAPASPIDFKPLHDYLKHLA
FT                   DLRAEALASRSLGDFSRKRNVEDDDVVESRAEKKRRTEEEEKKKKASESRGVRELKKVN
FT                   TSGMKKMSDFFGKAAPKKKS"
FT   gene            complement(451795..453470)
FT                   /locus_tag="ANIA_04957"
FT                   /old_locus_tag="AN4957.4"
FT                   /product="galactokinase (AFU_orthologue; AFUA_3G10300)"
FT   mRNA            complement(join(451795..451831,451887..452768,
FT                   452815..453470))
FT                   /locus_tag="ANIA_04957"
FT                   /old_locus_tag="AN4957.4"
FT                   /note="transcript_id=CADANIAT00005439"
FT   CDS_pept        complement(join(451795..451831,451887..452768,
FT                   452815..453470))
FT                   /locus_tag="ANIA_04957"
FT                   /old_locus_tag="AN4957.4"
FT                   /product="galactokinase (AFU_orthologue; AFUA_3G10300)"
FT                   /note="transcript_id=CADANIAT00005439"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005439"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005439"
FT                   /db_xref="GOA:Q5B3C3"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3C3"
FT                   /protein_id="CBF76398.1"
FT                   /translation="MATPQELVPRTESIAEVYATDNASATTASPEHVKRFNNLVSHFHK
FT                   QYNHSPDFVARSPGRVNIIGEHIDYNLYDVLPTAVSVDVIIAVKVVPTESSESAVKIAN
FT                   VLPDKFPTREFSVPKDSDVEIDPKKHEWVNYFKAGLVGALKVLRKGAADGSFAPASMEV
FT                   LVDGNVPPGGGISSSAAFVCSSALAVMKANNHDVSKQDLLDLAVVSERAVGVYSGGMDQ
FT                   AASIFSRRGYLLYTQFFPNFSVQHVAIPKAAEEITFLMAQSFVTSNKAETAPRHYNLRV
FT                   AECTLASVVLAKANGLTLPKDNSSLGYSLRTFHNELMRKEGRLGDPLEYQIDSVIQATL
FT                   DILTQEQGYTREEIAQLLSISVPELETTYLSSFPVQAERFLLRQRALHCFKEARRVLDF
FT                   KACLANASTLDDKRIHYLGQLLNESQDSCRDVYECSAPQVDEICNIARKAGTWGSRLTG
FT                   AGWGGCTVHMLPQSKVEAVTKALTEEYYLKYFPDISEEKLKEAMVISKPSNGSFLITGA
FT                   AISQVDV"
FT   gene            454466..456826
FT                   /locus_tag="ANIA_04956"
FT                   /old_locus_tag="AN4956.4"
FT                   /product="hypothetical acetolactate synthase, large
FT                   subunit, biosynthetic (Eurofung)"
FT   mRNA            join(454466..454682,454749..454847,454910..454977,
FT                   455031..456716,456771..456826)
FT                   /locus_tag="ANIA_04956"
FT                   /old_locus_tag="AN4956.4"
FT                   /note="transcript_id=CADANIAT00005440"
FT   CDS_pept        join(454528..454682,454749..454847,454910..454977,
FT                   455031..456716,456771..456826)
FT                   /locus_tag="ANIA_04956"
FT                   /old_locus_tag="AN4956.4"
FT                   /product="hypothetical acetolactate synthase, large
FT                   subunit, biosynthetic (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005440"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005440"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005440"
FT                   /db_xref="GOA:C8V916"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:C8V916"
FT                   /protein_id="CBF76400.1"
FT                   /translation="MMPLRPSKSALRTLHYQRYIASGRRAFASAVSTPHRFSTQKRDQS
FT                   TATATASTSRPRPSPAFNQEPSRNEVSPLQNRQLPELDDSFVGLSGGEIFHEMMLRLGV
FT                   KHVFGYPGGAILPVFDAIYNSKHFDFILPRHEQGAGHMAEGYARASGKPGVVLVTSGPG
FT                   ATNVITPMQDAFSDGTPMVVFCGQVVTTSIGTDSFQEADVVGISRACTKWNVMVKSVAE
FT                   LPRRIQEAFEIATSGRPGPVLVDLPKDITAGILRKPIPMQSTLPSRPSAATLAAKELSE
FT                   KQLHSTINRVARLVNVAKKPVLYVGQGILENPDGPKLLKELADKACIPVTTTLQGLGGF
FT                   DELDPKSLHMLGMHGSAYANLAMQEADLIIALGARFDDRVTGSIAKFAPQAKLAASENR
FT                   GGIVHFEIMPKNINKVVQANEAVEGDCAENIRHLLPLVEPVSERPEWFAQINDWKTRFP
FT                   LSLYEKQTPDGPIKPQALIEKLSDLTAHMKDRTIITTGVGQHQMWAAQHFRWRRPRSMI
FT                   TSGGLGTMGYGLPAAIGAKVARPDCLVIDIDGDASFNMTLTELTTAAQFNIGIKVLLLN
FT                   NEEQGMVTQWQNLFYEDRYSHTHQKNPDFVRLAEAMGVAAERCTKPSEVESKLKWLIES
FT                   DGPALLEVFTDRKVPVLPMVPGGSGLHEFLVFDEAKDRERRALMKKRNPNGV"
FT   gene            457754..459187
FT                   /locus_tag="ANIA_04955"
FT                   /old_locus_tag="AN4955.4"
FT                   /product="RING finger domain protein (AFU_orthologue;
FT                   AFUA_3G10320)"
FT   mRNA            join(457754..458161,458240..459187)
FT                   /locus_tag="ANIA_04955"
FT                   /old_locus_tag="AN4955.4"
FT                   /note="transcript_id=CADANIAT00005441"
FT   CDS_pept        join(457754..458161,458240..459187)
FT                   /locus_tag="ANIA_04955"
FT                   /old_locus_tag="AN4955.4"
FT                   /product="RING finger domain protein (AFU_orthologue;
FT                   AFUA_3G10320)"
FT                   /note="transcript_id=CADANIAT00005441"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005441"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005441"
FT                   /db_xref="GOA:Q5B3C5"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3C5"
FT                   /protein_id="CBF76402.1"
FT                   /translation="MASLPSFSAFGRTRSSDTSPPAASSSQPDQHHNYQEPANELSKED
FT                   EAVLLNESISEEIERPDAKITTRPANTLSVPDEPRKCWICYTDETEDTPLNSEWRSPCP
FT                   CALTAHEACLLDWLADLENPRARKRTGHSAKMRLAGRLVLPGMVFTLAGTVWAGCCAHG
FT                   VYSMYFVFGTDEAKQILEEAAEGTWNSGLNMGLPLIPLVLIFSRTRYAEGLLPAIPVLF
FT                   FATHSPGQEPDLDLWPPSAAVTFAALPYIKSFYGALYERLFGKWERKWIAEVQPRQADV
FT                   NEFDDNAPEPEQGPVAADDGQILMEFDLEFQVGMGNNADQQEVLGLQGANQQQQQQNNQ
FT                   NQGGAINGQNLVHETSSLADIVLGALAFPAISATMGGLLKYVLPKSWTTASTLERGRPG
FT                   LLQTRWGRSVIGGCVFVLLKDALVLYCRWKLAQTHRRRKVLNYDRLKKRVTR"
FT   gene            459502..460211
FT                   /locus_tag="ANIA_04954"
FT                   /old_locus_tag="AN4954.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(459502..459778,459862..460211)
FT                   /locus_tag="ANIA_04954"
FT                   /old_locus_tag="AN4954.4"
FT                   /note="transcript_id=CADANIAT00005442"
FT   CDS_pept        join(459571..459778,459862..460211)
FT                   /locus_tag="ANIA_04954"
FT                   /old_locus_tag="AN4954.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005442"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005442"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005442"
FT                   /db_xref="GOA:Q5B3C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3C6"
FT                   /protein_id="CBF76404.1"
FT                   /translation="MRPSVSPVLASLANVFRIPLSQSTLRPTIPFLNKQTSTQPSTLQA
FT                   QAKAPFSTTTPLLKRKTQYTDRRVTLIRYFLYHPLTPRPLRFSRTRFLRHWTIHRAWQL
FT                   YQAQRRRNHQLELQRQWQAMNAACEELRTGAGDGGKLFRKSMIKTRIFQDMFPIEYGRL
FT                   QTEGPGEGWNHAWKRPEGTTKR"
FT   gene            complement(460297..461928)
FT                   /locus_tag="ANIA_04953"
FT                   /old_locus_tag="AN4953.4"
FT                   /product="hypothetical protein similar to Rho GTPases
FT                   (Eurofung)"
FT   mRNA            complement(join(460297..461015,461080..461271,
FT                   461328..461333,461388..461466,461549..461928))
FT                   /locus_tag="ANIA_04953"
FT                   /old_locus_tag="AN4953.4"
FT                   /note="transcript_id=CADANIAT00005443"
FT   CDS_pept        complement(join(460728..461015,461080..461271,
FT                   461328..461333,461388..461466,461549..461583))
FT                   /locus_tag="ANIA_04953"
FT                   /old_locus_tag="AN4953.4"
FT                   /product="hypothetical protein similar to Rho GTPases
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005443"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005443"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005443"
FT                   /db_xref="GOA:C8V919"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR017231"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8V919"
FT                   /protein_id="CBF76406.1"
FT                   /translation="MAQQQDDNVMRRKLVIIGDGACGKTSLLSVFTLGYFPTHYVPTVF
FT                   ESYVTDCRVDGRSVQLALWDTAGQEDYERLRPLAYSKAHVILIGFAVDTPDSLENVKIK
FT                   WIEEANERCPGVPIILVGLKKDLRENPGAIEEMRKKSLRFVSPKEGSETATQIKARKYL
FT                   ECSSLTGEGVDDVFEAATRAALLTFDKRKSSCCIVL"
FT   gene            463199..466832
FT                   /locus_tag="ANIA_04952"
FT                   /old_locus_tag="AN4952.4"
FT                   /product="Stress response protein nst1
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B3C8]"
FT   mRNA            join(463199..464246,464336..464565,464617..466132,
FT                   466182..466295,466363..466832)
FT                   /locus_tag="ANIA_04952"
FT                   /old_locus_tag="AN4952.4"
FT                   /note="transcript_id=CADANIAT00005444"
FT   CDS_pept        join(463199..464246,464336..464565,464617..466132,
FT                   466182..466295,466363..466832)
FT                   /locus_tag="ANIA_04952"
FT                   /old_locus_tag="AN4952.4"
FT                   /product="Stress response protein nst1
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B3C8]"
FT                   /note="transcript_id=CADANIAT00005444"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005444"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005444"
FT                   /db_xref="GOA:Q5B3C8"
FT                   /db_xref="InterPro:IPR025279"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3C8"
FT                   /protein_id="CBF76408.1"
FT                   /translation="MSSHVPAVTAPTPSTVSENSASKDSHSSPMPESKPVSVNRKKQKR
FT                   REKAARLAAQRQAANGHAPSDTLDVNGSSSTVLDNDVSHEQSGGGYDDKSEKVLNGHGH
FT                   NTQELPHPSEHDPQGTTSRKSKKKRGKKGRNGSQASSTPMSTPSISLSNAPRPPLSSHF
FT                   GSQSSSKLLKERSIWNTSTQEERENIKTFWLELGEEERRQLVKVEKDAVLKKMKEQQKH
FT                   SCSCTVCGRKRTAIEEELEVLYDAYYDELEQYANNTQGSFERGPAILPPPGLYQPPLRS
FT                   PGQHTHTHGQFHPSRGRIHEPEDDEDLEEDYDEDEEDDEPYSDEEYEDDEGSAARADFF
FT                   AFGNSLTVKVADDLLKNDGKHFIDMMEQLAERRMQREEDTQYGIAAAHQSLHSSHNHGP
FT                   LDDEDYDDEEDEDYDSQEEEEYEEDEMDAMTEEQRMEEGRRMFQIFAARMFEQRVLTAY
FT                   REKVAEQRQQKLIEELLEEENLNEQRNAKKAREAQKRKDKKRLAKLAKDEEKARREAQK
FT                   AAEEAAAKAEQERKLEEQRKKKEEQRKKREAERKAQEEERARKEAEKHKRLREERERQE
FT                   EAERRQREQKEQEKKRREEAKRKEREERELREQKAKQERERKAQDEQSRRERERVAQEQ
FT                   AKRAPNLQPVSPVSPPPESATPVVSKAPTPAKGRRPSQQGSHSSSPRSQSASAEASQVS
FT                   PRSAPLSQSSGSSIPKYGSGHPILHPHPGAPMSPLGRTHPPGLSPSNPPGLSGLVPRPP
FT                   MGHELPTYPPHSSPYMNQLRGFPAPNGIPVLPGMNGTRPMPPGRGFPLDAPGIPFHAQP
FT                   PFSGIFSPQPSGLPHGHSRQPSNSFERSPLDTSAQPFPISRPSPIKRPPSTQQEQRNSR
FT                   RDVDDLSAQLGSSALLDDSDVPLTSSQLSQSLPGTTPAPVMPGPARASFAGSSLFPDPL
FT                   SVAKHANFPVSPVIGGSTWGAQMPFGAPFPGGPTWGYTPANNNAFGAGIHHRAHTSRPV
FT                   AIRLLVIQACKQLSTMSPSKDSGGYHDVNAVLRQVEQLRPSNEPSISLKEMLDICDTEG
FT                   NAQNGGGTFSIKSGQTGELVKFEPDAVSTTTGHRGSIVPGEIGSPIPSSTMPALGGIGL
FT                   GTPPSSALRQFSSPTTGF"
FT   gene            complement(468051..471359)
FT                   /locus_tag="ANIA_04951"
FT                   /old_locus_tag="AN4951.4"
FT                   /product="vacuolar sorting protein 35 (AFU_orthologue;
FT                   AFUA_3G10360)"
FT   mRNA            complement(join(468051..468634,468688..469236,
FT                   469285..470243,470296..470933,471037..471359))
FT                   /locus_tag="ANIA_04951"
FT                   /old_locus_tag="AN4951.4"
FT                   /note="transcript_id=CADANIAT00005445"
FT   CDS_pept        complement(join(468317..468634,468688..469236,
FT                   469285..470243,470296..470933,471037..471173))
FT                   /locus_tag="ANIA_04951"
FT                   /old_locus_tag="AN4951.4"
FT                   /product="vacuolar sorting protein 35 (AFU_orthologue;
FT                   AFUA_3G10360)"
FT                   /note="transcript_id=CADANIAT00005445"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005445"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005445"
FT                   /db_xref="GOA:Q5B3C9"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR042491"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3C9"
FT                   /protein_id="CBF76410.1"
FT                   /translation="MATSVAPSEDQSRLLEEALGVVRQQSSMMRKCLETPGKLMDALKC
FT                   GSTLVSELRTPSLGPKQYYELYMAVFDALRHLSVYLKENHPVNHLADLYELVQYAGNIV
FT                   PRLYLMITVGTVYMSVEDAPVKEIMKDMMEMSRGVQHPIRGLFLRYYLSGQARDYLPTG
FT                   TGNGPEGNIQDSINFVLTNFVEMNKLWVRLQHQGPSREREKRMQERRELELLVGSNVVR
FT                   LSQLVDLDTYKSGILQALLEQVVQCRDVLAQEYLLEVITKVFPDEFHLHTLDLLLSAIA
FT                   RLNPHVDLKKIVIGLMDRLSSYAAREAETSMNAETRKQKEEEAVTKLLENLKVSEASQE
FT                   KPKEDATPTQENGVEQTPTESEEQTKPADEVTANGRDEDQKPTSPQDIKLYDIFYEQVV
FT                   SLIKSRGLPIQDTMALLVSLVNLALNTYPERLEYVDQILQFATKETAEYTDHADLHAAP
FT                   TQQNLLHLLIAPLRSYVSVFTALALPHYLPLLSSQSYPTRRSVAGEIARTLLKDRTLIT
FT                   TTENLDRVLQALRVLIKEGVQQGGYPGSQRRGESDETIEEQGWLARLVHLLQAPENDTQ
FT                   LKLLQATRKAYLDGNERIRYTFPAIVSSSIRLARKLKSREHYDDNWQSQSSALYRFMHQ
FT                   CVNNLYQRVNPGCADLALRLFVMCGEVADQTGFEEFSYEFFAQAFTIYEDSISDSRAQF
FT                   QAVCIIAGALHGTRGFSKENYDTLITKAALHGSKLLKKPDQCRAVYLASHLWWVIENPH
FT                   RGEEDPKNLYRDGKRVLECLQRALRVADACMDTAVSVELFVEILNRYVYYFDQQNETVT
FT                   TKYLNGLIELIHSNLQTDQDEPNPALENPKRHFYRTLEYIRAREFEGVVTDPRS"
FT   gene            complement(471537..472543)
FT                   /locus_tag="ANIA_04950"
FT                   /old_locus_tag="AN4950.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(471537..472543)
FT                   /locus_tag="ANIA_04950"
FT                   /old_locus_tag="AN4950.4"
FT                   /note="transcript_id=CADANIAT00005446"
FT   CDS_pept        complement(471803..472390)
FT                   /locus_tag="ANIA_04950"
FT                   /old_locus_tag="AN4950.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005446"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005446"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005446"
FT                   /db_xref="GOA:Q5B3D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3D0"
FT                   /protein_id="CBF76412.1"
FT                   /translation="MHTSAVLSLALALTSNAFPLSHPTFNTTVQRRSADYDVVNVGGLP
FT                   DTPQPAPSASTITQTVTAPGAPPQTVTVTISQTPTTPSPSSSAIWGAGTGVPYSSSAIL
FT                   PAVTPVPGEEVQDEEETATGAIDRLARAFGRSMNSHLRARTSNETAAYPRFDARGLNET
FT                   GSVHVSRGLLNSTELVTSSRKARSLNSTALRG"
FT   gene            complement(473525..475767)
FT                   /locus_tag="ANIA_04949"
FT                   /old_locus_tag="AN4949.4"
FT                   /product="transcription factor TFIIIC complex subunit Tfc6,
FT                   putative (AFU_orthologue; AFUA_3G10380)"
FT   mRNA            complement(join(473525..474375,474426..475767))
FT                   /locus_tag="ANIA_04949"
FT                   /old_locus_tag="AN4949.4"
FT                   /note="transcript_id=CADANIAT00005447"
FT   CDS_pept        complement(join(473525..474375,474426..475767))
FT                   /locus_tag="ANIA_04949"
FT                   /old_locus_tag="AN4949.4"
FT                   /product="transcription factor TFIIIC complex subunit Tfc6,
FT                   putative (AFU_orthologue; AFUA_3G10380)"
FT                   /note="transcript_id=CADANIAT00005447"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005447"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005447"
FT                   /db_xref="GOA:Q5B3D1"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3D1"
FT                   /protein_id="CBF76414.1"
FT                   /translation="MPSSRRSGRLSGVRKTYTVDPFAENDLDLTIFGEEDSKTPQNKGK
FT                   GRVQGDDDSDEEFQAQEEEEEEDPDGDVSEAEEPSAENAGEGVDAATFKSRRLKGFQKP
FT                   VRLDQPRSTKKRRPDGAIVLTGDETHSRGAWNPLEHAGKSIHLQVTFGLDERDLLAVLY
FT                   TRDRWSRGIDSTFPTRVSLDEAESLRDYKYGLTFGVEPDDYEKEKTSSWDWYYDDDGPG
FT                   GRFRKRQRIEQINEQEACPTFLPTPKQGKHTVLMGPAGNQMEFNLNQYEVFNFGDAWGE
FT                   LKSRNQKETSNKKKRQGWVLNIGQRIQCLAWVPNQSGRDQFLSVVAPITNEQKQMYLDP
FT                   LKDYAAAAFRSSAPYPCALQIWAFKASEDGGLTKTIDMNIEPSLRLILCTKWGDLRRMA
FT                   WCPITRKPRDEDNKGGFRNLGLLAGVWGDGYVRVIDVKVNNDPTKTEFYRIDVPVFEAR
FT                   PPSTVCTCVAWMSSSDIVVGCANGFVGVWSIAPPFNEPQTDNLPYFYHPIHTTYVLNVS
FT                   PGYPTHAHLVATTSMDGETRLTSIVDHEKDVVETTRMRVGSPYLTYSPWLHSFVSSDEN
FT                   DFVRLLTLRRFFTTLAVARMPSTVSALATCSPWHPSALIGCTGGTVISTNPLRRLLHSK
FT                   EKQWQQAWFSHTWVQGEDPSSPGVSRFFDGFRAESISLLRNMTGDRKMVNGTMVVTIYE
FT                   EETHVTALSWNPNQSCAGWAAAGLGCGLLRIEDLAM"
FT   gene            476297..477419
FT                   /locus_tag="ANIA_04948"
FT                   /old_locus_tag="AN4948.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(476297..476335,476388..477419)
FT                   /locus_tag="ANIA_04948"
FT                   /old_locus_tag="AN4948.4"
FT                   /note="transcript_id=CADANIAT00005448"
FT   CDS_pept        join(476297..476335,476388..477329)
FT                   /locus_tag="ANIA_04948"
FT                   /old_locus_tag="AN4948.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005448"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005448"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005448"
FT                   /db_xref="GOA:Q5B3D2"
FT                   /db_xref="InterPro:IPR013744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3D2"
FT                   /protein_id="CBF76416.1"
FT                   /translation="MALPSYPGILHNYAPRLVAFEFRSSGTLKPHSLLFIGGLTDGLYT
FT                   VPYVQGLANALEPTEWSLFHLHLSSSYGGWGIGSLDRDVEEIGQCIEYVRNLKQRTTSG
FT                   AKVVIMGHSTGSQDVLHYLYSANPTPRNPDVDGVHSLTRPAVDGAIVQAPVSDREALLQ
FT                   CAKESPEAREAYEKLVTFAREQPARAICPIELSGLVGLDPVTPVSARRFWSLASPESPE
FT                   KPSEDDLFSSDLTDERLGETFGRIAERGLLRTTLVALYSGSDEYCPNWVDKEALLERWK
FT                   RATNARGEKKWDDEISGIIPGASHNVRDEGQAWMIERILSYLNRV"
FT   gene            complement(477488..478315)
FT                   /locus_tag="ANIA_04947"
FT                   /old_locus_tag="AN4947.4"
FT                   /product="hypothetical protein similar to dolichol
FT                   phosphate mannose synthase (Eurofung)"
FT   mRNA            complement(join(477488..478121,478215..478315))
FT                   /locus_tag="ANIA_04947"
FT                   /old_locus_tag="AN4947.4"
FT                   /note="transcript_id=CADANIAT00005449"
FT   CDS_pept        complement(join(477488..478121,478215..478315))
FT                   /locus_tag="ANIA_04947"
FT                   /old_locus_tag="AN4947.4"
FT                   /product="hypothetical protein similar to dolichol
FT                   phosphate mannose synthase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005449"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005449"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005449"
FT                   /db_xref="GOA:Q5B3D3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3D3"
FT                   /protein_id="CBF76417.1"
FT                   /translation="MAKDNKYSVILPTYNERRNLPIICWLLERTFRENKLDWEVIIVDD
FT                   GSPDGTLDVAKQLQNVWGADHIVLKPRAGKLGLGTAYVHGLQFTTGNFVIIMDADFSHH
FT                   PKFIPEMVRIQKETDADIVTGTRYASRDGIRGGVYGWDLFRKFTSRTANLIADVMLMPG
FT                   VSDLTGSFRLYRKSVLEKVISSTQSKGYSFQMEMMVRAKAMGYKVAECPITFVDRLYGE
FT                   SKLGGSEIVEYLKGVFNLWLKV"
FT   gene            complement(478648..479183)
FT                   /locus_tag="ANIA_04946"
FT                   /old_locus_tag="AN4946.4"
FT                   /product="conserved serine-rich protein (AFU_orthologue;
FT                   AFUA_3G10410)"
FT   mRNA            complement(join(478648..478967,479015..479183))
FT                   /locus_tag="ANIA_04946"
FT                   /old_locus_tag="AN4946.4"
FT                   /note="transcript_id=CADANIAT00005450"
FT   CDS_pept        complement(join(478648..478967,479015..479183))
FT                   /locus_tag="ANIA_04946"
FT                   /old_locus_tag="AN4946.4"
FT                   /product="conserved serine-rich protein (AFU_orthologue;
FT                   AFUA_3G10410)"
FT                   /note="transcript_id=CADANIAT00005450"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005450"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005450"
FT                   /db_xref="GOA:Q5B3D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3D4"
FT                   /protein_id="CBF76419.1"
FT                   /translation="MTSLLRYSRSIRAVNPRTSRFPVFLQQRFYGQSTYGDGETNPGED
FT                   RNAPTRDMEHPGAPPPNVSKENSTKSQPSYKQDESRSGVLEEDIPKKQSDKARPVINDG
FT                   RQTSNVKEDGNTKSDVPEDVKKHNEEIDQRHDKPYNRIDDGGKVGKGFWGKLDGAEGY"
FT   gene            479477..479719
FT                   /locus_tag="ANIA_11453"
FT                   /old_locus_tag="AN11453.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(479477..479550,479659..479719)
FT                   /locus_tag="ANIA_11453"
FT                   /old_locus_tag="AN11453.4"
FT                   /note="transcript_id=CADANIAT00005451"
FT   CDS_pept        join(479477..479550,479659..479719)
FT                   /locus_tag="ANIA_11453"
FT                   /old_locus_tag="AN11453.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005451"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005451"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005451"
FT                   /db_xref="UniProtKB/TrEMBL:C8V927"
FT                   /protein_id="CBF76421.1"
FT                   /translation="MSEHRVVFMPKDIIHTGHIAIEMMCKRESRSNRGMAERHKDENK"
FT   gene            complement(479932..482223)
FT                   /locus_tag="ANIA_04945"
FT                   /old_locus_tag="AN4945.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(479932..482223)
FT                   /locus_tag="ANIA_04945"
FT                   /old_locus_tag="AN4945.4"
FT                   /note="transcript_id=CADANIAT00005452"
FT   CDS_pept        complement(479932..482073)
FT                   /locus_tag="ANIA_04945"
FT                   /old_locus_tag="AN4945.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005452"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005452"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005452"
FT                   /db_xref="GOA:Q5B3D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3D5"
FT                   /protein_id="CBF76423.1"
FT                   /translation="MSGRLSSDHSRSYSQSSRSRSGHHAPDSMHDQSTSGRSSNPNVFA
FT                   DEYSLEPLESEQSTLTPRSPSISSIASSHTLRSSLPHHQKPYDTSATDNDNEQLENPFR
FT                   DDARLSFEQDTVQRSSLPQKGFDLSYRNSVTSNSTVHSTAQRSQSTSSRFSLPPRALSP
FT                   YTGATGPSHPYAMYPQVGVSRSPSVATTSTIRPVDGPLIDSNGPQHPYAMYSQNVVVEE
FT                   GLDDPIIPLGFPGHNHEAYQRPPNRAADDVGDLIGPDGYTEQLPPYSRYPEGASPKLEP
FT                   SVVALPDDPINSNQTSRNSDRGAATSDASSRTMVAGTVTAGTMAAGALAAGDQPTERGG
FT                   GALDGPPPTGVMAFEEKLKRRGQKKVCCGLPVWTLVLISVVMIVGGSIGGAIGGILGAK
FT                   KAAEEANDSPETTILTMTVPPRTDATPLTATPYNMPPIPTGRFAIPAAPKNQSKFCILD
FT                   QDQTPSWGCYSQNPIPIEVGGNKDKTIDFYSDPLPKTLTYGAQAPFFTQPSMPLDLVMD
FT                   TSDLSLGPALNFFTFFDKLVVVPEDTFSSSDLSARTVSEDEVFAGIHHRKRSSDVGDRP
FT                   WFCWWNSTAMEFFLYINETTKESRYSSSDLSTSSKSSDDEDSKVYTTDSLSRRGSSLSN
FT                   YPRRIKMEEKRDNAEAHAPYCQQMQVLDDGAYTTVSPKTIGISVNEPTATTTTGQYGST
FT                   TQTAKAQYQSICYCVSLTD"
FT   gene            complement(483750..484989)
FT                   /locus_tag="ANIA_04944"
FT                   /old_locus_tag="AN4944.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(483750..483966,484133..484989))
FT                   /locus_tag="ANIA_04944"
FT                   /old_locus_tag="AN4944.4"
FT                   /note="transcript_id=CADANIAT00005453"
FT   CDS_pept        complement(join(483750..483966,484133..484989))
FT                   /locus_tag="ANIA_04944"
FT                   /old_locus_tag="AN4944.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005453"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005453"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005453"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3D6"
FT                   /protein_id="CBF76425.1"
FT                   /translation="MAKQVLNAAKRASKKRSAPTENKDGSPQKKLKSSLQSSTDTPFTV
FT                   ESALALPVSTASEEELSDVVLITNRAPLVLAFAVCVLKYTMPEQPISSRLSLAQAVVSA
FT                   NSRSKAISLGLESDKPAEQEGWGDGLPTISVLGREIKVLKRWDYNPREGRPSQESQGAE
FT                   ATSDDILGQCLTDDSEPRPSLWGIDVLALKRGESYPPETAANTSKALPIHNPDAARSYL
FT                   LKSFMKSPDKDQGESASSKRKSVTKIETEREACLSHLLRSIDMVCQSWASTLSAEDLDR
FT                   RAWSCSTSAGNSFGVLAPACHYCNEFVLDGFRTILNKTLDIRCHIITDLRCQNWKRIYE
FT                   HSSSKIFVKPSLVAAVY"
FT   gene            485497..487920
FT                   /locus_tag="ANIA_04943"
FT                   /old_locus_tag="AN4943.4"
FT                   /product="hypothetical protein"
FT   mRNA            485497..487920
FT                   /locus_tag="ANIA_04943"
FT                   /old_locus_tag="AN4943.4"
FT                   /note="transcript_id=CADANIAT00005454"
FT   CDS_pept        485497..487920
FT                   /locus_tag="ANIA_04943"
FT                   /old_locus_tag="AN4943.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005454"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005454"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005454"
FT                   /db_xref="GOA:Q5B3D7"
FT                   /db_xref="InterPro:IPR000061"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR035967"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3D7"
FT                   /protein_id="CBF76427.1"
FT                   /translation="MADNSKHKAFPDVSSKLSAPAKKSLFERQKAEAEAKRARERAETA
FT                   AVYEDFVKSFEDDSPAPERSTFEGKQNRFANRNTGFGGPAKRHFTSSGPRMSGPGTLGP
FT                   PPTSLSRKRNHEGFQPLHRNWESAQGTLGFDNAAGAAKSAFRASDDEDEGSADAKEAER
FT                   AAAKPTLYLASLPPGTSQSVVKALIPTVLTVDNVKFLRPSGQTATERKSVSAIVTLASE
FT                   SAASDIDSSVSALQNRYLGWGYYLSISRHLSSAAIGSTVAIGPSSTGSLPFGAKPVAPE
FT                   LGGRLNRAPPPGLHRGGFAPPSSYGPSYGGSSSTLQVEVKAPSDLKQLRLIHKTLENLL
FT                   NYGPEFEALLMSRPEVQKEEKWAWLWDARSPGGVYYRWKLWDIITNSRSKDQRGHSQNP
FT                   FPIFEGGAMWIPQDKLTFEYTTRLDELVSDEDYDSSDEDISDGEDDRRQHGGPPPTDGI
FT                   GTGNEGLGHMNPLKKAKLAHLLARLPTTHAKLRKGDVARVTAFAIKHAGAGADEVVEMI
FT                   VSNIIEPFVYTGANPDRELEKGLARKEQNGDGANAAPTDKAGKEKLDTSSAKLVGLYLI
FT                   SDILSSSATSGVRHAWRYRQLFESALKTHKVFEHLGRLEKDLSWGRLRAEKWKRSIGSL
FT                   LHLWEGWCVFPQSSQEHFFQVFEKPPLTEEELREEKEKAESERAAAAVSKNKSRWKAVD
FT                   EDSSAAARFEPGGSSEGKPPSAEVHQEVAEDMDIDGAAMSDIDGEPMEDSDLEDIDEDE
FT                   NPREEIEEEDKPKEQPQTKSEKPPEIPAGPVRKPRPKAEDMFADSDSDSEGRIE"
FT   gene            488141..489741
FT                   /locus_tag="ANIA_04942"
FT                   /old_locus_tag="AN4942.4"
FT                   /product="Nuclear transport factor 2 (NTF-2)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q96VN3]"
FT   mRNA            join(488141..488245,488405..488422,488529..488593,
FT                   488659..488730,488844..488945,488995..489741)
FT                   /locus_tag="ANIA_04942"
FT                   /old_locus_tag="AN4942.4"
FT                   /note="transcript_id=CADANIAT00005455"
FT   CDS_pept        join(488239..488245,488405..488422,488529..488593,
FT                   488659..488730,488844..488945,488995..489108)
FT                   /locus_tag="ANIA_04942"
FT                   /old_locus_tag="AN4942.4"
FT                   /product="Nuclear transport factor 2 (NTF-2)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q96VN3]"
FT                   /note="transcript_id=CADANIAT00005455"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005455"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005455"
FT                   /db_xref="GOA:Q96VN3"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96VN3"
FT                   /protein_id="CBF76429.1"
FT                   /translation="MADFQSIAQQFVTFYYQTFDGNRAGLAPLYRDHSMLTFETSAIQG
FT                   VAGIIEKLTSLPFQKVQHQVSTLDAQPSGEHGGILVLVTGALLVDEEKNPMNYTQTFQL
FT                   MPDGAGSYFVLNDVFRLIYNA"
FT   gene            complement(489524..490518)
FT                   /locus_tag="ANIA_04941"
FT                   /old_locus_tag="AN4941.4"
FT                   /product="PQ loop repeat protein (AFU_orthologue;
FT                   AFUA_3G10470)"
FT   mRNA            complement(join(489524..490094,490146..490403,
FT                   490451..490518))
FT                   /locus_tag="ANIA_04941"
FT                   /old_locus_tag="AN4941.4"
FT                   /note="transcript_id=CADANIAT00005456"
FT   CDS_pept        complement(join(489524..490094,490146..490403,
FT                   490451..490518))
FT                   /locus_tag="ANIA_04941"
FT                   /old_locus_tag="AN4941.4"
FT                   /product="PQ loop repeat protein (AFU_orthologue;
FT                   AFUA_3G10470)"
FT                   /note="transcript_id=CADANIAT00005456"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005456"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005456"
FT                   /db_xref="GOA:Q5B3D9"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3D9"
FT                   /protein_id="CBF76431.1"
FT                   /translation="MASSDTQCGHLVSPGLLNFVLSILIVLGILVSYLPQLVRIAALRS
FT                   SFGISPYFVLLGTTSGTFALANMVSQRQTLQDVSCCKDVSGLSCFAGLLGILQVATQLL
FT                   SFFAILTLFVVFFPKNPLAPLSVPRKEGPTYRTALVVAFICIVHAVVMLIVTLAVGFEK
FT                   PSALQSWSNFCGITAAILASIQYFPQIYTTLRLRCVGSLSIPMMCIQTPGALVWAGSLA
FT                   ARLGSKGWSTWGILIVTACLQGTLLVLCVFFEYLGPNKGHSHDYNKDTAPSQPGENSDA
FT                   QDEDGPYEETPLLRDSR"
FT   gene            491111..493173
FT                   /locus_tag="ANIA_04940"
FT                   /old_locus_tag="AN4940.4"
FT                   /product="meiotic sister chromatid recombination protein
FT                   Ish1/Msc1, putative (AFU_orthologue; AFUA_3G10480)"
FT   mRNA            join(491111..491385,491441..491491,491543..491690,
FT                   491737..492528,492577..493173)
FT                   /locus_tag="ANIA_04940"
FT                   /old_locus_tag="AN4940.4"
FT                   /note="transcript_id=CADANIAT00005457"
FT   CDS_pept        join(491301..491385,491441..491491,491543..491690,
FT                   491737..492528,492577..493051)
FT                   /locus_tag="ANIA_04940"
FT                   /old_locus_tag="AN4940.4"
FT                   /product="meiotic sister chromatid recombination protein
FT                   Ish1/Msc1, putative (AFU_orthologue; AFUA_3G10480)"
FT                   /note="transcript_id=CADANIAT00005457"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005457"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005457"
FT                   /db_xref="GOA:C8V933"
FT                   /db_xref="InterPro:IPR018803"
FT                   /db_xref="UniProtKB/TrEMBL:C8V933"
FT                   /protein_id="CBF76433.1"
FT                   /translation="MKLQLASWLVCALATAEAVGASNWFSKAVYNKWHETELERWLADH
FT                   DIPYPSPADRKELENAVKTNWDLKVQKPLGQLSDHSGDRWEHTKEWIFDTWTDSQLKAF
FT                   LDRHGIPSPQPRRRDTLLKAARENYEAVAKKLGEAAHYPGNWLYDQWSDSDLKLWLDER
FT                   GWPAPQPTTRDRLIAAVRRNTRLASLQAKNIAASVVQSANAAQETLSEALFSAWSDSDL
FT                   KRFLDEHGIHVPQGSKRNELIALARKHRAALVDQASSASSSVSSTASEYIGAATSRAGN
FT                   EYARATDNASLKSQEAFDTAINSWSDSRLKAFLDARGVPVPQKNKRDELLAQVRLNKHK
FT                   AATGWSAWTFDTWDTEHLKKYLSSVNSKVAHRAGVTRDELVKEAQDTYEKATKAGGSQL
FT                   ASATSYLKQATASAKDATFDTWSDSDLKQYLDSYGVPVYQGTELNELRAAARRNAHWFR
FT                   YGTSTPQGALYAKFTGAAQWLLDQLKIGAASGRAQGREAAEKLQDKAEKKAEEVRSEL"
FT   gene            complement(493186..494330)
FT                   /locus_tag="ANIA_04939"
FT                   /old_locus_tag="AN4939.4"
FT                   /product="DNA damage response protein (Dap1), putative
FT                   (AFU_orthologue; AFUA_3G10490)"
FT   mRNA            complement(join(493186..493435,493490..493748,
FT                   493823..494060,494129..494153,494211..494330))
FT                   /locus_tag="ANIA_04939"
FT                   /old_locus_tag="AN4939.4"
FT                   /note="transcript_id=CADANIAT00005458"
FT   CDS_pept        complement(join(493518..493748,493823..494060,
FT                   494129..494153,494211..494220))
FT                   /locus_tag="ANIA_04939"
FT                   /old_locus_tag="AN4939.4"
FT                   /product="DNA damage response protein (Dap1), putative
FT                   (AFU_orthologue; AFUA_3G10490)"
FT                   /note="transcript_id=CADANIAT00005458"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005458"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005458"
FT                   /db_xref="GOA:Q5B3E1"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3E1"
FT                   /protein_id="CBF76435.1"
FT                   /translation="MSAEGTAPQAEVASIATPINLILFSAFAFLVYTQFRPKPPAVLPK
FT                   APAPVVFRTFTPKTLLPFNGENDKPVYLAVRGRVFDVTPGRNFYGPGGPYENFAGRDAS
FT                   RGLAFQSFDKEMLTEDLSGPLDDLKDLNADQLENLQSWEERFLEKYLVVGKLVAEGDPE
FT                   APKS"
FT   gene            496520..498648
FT                   /locus_tag="ANIA_04938"
FT                   /old_locus_tag="AN4938.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(496520..496851,496920..497076,497127..498648)
FT                   /locus_tag="ANIA_04938"
FT                   /old_locus_tag="AN4938.4"
FT                   /note="transcript_id=CADANIAT00005459"
FT   CDS_pept        join(496931..497076,497127..498648)
FT                   /locus_tag="ANIA_04938"
FT                   /old_locus_tag="AN4938.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005459"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005459"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005459"
FT                   /db_xref="GOA:Q5B3E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3E2"
FT                   /protein_id="CBF76437.1"
FT                   /translation="MWAKASLRTRKTSGAGDTPAPTDIRAQLSTVNHNRDISAKALPTL
FT                   PLSPGPFSSQFTTYQPEPSQRVASSIYSRDTVVYDHHRQRSISDTYQSPPQLDDSYAGR
FT                   RRSVDISPPDSPIGAPRSQDSARVSPIENGSIQATGVDGSAAKFSSHIPVFRKRADSKL
FT                   DQSPNPSRAKATQWDNFSGEPTSGLGRIGQVNPGIISFETHVSATRQRSNSSKLIDWGK
FT                   EHFHSRKKVSESRNRFYANEATPFADREPWRGQSGRSPIVYPIQEKPRNRSSSRLHLSR
FT                   SSDRLRENTPSPIVGSTGTFTTIITAGKQNHRQQPWTRPYGHDVPESRNASAVSVSSTT
FT                   PPRVDLVSSPDLSASLTDLTLADNEHNEPTSRFSVTTCNTTEAESATPSPRNSISPSPP
FT                   ASVIDTASQLSTDTTRSIMSRSRPVPSAIAPGKRPARKPTPSEISNKALPPNPAEMTPQ
FT                   GRIDMLEAKRNELMRRKANINTMINELTQVIQPSSIAYDMAAREEVKKTVASLNSELAD
FT                   IQKEEHEVGLKLLRAWKKRDDNDFYGPSSSLWVKRVTS"
FT   gene            complement(498876..499417)
FT                   /locus_tag="ANIA_04937"
FT                   /old_locus_tag="AN4937.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(498876..499175,499240..499329,
FT                   499396..499417))
FT                   /locus_tag="ANIA_04937"
FT                   /old_locus_tag="AN4937.4"
FT                   /note="transcript_id=CADANIAT00005460"
FT   CDS_pept        complement(join(499081..499175,499240..499329,
FT                   499396..499417))
FT                   /locus_tag="ANIA_04937"
FT                   /old_locus_tag="AN4937.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005460"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005460"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005460"
FT                   /db_xref="GOA:Q5B3E3"
FT                   /db_xref="InterPro:IPR015157"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3E3"
FT                   /protein_id="CBF76439.1"
FT                   /translation="MGGASREGGKVKPLKAAKKEKRELDDDDLAFKERQRAEAKAKKEL
FT                   MEKAKGKGPLNTGNQGIKKSGKK"
FT   gene            499879..502318
FT                   /locus_tag="ANIA_04936"
FT                   /old_locus_tag="AN4936.4"
FT                   /product="casein kinase, putative (AFU_orthologue;
FT                   AFUA_8G04810)"
FT   mRNA            join(499879..500582,500626..500831,500886..502318)
FT                   /locus_tag="ANIA_04936"
FT                   /old_locus_tag="AN4936.4"
FT                   /note="transcript_id=CADANIAT00005461"
FT   CDS_pept        join(499879..500582,500626..500831,500886..502318)
FT                   /locus_tag="ANIA_04936"
FT                   /old_locus_tag="AN4936.4"
FT                   /product="casein kinase, putative (AFU_orthologue;
FT                   AFUA_8G04810)"
FT                   /note="transcript_id=CADANIAT00005461"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005461"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005461"
FT                   /db_xref="GOA:Q5B3E4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3E4"
FT                   /protein_id="CBF76441.1"
FT                   /translation="MSSRRSSTASEGEIIESGSETKATTSQSLLNDNSVDRPTRVSSSA
FT                   SVTRSPRRQRSRARTRSRSPSRSPYRDYRGYKRRRAGDYDHDDYWYGYDDDRHSGRTFP
FT                   PPRRGCHRHDGYPQRQARSYYDYDREDNHLADLRYSDDYDRRREKRPRTRSRSPYREVR
FT                   KRKQYSGDEWESQQSRREGSVASQSKRRSSTEQSVSERGNPPAVARDSRQDAETQKNQV
FT                   QAASILPTSDGDSMNGQDVAERHEEPLDEAAQLEARRKRREAIKAKYRDQATPLRIQAL
FT                   HLGGDRGTTPTSEAATPNNETAESAATPDGGSFPDFSIGKDLDLVKDGAVDGADKDEPS
FT                   AADYDPTIDMKAERERHGGQSNDVSAASYDETKTTKQDVLLPDAPSQQEPEAKDSFDIF
FT                   AEDDDDMFAEDTEETSKPAHASAIAVPQARELDVSMMDNWDDPEGYYNLRIGELIDGRY
FT                   HVQQNLGKGMFSSVVRAKDSKTGNVVAIKIIRQNDTMKKAGLKEIGILEKLREADPEDK
FT                   KHMIKFERSFEHKGHLCMVFENLSMNLREVLKKFGRDVGLNLRAIRAYAQQIFLGLSLM
FT                   RKCNILHADLKPDNMLVNEQRNILKVCDLGSASLASDNEITPYLVSRFYRAPEIILGIP
FT                   YDYAIDMWSIGCTLFELYTGKILFTGRNNNQMLKSIMECRGKYPPKLLRRGSLAHLHFD
FT                   EMANFHSTEEDKITGRLTTRIMDFKKPTRDLKTRLMGKGTRGMTDSEAKELALFVDLLD
FT                   RCLSLNPEKRCTPAEALKHPFILRPKA"
FT   gene            505001..507021
FT                   /locus_tag="ANIA_04935"
FT                   /old_locus_tag="AN4935.4"
FT                   /product="protein serine/threonine kinase (Ran1), putative
FT                   (AFU_orthologue; AFUA_3G10530)"
FT   mRNA            join(505001..506278,506331..507021)
FT                   /locus_tag="ANIA_04935"
FT                   /old_locus_tag="AN4935.4"
FT                   /note="transcript_id=CADANIAT00005462"
FT   CDS_pept        join(505618..506278,506331..506980)
FT                   /locus_tag="ANIA_04935"
FT                   /old_locus_tag="AN4935.4"
FT                   /product="protein serine/threonine kinase (Ran1), putative
FT                   (AFU_orthologue; AFUA_3G10530)"
FT                   /note="transcript_id=CADANIAT00005462"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005462"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005462"
FT                   /db_xref="GOA:C8V9D0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9D0"
FT                   /protein_id="CBF76443.1"
FT                   /translation="MLTQPVPFMYPHPHPLPHPHPHPHMLPTPPPSPPTGRFYAPEDRL
FT                   GLLLANRLELTSILGVGAYGVVYTAVDIHTDVLYAVKALNKTGLDPRQLKFQQREIKLH
FT                   HMASQHPNVVSLVRIMDSDDCTYVVIEFCPEGDLFSSITDKSHFVGNDPLVKRVFLQIL
FT                   DAVHYCHSLGIYHRDLKPENILVTDQGMTVKLADFGLATTDMFTSDFGCGSTFYMSPEC
FT                   QQTNPRPMSYYQSAPNDVWSLGVILVNLTCGRNPWKRASIEDSTFRAYLKDPFFLKSIL
FT                   PLSDEMVCILSRIFEPNPSKRITIPELRQIILECPRFTLNPMTPWGSTTGPLVNYMHPP
FT                   QVTPIENLNTQPSACSSDSSQYSDAFSAVSDASSYTEGYSDMDSVSSVGQDDFKDEFPA
FT                   DTVCSDLQQPLSAPVTGSAAGPLVVCQQPFTYLIPVC"
FT   gene            complement(507952..509054)
FT                   /locus_tag="ANIA_04934"
FT                   /old_locus_tag="AN4934.4"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative (AFU_orthologue; AFUA_3G10540)"
FT   mRNA            complement(join(507952..508330,508400..508551,
FT                   508633..508820,508889..509054))
FT                   /locus_tag="ANIA_04934"
FT                   /old_locus_tag="AN4934.4"
FT                   /note="transcript_id=CADANIAT00005463"
FT   CDS_pept        complement(join(507952..508330,508400..508551,
FT                   508633..508820,508889..509054))
FT                   /locus_tag="ANIA_04934"
FT                   /old_locus_tag="AN4934.4"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative (AFU_orthologue; AFUA_3G10540)"
FT                   /note="transcript_id=CADANIAT00005463"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005463"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005463"
FT                   /db_xref="GOA:Q5B3E6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3E6"
FT                   /protein_id="CBF76445.1"
FT                   /translation="MASRLSQLNAHLNYPRGLLADQVAIITGAGQGIGAEAARLFANEG
FT                   AKVVIADIDGEKANAVANAINSASPNRAIAVVGDILNDKYITTLVEKAAEFGNGKIHII
FT                   VNNAGFTWDGVIHKITDKQWDTMIAVHNTAPFKLIRAAAKYFRVKDGEPRVIINISSTS
FT                   GIHGNAGQANYALAKAGVVGLTRTIAKEWGPQFGVRSNTIAFGFVQTRLTAAKEKGAFI
FT                   TTPDGTKVALGIPGQQLGAKEGAKDGKPAYPDIPLGRPASPEEAARSVLAVASPLFSYV
FT                   NGETIRVTGGRNM"
FT   gene            complement(509311..510437)
FT                   /locus_tag="ANIA_04933"
FT                   /old_locus_tag="AN4933.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(509311..510054,510108..510437))
FT                   /locus_tag="ANIA_04933"
FT                   /old_locus_tag="AN4933.4"
FT                   /note="transcript_id=CADANIAT00005464"
FT   CDS_pept        complement(join(509311..510054,510108..510437))
FT                   /locus_tag="ANIA_04933"
FT                   /old_locus_tag="AN4933.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005464"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005464"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005464"
FT                   /db_xref="GOA:Q5B3E7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3E7"
FT                   /protein_id="CBF76447.1"
FT                   /translation="MLTESGTSSSSPGNGETPKLRTACENCRQSKVKCNLSGKDTCIRC
FT                   LRHGLPCRYRVANRSGKPKGSKNRSTLRKLGQLQENKSAFTSSDRLPKRNIEAIPSPGF
FT                   ARSDTESLPTEQPLESPMGEMQDAALFLADCEYPSPYGESLADSSCAASMSPTFLQKEF
FT                   ITKGLTSFPLAVHVPSALRPTCECAETLVFYHDSLRQMVVNPAQVRFDQMLQGVQAALS
FT                   VCRGFLQCPSGHKDNHSANDTSIILCMSTLEFTLQLLDYWTSYELLPQSREGPREVGYG
FT                   EYEMEADEARRVRRFLIRGRLLLCKETLGLLKGAAGFEDGPGGNWLQQIIGGSEAMTDT
FT                   FLHAMSEAECLCNLPTY"
FT   gene            complement(511397..512747)
FT                   /locus_tag="ANIA_04932"
FT                   /old_locus_tag="AN4932.4"
FT                   /product="haemolysin-III channel protein Izh2, putative
FT                   (AFU_orthologue; AFUA_3G10570)"
FT   mRNA            complement(511397..512747)
FT                   /locus_tag="ANIA_04932"
FT                   /old_locus_tag="AN4932.4"
FT                   /note="transcript_id=CADANIAT00005465"
FT   CDS_pept        complement(511397..512353)
FT                   /locus_tag="ANIA_04932"
FT                   /old_locus_tag="AN4932.4"
FT                   /product="haemolysin-III channel protein Izh2, putative
FT                   (AFU_orthologue; AFUA_3G10570)"
FT                   /note="transcript_id=CADANIAT00005465"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005465"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005465"
FT                   /db_xref="GOA:Q5B3E8"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3E8"
FT                   /protein_id="CBF76449.1"
FT                   /translation="MPPRQRRPTEIHKKDPGGCQTASVATAVLEDPPRAIRSLVHWDEL
FT                   PHWQRDNQHIHTGYRPASYSFRGSFQSLTYIHNETVNIYTHLLPSVLAIPAAIQLYRAL
FT                   APRYETATDGDIRAFGCFFVGAAFCLGMSAFYHTISNHSPTVARIGNTFDYIGIVGLIV
FT                   GSFVPSVYYGFYCVPELQRLYWSMICTIGLGCIVVSIFPKFRTPRWRPFRAAMFVGMGL
FT                   SAVFPVVHGLQLYGRDQMMRQIGLGWLLLQGFLYILGAGIYAARVPERLRPGGFDLWGS
FT                   SHQIFHVLVVCAAVAHLTGLLRAFDYRHNGTAGSCQV"
FT   gene            512795..513831
FT                   /locus_tag="ANIA_04931"
FT                   /old_locus_tag="AN4931.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(512795..512895,512961..513831)
FT                   /locus_tag="ANIA_04931"
FT                   /old_locus_tag="AN4931.4"
FT                   /note="transcript_id=CADANIAT00005466"
FT   CDS_pept        join(512795..512895,512961..513831)
FT                   /locus_tag="ANIA_04931"
FT                   /old_locus_tag="AN4931.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005466"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005466"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005466"
FT                   /db_xref="GOA:Q5B3E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3E9"
FT                   /protein_id="CBF76451.1"
FT                   /translation="MSGRAPSAKWPHSRLKPVADSLESVGFVSKGDCKLLDHKAQKNYY
FT                   DKIMARYIEFCARHSKNLDEAWLSLPRSASNDATKNPPASVPQSTKSAVSPGPSPATEL
FT                   STLLLSLRKLREAVLATASTTPISFSQRVHVFSIKVSIQARHPPSYFPSLRHLLDDLHT
FT                   PSNPLPDSELKDHTSYLILDYACRQEDLVAAFELRARARRQYNFHSREVDQILQAIAHD
FT                   NWIVFWRVRKEVDSAMRAIMNWAEDRVRRHALKAVGKAYLGVDIAWIVEGCTGDSTWTW
FT                   EKLAEREKLGWEKEGDRVIIRKPRSKPKPEGNLTPIQEKSTG"
FT   gene            complement(513921..515298)
FT                   /locus_tag="ANIA_04930"
FT                   /old_locus_tag="AN4930.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(513921..514154,514207..515298))
FT                   /locus_tag="ANIA_04930"
FT                   /old_locus_tag="AN4930.4"
FT                   /note="transcript_id=CADANIAT00005467"
FT   CDS_pept        complement(join(513960..514154,514207..515298))
FT                   /locus_tag="ANIA_04930"
FT                   /old_locus_tag="AN4930.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005467"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005467"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005467"
FT                   /db_xref="GOA:C8V9D5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9D5"
FT                   /protein_id="CBF76453.1"
FT                   /translation="MYNEQWLLTTYSPLNVESLSEISTPLHQNATDYGMYSGDSFSSLD
FT                   PLAPELPSEMGKDLSFLLRYDNYHSLSQVDIPHALRSDFISPTSDETLASSLSTLERLL
FT                   AEGHFLLAAYLAGTILTSSLISPTDIKVIFALFYTRLACLELSGNTNIAAQESKALEDL
FT                   SSTFYYVEPKLAATDARDHQLSYARHIAPWPLRVLAIRLQSIGFGDPRRGIGGLYELGL
FT                   EARREILRPDIDPAEREIWKQRLSDLGIRTVNALIEMGDLCAAKRSLESLRKTESANEI
FT                   TRLRATLLLLAIGDVDAARQLFEGFGDTGDAIFKPLLSMSEGRYNDAVIEWRDILGNNS
FT                   READEAIISQNLAVCLLYTGQLSEAREALETLVQAQHSFSSLIFNLATVYELCSDKAMQ
FT                   LKHGLVEKVARQPVTGHTNLDRPNADFKL"
FT   gene            518169..518765
FT                   /locus_tag="ANIA_11452"
FT                   /old_locus_tag="AN11452.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(518169..518292,518632..518765)
FT                   /locus_tag="ANIA_11452"
FT                   /old_locus_tag="AN11452.4"
FT                   /note="transcript_id=CADANIAT00005468"
FT   CDS_pept        join(518169..518292,518632..518765)
FT                   /locus_tag="ANIA_11452"
FT                   /old_locus_tag="AN11452.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005468"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005468"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005468"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9D6"
FT                   /protein_id="CBF76455.1"
FT                   /translation="MASTFSEIPKSSGGAADITIAGEIGTAPYKPDLKQGSVRRRPYNQ
FT                   PETDGFKLAESQPPGSTLVMPEINEPTSIQKRLGTGSPDF"
FT   gene            521444..524532
FT                   /locus_tag="ANIA_04929"
FT                   /old_locus_tag="AN4929.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(521444..522377,522433..524532)
FT                   /locus_tag="ANIA_04929"
FT                   /old_locus_tag="AN4929.4"
FT                   /note="transcript_id=CADANIAT00005469"
FT   CDS_pept        join(521444..522377,522433..524342)
FT                   /locus_tag="ANIA_04929"
FT                   /old_locus_tag="AN4929.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005469"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005469"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005469"
FT                   /db_xref="GOA:Q5B3F1"
FT                   /db_xref="InterPro:IPR021582"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3F1"
FT                   /protein_id="CBF76457.1"
FT                   /translation="MTTQTGPVIPPRPSRSPAEKTADMPKIPPRPTHRIDRTASPMGSN
FT                   YAPSPLNEPPNGSTLSKTVSNDMPARPPSVTIPSLGEEGIEYQDLDALNASDSHNTTPA
FT                   ETRNVGSDLKLHAPRPSLPTSSAKAKVQAVTRTDSSQAVAAGFGAIGSPEQDEQQERSS
FT                   RSIYSVQGSRAASSTASFERPRSIHDEEHGIPEIGQRVPMLANAGDVQAPSPSPFLEQP
FT                   GSRSGRGHHRTRSGREASLPPGSYGLHGHGVPTNDKFEKAWYEKHPDEYAKEEQGHYGS
FT                   GVGTPRPDWALSSDDLNKIVRGSAVTGAGLGTSPAITGTPEEELGYLASEEYTQRLTSP
FT                   TPDSKRDSRPTVESPLKNSSAPAAEAGEKAKEQPSFIHIDEPYHHRDHPDGFALTPDPQ
FT                   EIANKGKGDEEDEPILAADEVRPESAYQHAAVSPTFNRRESHDYEGRSRTPSVNGSRSN
FT                   SRTAGRRGSTPVLARYNSHEDHAPLEDVEEYEPLFPEDESKENNPMSAAERFKKRPDTL
FT                   KHRFPSEDIWEDSPNSHQLHATVSTPDIPKESRFETPEQEEARKTREPSVDSHQVAQRI
FT                   LHSEEPASRPGLAKQRFPSRDIWEDAPESQTLVTTIEPPEEKQTSPDVPSKPAIPARPE
FT                   KRQPPQVDVSTKPTSPVEKRQPPVIPDRPKPQIPARPANRVSRSNGDEAQDASVKSKPA
FT                   VPARPIGGKIASIKAGFLSDLNSRLQLGPQAPPKPEPKQETPAERGPLSDARKGRARGP
FT                   ARRKPAVESPGARLPTIPEIKITETWNVWEVREDGQLIVGDGNKGNKASTASASSDPWD
FT                   TPMAPPLARNMAGGAVDPPRQPTKEEVLEPTSTGTSSELEQEAPKVEPTEAKSMKEEDL
FT                   SSSIPGGFDSSEKKVETPSAVSDDKVESVPESFEKQVDITSAVSGDNVEAVSEDLTSSA
FT                   DGKKLSDGDETVSASRD"
FT   gene            complement(524945..526139)
FT                   /locus_tag="ANIA_04928"
FT                   /old_locus_tag="AN4928.4"
FT                   /product="transcription initiation protein (AFU_orthologue;
FT                   AFUA_3G10620)"
FT   mRNA            complement(524945..526139)
FT                   /locus_tag="ANIA_04928"
FT                   /old_locus_tag="AN4928.4"
FT                   /note="transcript_id=CADANIAT00005470"
FT   CDS_pept        complement(525084..526139)
FT                   /locus_tag="ANIA_04928"
FT                   /old_locus_tag="AN4928.4"
FT                   /product="transcription initiation protein (AFU_orthologue;
FT                   AFUA_3G10620)"
FT                   /note="transcript_id=CADANIAT00005470"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005470"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005470"
FT                   /db_xref="GOA:Q5B3F2"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3F2"
FT                   /protein_id="CBF76459.1"
FT                   /translation="MATISATALQEGTTPWRKNLSAHVICPECKEMPPNLEFPGSHETV
FT                   CGSCGLVLADREIDMHSEWRTFSNDDQNNDDPSRVGDATNPLLNGDQLETQIASGGSGR
FT                   VRDLYRAQNKQSSDKANKSLLAAYKEIGALCDGFGIPKNVADTAKYLFKIVDDAKAFKG
FT                   KSQDVIIAGCIFIACRKCKVPRTFTEIFAVTKVSRKEIGRIYKALEKFFTSQNLERANA
FT                   VVSNGGVPDPNDTYTATTSTKPSDLCSRFCNLLDLPFQVTSVSSALSDRVTTEGNLAGR
FT                   SPLSIVAACIYMASYLMGHPKSAKEISQVAHVSDGTIRGAYKQLYTERESLVDKEWIKD
FT                   GKGALKNLPPS"
FT   gene            527035..527764
FT                   /locus_tag="ANIA_04927"
FT                   /old_locus_tag="AN4927.4"
FT                   /product="mitochondrial F1F0 ATP synthase subunit Atp14,
FT                   putative (AFU_orthologue; AFUA_3G10630)"
FT   mRNA            join(527035..527094,527162..527243,527348..527764)
FT                   /locus_tag="ANIA_04927"
FT                   /old_locus_tag="AN4927.4"
FT                   /note="transcript_id=CADANIAT00005471"
FT   CDS_pept        join(527068..527094,527162..527243,527348..527613)
FT                   /locus_tag="ANIA_04927"
FT                   /old_locus_tag="AN4927.4"
FT                   /product="mitochondrial F1F0 ATP synthase subunit Atp14,
FT                   putative (AFU_orthologue; AFUA_3G10630)"
FT                   /note="transcript_id=CADANIAT00005471"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005471"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005471"
FT                   /db_xref="GOA:Q5B3F3"
FT                   /db_xref="InterPro:IPR019711"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3F3"
FT                   /protein_id="CBF76460.1"
FT                   /translation="MMSQSLRASSSLFARVARQQAPSVARRTFLTSAVRRADPVQELYL
FT                   RELRAYKPTPVKPGDADAHVQKFSAPAAPKSPEEANLANELSSYESQEVEVEGQAAAGE
FT                   AAPAEESWFEEDEDETPAAH"
FT   gene            complement(528822..529124)
FT                   /locus_tag="ANIA_11451"
FT                   /old_locus_tag="AN11451.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(528822..528864,529081..529124))
FT                   /locus_tag="ANIA_11451"
FT                   /old_locus_tag="AN11451.4"
FT                   /note="transcript_id=CADANIAT00005472"
FT   CDS_pept        complement(join(528822..528864,529081..529124))
FT                   /locus_tag="ANIA_11451"
FT                   /old_locus_tag="AN11451.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005472"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005472"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005472"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9E0"
FT                   /protein_id="CBF76462.1"
FT                   /translation="MIIAAFDRATLNNFEYPLTIPKNQPTDV"
FT   gene            530154..533610
FT                   /locus_tag="ANIA_04926"
FT                   /old_locus_tag="AN4926.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(530154..531016,531065..532636,532683..533610)
FT                   /locus_tag="ANIA_04926"
FT                   /old_locus_tag="AN4926.4"
FT                   /note="transcript_id=CADANIAT00005473"
FT   CDS_pept        join(530154..531016,531065..532636,532683..533610)
FT                   /locus_tag="ANIA_04926"
FT                   /old_locus_tag="AN4926.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005473"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005473"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005473"
FT                   /db_xref="GOA:Q5B3F4"
FT                   /db_xref="InterPro:IPR013887"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3F4"
FT                   /protein_id="CBF76464.1"
FT                   /translation="MSPPALEIATTHQDDQNSQLSRAASYNNLPDLAASEPGSPGLRRT
FT                   FSDLTFQKQAESPSKEDVAAGKDILRRTSLRRSKDKSTVAVSRFTVSTEDLADAPPSEA
FT                   QEPPPKVPETRAPSPVARPSKARSMSGRLVSFARKPWMSSSPNRSTSPSSKTARLRSLQ
FT                   GEDSAPQTSSPRSSGSLDLAAGPDSAMPTRKRTILSKRPRRPMVAVVTQSRAESPSTPS
FT                   SPSPGSLLAKGSLERLTSSFNVSTPVLPPAAKTAAVSGDVPGNLDPPRKKDELWNAFRG
FT                   LEADFQKFQSKSTALKANVIRSSLLPFLNRAHPPHYIKALRPEDLDRRVNILNKWWTGL
FT                   LDMLNGKNNQAISGTDRPVYLEAVVGIMSRPEWKVPFPMSSPDAQLPKPLKPSGASISE
FT                   TSEASSGSDFLVESIHHNIRNIFTNNLLTQMAFVVERMSMRHAPASLVAFCGKACAYAF
FT                   FFCPGVAEMLVRLWNIPANICRRVYAETQVDKSSGLRAMTQELALNFPPGLRSLSFHTH
FT                   TALVRYLRQKPEVPLNITQIQWQSPWVTRWCGRDTDLFYVFVKYIHLLYADAIPSYFEK
FT                   SARILSPGLLPIHAQILIVLEDTLYKQSQNQAPENPHTTAAITFDDFIEGAEGSASALP
FT                   LGTANSHRSMAENRLIILLRDYLSESSLEPNHARLFYAESFCMIMKITAQRTSLFDHNA
FT                   CFLLCDFVEEAIPIIARYSRSIEMDLFDWKFWLEACRQMMQSHNSLTEVRVFSFLFCIW
FT                   NTWIASEERKAALCLGFLLDETLFYHYFSHWSPMVRAYFHRLLCWRLGRFNGDPSPLDS
FT                   IIYETLSNRLQRLWDFYLAVQTKAQSGLAAPLSSAPCTPAPGRRIIIIRCDNPMSPSNL
FT                   FMSFDRVLPASAPNQATSSISMKADDVSEAQNPPKKRWNILKAVFGASRSNEELSPITS
FT                   SDESDTTVSDSSATGEKGADVSWRGGNNPSESQRPKTPHQPYTFRFSLEWMDRPQWPSK
FT                   NKRLYTPSLPVASQLHLQLRRSTLKSEDSDTTSDDTTDSEAEKDAEKDPLAPGVKQNVT
FT                   DADAKIKKAPKNDLTAAADDKIASSKYAGRALAEWAQIVSECDSFFSRRRDEGVPNDRM
FT                   VETPTLGVEGFRK"
FT   gene            complement(534348..534502)
FT                   /locus_tag="ANIA_11450"
FT                   /old_locus_tag="AN11450.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(534348..534388,534493..534502))
FT                   /locus_tag="ANIA_11450"
FT                   /old_locus_tag="AN11450.4"
FT                   /note="transcript_id=CADANIAT00005474"
FT   CDS_pept        complement(join(534348..534388,534493..534502))
FT                   /locus_tag="ANIA_11450"
FT                   /old_locus_tag="AN11450.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005474"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9E2"
FT                   /protein_id="CBF76466.1"
FT                   /translation="MSKAIELSFCIYIKSQ"
FT   gene            complement(534896..537605)
FT                   /locus_tag="ANIA_04925"
FT                   /old_locus_tag="AN4925.4"
FT                   /product="glutamate carboxypeptidase Tre2, putative
FT                   (AFU_orthologue; AFUA_3G10650)"
FT   mRNA            complement(join(534896..535084,535140..537605))
FT                   /locus_tag="ANIA_04925"
FT                   /old_locus_tag="AN4925.4"
FT                   /note="transcript_id=CADANIAT00005475"
FT   CDS_pept        complement(join(534896..535084,535140..537605))
FT                   /locus_tag="ANIA_04925"
FT                   /old_locus_tag="AN4925.4"
FT                   /product="glutamate carboxypeptidase Tre2, putative
FT                   (AFU_orthologue; AFUA_3G10650)"
FT                   /note="transcript_id=CADANIAT00005475"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005475"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005475"
FT                   /db_xref="GOA:Q5B3F5"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR036757"
FT                   /db_xref="InterPro:IPR039373"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3F5"
FT                   /protein_id="CBF76468.1"
FT                   /translation="MTKDQKYEYDSLPIPSYEEAIADRPSSSRTHLAADVTDDPAAEGQ
FT                   ALLHETRESAARDGPQSRPHGYHPPTVESARNSVDDLGSSPAASERGSLEELRGELNQM
FT                   DVEDGSQQSSQRSRLRSRLSKPFSNLGRTLSSIHLPLRRFLPNFKFTINLNSARTSFNS
FT                   NGCIILLRLFGLLLVIAVIYVFVVSDVFNFSSRFMMGQSYSAASVENFVQGHINETNIA
FT                   EYLRRVTEFPHMAGTEGSYVLAEWIQREFEEAGLETIEMEKYEVYLNYPKEDGRRIAII
FT                   DPPDLRWEAILEENDSETPVFHGHSKSGNVTGHLVYANYGSREDFQYLADKGINLNGSI
FT                   ALVRYYGTESDRALKVKAAELAGAAGCIIYSDPSDDGFVRGAAYPKGRFMPADGVQRGA
FT                   VSQMSYVVGDVLSPGFASTPQMKTRLSLEQTTGMPGIPSLPLAWRDAQRLLQVLEGHGS
FT                   KVPKKWVGGVPKVKQWWTGDEKSPTVNLMNLQDEVDRQPIYNVIGRIHGMEEPEKKIIV
FT                   GNHRDSWCLGSADPGSGTAVFLELVRVFGELLTFGWRPLRTIEFASWDAEEYNLIGSTE
FT                   HVEDSMDNLHGNAYAYINVDVGVSGTDFEASGCPLYERVVMQVLGRISDPVTNETLKDI
FT                   WEQKNKRFAPLGAGSDYVAFQDLAGISSIDFGFTGEPYPYHSCHENFDWMAKFGDPGFQ
FT                   YHKILGQFWGLLLLQFADNPILPYDVEVYAEHLAGYVIDLENYARSKNVPIDNNASGDS
FT                   SVNLTPLYNATSKLRADAEQFQQWPKLWHDAVWGAGGFENNIIALQRMSHNFRMAKLDV
FT                   HLLDNRYGGGIPNRTQFKHVVFGPQLWSGYDAAIFPAIQDSLETRNWTLAQEWVDRIAG
FT                   IIQNAGDKLLHDD"
FT   gene            539320..539819
FT                   /locus_tag="ANIA_04924"
FT                   /old_locus_tag="AN4924.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(539320..539323,539458..539819)
FT                   /locus_tag="ANIA_04924"
FT                   /old_locus_tag="AN4924.4"
FT                   /note="transcript_id=CADANIAT00005476"
FT   CDS_pept        join(539320..539323,539458..539819)
FT                   /locus_tag="ANIA_04924"
FT                   /old_locus_tag="AN4924.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005476"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005476"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005476"
FT                   /db_xref="GOA:Q5B3F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3F6"
FT                   /protein_id="CBF76470.1"
FT                   /translation="METMSQVGAGFSSETANFGVYEIKVESDPQDKIDKVSALRLGDYW
FT                   DQGDPTAKASRIEILHRQPAVSRRPGNGREQPMSQLILVRLPLPTSSSIRTQWAPSIPC
FT                   LQSETTRSRTRYGSMGQ"
FT   gene            541181..542997
FT                   /locus_tag="ANIA_04923"
FT                   /old_locus_tag="AN4923.4"
FT                   /product="hydroxymethylglutaryl-CoA synthase, expressed
FT                   (Eurofung)"
FT   mRNA            join(541181..541511,541570..542997)
FT                   /locus_tag="ANIA_04923"
FT                   /old_locus_tag="AN4923.4"
FT                   /note="transcript_id=CADANIAT00005477"
FT   CDS_pept        join(541352..541511,541570..542789)
FT                   /locus_tag="ANIA_04923"
FT                   /old_locus_tag="AN4923.4"
FT                   /product="hydroxymethylglutaryl-CoA synthase, expressed
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005477"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005477"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005477"
FT                   /db_xref="GOA:Q5B3F7"
FT                   /db_xref="InterPro:IPR000590"
FT                   /db_xref="InterPro:IPR010122"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3F7"
FT                   /protein_id="CBF76472.1"
FT                   /translation="MSRPQNIGIKAIEVYFPSQCLDQTELEKHDGVSEGKYTIGLGQSK
FT                   MSFCDDREDIYSIALTTLSSLMKKYNIDPNSVGRLEVGTETLLDKSKSVKSVLMQLFAP
FT                   HGNTNIEGVDTVNACYGGTNALFNSINWVESSAWDGRDAVVVCGDIALYAKGAARPTGG
FT                   AGCVAMLIGPDAPIIFEPGLRASYLTHAYDFYKPDLTSEYPVVDGHFSLRCYTEAVDAC
FT                   YKAYGAREKTLKEKTQNGTNGVTHDESKTALDRFDYVLFHAPTCKLVQKSYARMLYNDY
FT                   LANPTHPSFAEVAPELRDLDYETSLTDKNVEKTFMGLTKKRFAERVRPGLDVATLCGNM
FT                   YTATVYAGLCSLLSNVTFDPSQPKRLGFFSYGSGLASSLFSAKIVGDVSYIVEKLNLHK
FT                   RLESRTVLSPTDYEAMCELREHAHLAKDFKPSGNPDTLFPGTYYLTEIDGMFRRKYETK
FT                   A"
FT   gene            544295..546256
FT                   /locus_tag="ANIA_04922"
FT                   /old_locus_tag="AN4922.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(544295..545134,545240..546256)
FT                   /locus_tag="ANIA_04922"
FT                   /old_locus_tag="AN4922.4"
FT                   /note="transcript_id=CADANIAT00005478"
FT   CDS_pept        join(544295..545134,545240..546256)
FT                   /locus_tag="ANIA_04922"
FT                   /old_locus_tag="AN4922.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005478"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005478"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005478"
FT                   /db_xref="GOA:Q5B3F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3F8"
FT                   /protein_id="CBF76474.1"
FT                   /translation="MSLGFPYYRPTTPPVQYQELAGQTHNHTASDSSIYSNDSSPWSAV
FT                   TSTTSPTIDSPPRYQHGPALLPRIRSQDVVIEPPPTAGPQRHRRFLSNTRNPPGFIPYP
FT                   TRRPSVQRNVVEVSDRLAAVSSAHTSPVYASYNESALSSPVSITASHRREDSGKHSRSS
FT                   SASSMEEAKYAYLNYRQCPKYTAQPQASPTALITPATPSIMVYPPFSRDSPAEPATKSQ
FT                   GTPAQLALPASPYHYAQAPSAQCSPVGVAHPVPTVCAQSTTLLSYLTSPTQAINLVRNG
FT                   LTKLLKTAIPTSLAPPAVVQSSRLSPDSEIALVNLVQDIYAPRVNAALAVSQGPDHLSL
FT                   YPAPTPRIPANKNYGGPHFLANYASDTEQTTSGLPRGRLVGIAKSFDRWNTGMRNEAPH
FT                   RRVEYLNGLAHLQRCMREHSCRYGFIITEIELVCVRAGCDPGDDVPYFGFLEVSAPIPT
FT                   NVAARPANANDDAVEHNSTAYASPNSPTPSVDSSLASQSPPYNHNPHEGYSVEATEALN
FT                   GPMTASLALYFLLMLSKSVPLPSQPSSHLNVGGPGALTRQRTLPEGKDKWIPEPQIGEK
FT                   RDAKRVRGWIWPHDAWHRREGGGVPRSKAAAAAPAKAKKWHK"
FT   gene            complement(546529..548359)
FT                   /locus_tag="ANIA_04921"
FT                   /old_locus_tag="AN4921.4"
FT                   /product="FAD binding domain protein (AFU_orthologue;
FT                   AFUA_3G10680)"
FT   mRNA            complement(join(546529..547181,547234..548359))
FT                   /locus_tag="ANIA_04921"
FT                   /old_locus_tag="AN4921.4"
FT                   /note="transcript_id=CADANIAT00005479"
FT   CDS_pept        complement(join(546529..547181,547234..548359))
FT                   /locus_tag="ANIA_04921"
FT                   /old_locus_tag="AN4921.4"
FT                   /product="FAD binding domain protein (AFU_orthologue;
FT                   AFUA_3G10680)"
FT                   /note="transcript_id=CADANIAT00005479"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005479"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005479"
FT                   /db_xref="GOA:Q5B3F9"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3F9"
FT                   /protein_id="CBF76476.1"
FT                   /translation="MAQLHDVLIIGAGPCGLAVAARLREHTPSAIFTDAEHQRYHWINK
FT                   HKGRMNLVRRRPGKMGSLGVPKHQPAAQGKERASSVSSEDSTSTNSTTFTQGRDSATSV
FT                   SSHDWDSEPEEESKDSPSIKVLDSTSPNWLTKWHRAFNTLEIAQLRSPMFFHVDPSDRD
FT                   GMLAYTTEQGREDDLWEIPGCVGKELSKHKKKKQQRQRLKQKKGNLGVLGDTEIDERDR
FT                   KDYFSPGTGLFRDFCESVVSRYRLDRKGFIEEAEVSDITYGYVDDLDSVKKVFTVTTKD
FT                   ERVFYARTVVLAVGPGGKKIMPFELSEQEKEGACHSSDLRPGLFPCPHVKRMIQARKET
FT                   NLVIVGGGLSSAQIVDMAIRKGVSKVWFLMRSDFKVKHFDITLTWMGKFKNYSKAVFWS
FT                   ADTDEERLEMIKTARGGGSITPRYQRILLKHAAAKRLSIHTHTVITEKAYNPATRTWRL
FT                   ATSPPIPNLPDQIDYVCFATGMHMDVNELPFMQKMHADYPIRSIGGLPCLTDDLMWQAE
FT                   VPLYMTGRLAALRLGPGAPNLEGARLGAERIAWSLEEVLGKRTFGKDEKREALDVERSM
FT                   ECFCGLGNRFAELPEA"
FT   gene            552163..555928
FT                   /locus_tag="ANIA_04920"
FT                   /old_locus_tag="AN4920.4"
FT                   /product="calcium ion P-type ATPase (Eurofung)"
FT   mRNA            join(552163..553010,553121..553551,553605..553747,
FT                   553797..555928)
FT                   /locus_tag="ANIA_04920"
FT                   /old_locus_tag="AN4920.4"
FT                   /note="transcript_id=CADANIAT00005480"
FT   CDS_pept        join(552171..553010,553121..553551,553605..553747,
FT                   553797..555928)
FT                   /locus_tag="ANIA_04920"
FT                   /old_locus_tag="AN4920.4"
FT                   /product="calcium ion P-type ATPase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005480"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005480"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005480"
FT                   /db_xref="GOA:Q5B3G0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3G0"
FT                   /protein_id="CBF76478.1"
FT                   /translation="MLMANPNYFGSYEGSSRLPTPQIEIHEDDQSSSLSPGQTGSRTLM
FT                   PTADRLTVNHDPPRSSHSLDGDTLRARANSTVSSAETIVHAEAPSKLEPTKGALKTDFS
FT                   HLDDVPLSEALNPDPQYVQDFEVQDNKFSFSPGQLNKMLNPKSLAAYQALGGLSGLAQA
FT                   LRTDLKSGLSTDETTLQGKVVYNLETTSFDYVEDAGSSEGADTQFSDRIRVFSQNRLPA
FT                   RKTTGFFMLLWMAYNDKIIILLTIAAVVSLSLGIYQTIDEGHGVDWIEGVAIVVAIAIN
FT                   DDREVKAVRSGKVVMISVFDITVGDVLHVEPGDSVPADGVLISGHGIKCDESSATGESD
FT                   QMKKTDGFEVSRQIADGTATKKLDPFMISGSNVLEGVGSYLVTSVGKYSSYGRILMSLQ
FT                   ESNDPTPLQVKLGRLANWIGWLGSSAAIVLFFALLFRFLANLGSNPGSSAAKGQEFVDI
FT                   LIVAVTVIVVAIPEGLPLAVTLALAFATTRMVKENNLVRVLRACETMGNATVICSDKTG
FT                   TLTQNKMTVVAGTLGTKGFSQDESTSMSAAELFKICPREAQDLLVKSIALNSTAFEEVK
FT                   EGTKEFIGSKTEVALLQLARDYLGMDVATERASATIIQLIPFDSARKCMGVVYQVADGH
FT                   YRLLIKGAAEMMVDKCSNRINYDSDKLCIEPAAAKDKQEILEIIESYAKKSLRTIGLVY
FT                   KDFSAPTWPPPEAVRVQDDPDSAEFDTIFHDMTWLGVMGIQDPLRPEVPAAIERCHVAG
FT                   VQVKMVTGDNINTATAIAESCGIKTEDGIAMEGPTFRRLSEEEMDKVIPRLQVLARSSP
FT                   EDKRILVARLKKLGETVAVTGDGTNDGPALKTADVGFSMGIAGTEVAKEASSIILLDDN
FT                   FKSIVTAIAWGRAVNDAVAKFLQFQITVNITAVVLTFVSSLYNSDNESVLSAVQLLWVN
FT                   LIMDTFAALALATDAPTDKILNRKPVPKSASLFTVTMWKMILGQAIYQLGITFMLYFAG
FT                   DSILSDYLSSNPDIRHRQLDTIVFNTFVWMQIFNEFNNRRLDNKLNIFEGMHRNYWFIG
FT                   INCIMVAGQVMIIYVGGEAFNVREITSVQWGVCIACAFGCIPWAVVLRCIPDKPVGIVL
FT                   DTVTAGIGFVLKPLGRAFAAIGRPIKRIIRRRQNKNKSDDANALTYLKEQRVPDEEQRS
FT                   VPQLTFTTLDDVSSR"
FT   gene            556482..557349
FT                   /locus_tag="ANIA_04919"
FT                   /old_locus_tag="AN4919.4"
FT                   /product="Arp2/3 complex subunit Arc16, putative
FT                   (AFU_orthologue; AFUA_3G10700)"
FT   mRNA            join(556482..556964,557037..557349)
FT                   /locus_tag="ANIA_04919"
FT                   /old_locus_tag="AN4919.4"
FT                   /note="transcript_id=CADANIAT00005481"
FT   CDS_pept        join(556606..556964,557037..557259)
FT                   /locus_tag="ANIA_04919"
FT                   /old_locus_tag="AN4919.4"
FT                   /product="Arp2/3 complex subunit Arc16, putative
FT                   (AFU_orthologue; AFUA_3G10700)"
FT                   /note="transcript_id=CADANIAT00005481"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005481"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005481"
FT                   /db_xref="GOA:C8V9E9"
FT                   /db_xref="InterPro:IPR006789"
FT                   /db_xref="InterPro:IPR036743"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9E9"
FT                   /protein_id="CBF76480.1"
FT                   /translation="MSTLNYRTINIDALDPDSPQNFPLTTLLPSTLPPPQGSSDAANTA
FT                   TQVRQLLRSGDPAAALIHVLDTAPLGGDEGAKQVHLATVIDVLQGIRQGEMGRVLQAVL
FT                   DGPGGVERGDCLMKYLYKGMAAGGPSNGAQSPRKSVSPQSTGFSQIQARNLGEGGGGQQ
FT                   MSVLLNWHEKLVELTGTGSIVRVMTDRRTV"
FT   gene            complement(557325..558634)
FT                   /locus_tag="ANIA_04918"
FT                   /old_locus_tag="AN4918.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(557325..558239,558333..558634))
FT                   /locus_tag="ANIA_04918"
FT                   /old_locus_tag="AN4918.4"
FT                   /note="transcript_id=CADANIAT00005482"
FT   CDS_pept        complement(join(557325..558239,558333..558548))
FT                   /locus_tag="ANIA_04918"
FT                   /old_locus_tag="AN4918.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005482"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005482"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005482"
FT                   /db_xref="GOA:Q5B3G2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3G2"
FT                   /protein_id="CBF76482.1"
FT                   /translation="MSSLRHLRPVFRASWTARRTYASQTPGNPVLEIFNRKVKHLQKDR
FT                   AAQNVEESRKVDYLRDEVAMRLCERLLDIKRRFPNVLDLGANSCNIARALTTPIPPLDA
FT                   AAAPDGDADAAAAGATTITTEGATISPGGEPVTLADRIDHLTCVETSSALLHRDADLPF
FT                   NKLLPITRKVIPDLESLPYEPNTFDAVLSSLSIHWINDLPSLLAQVNSILKPDCPFIAA
FT                   MFGGDTLFELRTSLQLADLERRGGVSPHVSPLADVRDVGGLLTKAGFKMLTVDVEDIVV
FT                   EFPDTFALMADLQAMGENNAILQREQGPISRDVLLANEAIYRQLHMEEGSRGIPATFRL
FT                   IYMIGWKEGEGQSKPLPRGSGEVNLKDILGGGDFRP"
FT   gene            558822..560833
FT                   /locus_tag="ANIA_04917"
FT                   /old_locus_tag="AN4917.4"
FT                   /product="p62 subunit of dynactin (Eurofung)"
FT   mRNA            join(558822..559168,559221..559753,559800..560833)
FT                   /locus_tag="ANIA_04917"
FT                   /old_locus_tag="AN4917.4"
FT                   /note="transcript_id=CADANIAT00005483"
FT   CDS_pept        join(558822..559168,559221..559753,559800..560833)
FT                   /locus_tag="ANIA_04917"
FT                   /old_locus_tag="AN4917.4"
FT                   /product="p62 subunit of dynactin (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005483"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005483"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005483"
FT                   /db_xref="GOA:Q5B3G3"
FT                   /db_xref="InterPro:IPR008603"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3G3"
FT                   /protein_id="CBF76484.1"
FT                   /translation="MACPFPYTFISCPCADASVPDPSRKRRSRESPHKASPVKPRPQPV
FT                   ISDDEDEDEQTFDPRAPRSNFSLYPPEQLLYCEDCHQIKCPRCITEEILCWYCPSCLFE
FT                   TPSSLVRYEGNRCGRNCFNCPSCTAPLAVTALQGDPPSGEQAGPWVLSCNYCMWTTLDI
FT                   GIKFDKPTNIRAQLSKLTTEPSSTTASRSRGASRSFGDLKSPLSMYSSIDEQLPSAGTN
FT                   QPGEEQPTNTHTPRTRDARFAALKAFYKDQMTATNTTGVDPGDFAGQFSSPNTLQRFMV
FT                   IYTQSRLFTLYGTLTPSEGLFIPNRPESEVAIIRRLASDDCGWDGVASIEQRTAQPQSF
FT                   SARFVEDLLPLPTLLRTKRSKRCKSCKHILVKPEFKPQSVRYRIKLIAISYIPLPTLRP
FT                   LVLPPSASQPLPPPPPDLNSLQPQKPIQLLLTLKNHMFDPVRITLATPSVTPGRVASKV
FT                   TILCPQFDIGANKDAWSEALEPVAPPYERVAEAGKVWEKGRNWTTVVLEVVPGSLPGLG
FT                   ARRSATGTGSNSDDDDDNADNDPDDSEDAAKGVSGQFDWSGQASDPSQQIQPDEDVLEI
FT                   PVFVRMEWDSDSPMESEEGGKDSLGAAAGLGVGGTKRELAYWMVLGVGRIVSLSAGSSS
FT                   SS"
FT   gene            complement(560961..562213)
FT                   /locus_tag="ANIA_04916"
FT                   /old_locus_tag="AN4916.4"
FT                   /product="40S ribosomal protein S7 (Eurofung)"
FT   mRNA            complement(join(560961..561561,561653..561735,
FT                   561963..562213))
FT                   /locus_tag="ANIA_04916"
FT                   /old_locus_tag="AN4916.4"
FT                   /note="transcript_id=CADANIAT00005484"
FT   CDS_pept        complement(join(561195..561561,561653..561735,
FT                   561963..562118))
FT                   /locus_tag="ANIA_04916"
FT                   /old_locus_tag="AN4916.4"
FT                   /product="40S ribosomal protein S7 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005484"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005484"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005484"
FT                   /db_xref="GOA:Q5B3G4"
FT                   /db_xref="InterPro:IPR000554"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3G4"
FT                   /protein_id="CBF76486.1"
FT                   /translation="MAAINKIAHNSPSRQNPSELETAIAGALFDLESNTQDLKATLRPL
FT                   QFVSAREVEVGHGKKAVIIFVPVPLLQAFHKIQQRLTRELEKKFSDRHVLFVAQRRILP
FT                   KPKRSVNSRTNQKQKRPRSRTLTAVHDAILDDLVYPVEIVGKRIRTKEDGSKTLKVILD
FT                   EKERGGVDHRLDAYGEVYRRLTGRAVVFEFPQGGASEF"
FT   gene            complement(562377..563898)
FT                   /locus_tag="ANIA_04915"
FT                   /old_locus_tag="AN4915.4"
FT                   /product="RAB GTPase Vps21/Ypt51, putative (AFU_orthologue;
FT                   AFUA_3G10740)"
FT   mRNA            complement(join(562377..563185,563241..563304,
FT                   563424..563626,563745..563898))
FT                   /locus_tag="ANIA_04915"
FT                   /old_locus_tag="AN4915.4"
FT                   /note="transcript_id=CADANIAT00005485"
FT   CDS_pept        complement(join(562557..563185,563241..563304,
FT                   563424..563507))
FT                   /locus_tag="ANIA_04915"
FT                   /old_locus_tag="AN4915.4"
FT                   /product="RAB GTPase Vps21/Ypt51, putative (AFU_orthologue;
FT                   AFUA_3G10740)"
FT                   /note="transcript_id=CADANIAT00005485"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005485"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005485"
FT                   /db_xref="GOA:Q5B3G5"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3G5"
FT                   /protein_id="CBF76488.1"
FT                   /translation="MSESTPANAPKPSSSVKLVLLGEAAVGKSSLVLRFVNNDFQENKE
FT                   PTIGAAFLTQKCSLPSRTIKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPSSLT
FT                   KAKHWVAELQRQASPGIVIALVGNKLDLTNDGGETPAETEREAGTEGDDADDNQEEQED
FT                   NTPGDARKVPTREASTYADEEGLLFFETSAKTGLNVTDVFTAIANAIPESSLKSGRGAG
FT                   AGTGQTTLGGGGRSTDDSRVNLGDRGAATAKEGCAC"
FT   gene            complement(574238..576003)
FT                   /locus_tag="ANIA_04914"
FT                   /old_locus_tag="AN4914.4"
FT                   /product="acetate kinase, putative (AFU_orthologue;
FT                   AFUA_3G10750)"
FT   mRNA            complement(join(574238..574288,574342..574722,
FT                   574777..574849,574974..575036,575161..575475,
FT                   575556..576003))
FT                   /locus_tag="ANIA_04914"
FT                   /old_locus_tag="AN4914.4"
FT                   /note="transcript_id=CADANIAT00005486"
FT   CDS_pept        complement(join(574238..574288,574342..574722,
FT                   574777..574849,574974..575036,575161..575475,
FT                   575556..575935))
FT                   /locus_tag="ANIA_04914"
FT                   /old_locus_tag="AN4914.4"
FT                   /product="acetate kinase, putative (AFU_orthologue;
FT                   AFUA_3G10750)"
FT                   /note="transcript_id=CADANIAT00005486"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005486"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005486"
FT                   /db_xref="GOA:Q5B3G6"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3G6"
FT                   /protein_id="CBF76490.1"
FT                   /translation="MPRKSILSVNAGSSSVKITFYSYTKTPSVIATAQVSGITAPPATF
FT                   KYSVGSKQKKEELKEKISSGPDAFKLLLHRCFTDSDLKDVASADDLAYICHRVVHGGDF
FT                   ESPVVINEETYHQLEDLEDLAPLHNFAALEIVRLCKKELPNVQSITFFDSSFHKSLPPY
FT                   VKTYPIDQETARRNKLRKYGFHGISYSFILRSVAEYLNKPVEKTSLIALHIGSGASVCA
FT                   IKDGKSIDTSMGLTPLAGLPGATRSGDIDPSLVFHYTNEAGKLSPASTKEMHISTAEEI
FT                   LNKKSGWKVLTGTTDFSQIAVEDPPSEQHKLAFDILVDRIVGYIGNYYVKLDGQVEGIV
FT                   FAGGIGEKSALLRKAVIEQTRCLGFAVDPEKNQHGPGDDETVVDITASGRSDVKRVFIC
FT                   QTDEQFEMAYNCTKTQGLDKQ"
FT   gene            576345..579185
FT                   /locus_tag="ANIA_04913"
FT                   /old_locus_tag="AN4913.4"
FT                   /product="phosphoketolase, putative (AFU_orthologue;
FT                   AFUA_3G10760)"
FT   mRNA            join(576345..576507,576696..576930,576981..577133,
FT                   577185..577494,577544..578161,578210..579035,
FT                   579091..579185)
FT                   /locus_tag="ANIA_04913"
FT                   /old_locus_tag="AN4913.4"
FT                   /note="transcript_id=CADANIAT00005487"
FT   CDS_pept        join(576345..576507,576696..576930,576981..577133,
FT                   577185..577494,577544..578161,578210..579035,
FT                   579091..579128)
FT                   /locus_tag="ANIA_04913"
FT                   /old_locus_tag="AN4913.4"
FT                   /product="phosphoketolase, putative (AFU_orthologue;
FT                   AFUA_3G10760)"
FT                   /note="transcript_id=CADANIAT00005487"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005487"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005487"
FT                   /db_xref="GOA:C8V9F5"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9F5"
FT                   /protein_id="CBF76492.1"
FT                   /translation="MPGEVIERPNPAPKPSHVPDLVEKLIIPAQKTKLEKSDCDALHKY
FT                   RRAAAYIAAGHWGTCPGLILVYSHLNYLIKKQNLDMLYVVGPGHGAPGLLASLWLEGSL
FT                   GKFYPQYTKDKEGLHNLISTFSTSAGLPSHINAETPGAIHEGGELGYALSVSFGAVMDN
FT                   PDLIVTCVVGDGEAETGPTATSWHAIKYIDPAESGAVLPILHVNGFKISERTIFGCMDN
FT                   REIVCLFTGYGYQVRIVEDLEDIDNDLHSAMSWAVEEIRNIQKAARSGKPIMKPQWPMI
FT                   VLRTPKGWSGPKELHGQFIEGSFHSHQVPLPNAKKDDEELQALQKWLSSYKPDELFTES
FT                   GDVIDEILSIIPSDDKKLGMRPEAYKTHLPPDLPDWRQFCVKKGDQFSAMKAIGSFIDQ
FT                   VFVKNPHTVRLFSPDELESNKLSAALSHTGRNFQWDEFSNAKGGRVIEVLSEHLCQGFM
FT                   QGYTLTGRTGIFPSYESFLGIIHTMMVQYAKFAKMAKETAWHHDVSSINYIETSTWARQ
FT                   EHNGFSHQNPSFIGAVLKLKPYAARVYLPPDANTFLTTLHHCLKSKNYINLMVGSKQPT
FT                   PVYLSPEEAESHCRAGASIFKFCSTDGGLRPDVVLVGIGVEVMFEVIKAAAILRERCPE
FT                   LRVRVVNVTDLFILENEGAHPHALKHEAFDNLFTEDRSIHFNYHGYVNELQGLLFGRPR
FT                   LDRATIKGYKEEGSTTTPFDMMLVNEVSRYHVAKAAVTGGARFNEKVKLRHQELCSEFD
FT                   HNIAETRKYIMNNHQDPEDTYNMPSFN"
FT   gene            580494..581550
FT                   /locus_tag="ANIA_04912"
FT                   /old_locus_tag="AN4912.4"
FT                   /product="RTA1 domain protein, putative (AFU_orthologue;
FT                   AFUA_3G10770)"
FT   mRNA            join(580494..580746,580806..580898,580961..581550)
FT                   /locus_tag="ANIA_04912"
FT                   /old_locus_tag="AN4912.4"
FT                   /note="transcript_id=CADANIAT00005488"
FT   CDS_pept        join(580494..580746,580806..580898,580961..581550)
FT                   /locus_tag="ANIA_04912"
FT                   /old_locus_tag="AN4912.4"
FT                   /product="RTA1 domain protein, putative (AFU_orthologue;
FT                   AFUA_3G10770)"
FT                   /note="transcript_id=CADANIAT00005488"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005488"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005488"
FT                   /db_xref="GOA:Q5B3G8"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3G8"
FT                   /protein_id="CBF76494.1"
FT                   /translation="MSDSNLDISNYILPNGTVPYEVRRQLQTGCHAYIDGIGTPYGYVP
FT                   SLAAGIVFLVLFGLTMVGQTVQFAWKRTWWCAVFAVGSLTEVIGWAGRTWSAECPYNTN
FT                   AFLMQITTLIIAPTFYTAGVYVLLGRFIELLGRDSSILSPRVYLIIFVTCDIISLVVQA
FT                   IGGGMASVAAAQENGNTTPGTNIMVAGIIFQMASITVFVLCAADFVRRTLVRRLLQNYT
FT                   KTIVPLLAAMVFSVLCIYVRSIYRTIELLEGWSGYLITTERFFIALDGSMMVLAVAIFN
FT                   LIHPGWFLPESGHGGKGCEDGSFTELRYLG"
FT   gene            complement(581998..583161)
FT                   /locus_tag="ANIA_04911"
FT                   /old_locus_tag="AN4911.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(581998..582743,582798..583161))
FT                   /locus_tag="ANIA_04911"
FT                   /old_locus_tag="AN4911.4"
FT                   /note="transcript_id=CADANIAT00005489"
FT   CDS_pept        complement(join(581998..582743,582798..583101))
FT                   /locus_tag="ANIA_04911"
FT                   /old_locus_tag="AN4911.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005489"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005489"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005489"
FT                   /db_xref="GOA:Q5B3G9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3G9"
FT                   /protein_id="CBF76496.1"
FT                   /translation="MAPRKNETLVSSSPKKSYAEVAKAPPPPPKPMVERIPSLARFFLV
FT                   VISSLALSSTLFTLTSPITLGELGSVSRHLEEWWEVGGLMSWKAVEVALAWALGFDGRD
FT                   VLNFVFLIHLPTYALLSSFYGLRPTAVLASYAIVLISSAVPFALLRKPSSVHNLARAPS
FT                   TAVSNRGILQDWGITVYTTILATAIYAVTLYFSYQTWLPAQLVVHFERLPSVTRVHAGP
FT                   AGLPTLFLSLLPAGWAARDFLFVSSAGTPAVQDTEIEKGKSVLPQQGEYLASTVYRKTW
FT                   GALSWRTRVLIKRTVTLATVLMANTIIQVAGTVSGASFQGASVWGFVWTTATLVVGLVY
FT                   GWIEAVDGL"
FT   gene            complement(583568..585953)
FT                   /locus_tag="ANIA_04910"
FT                   /old_locus_tag="AN4910.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(583568..584233,584284..584624,
FT                   584686..584927,584986..585345,585399..585953))
FT                   /locus_tag="ANIA_04910"
FT                   /old_locus_tag="AN4910.4"
FT                   /note="transcript_id=CADANIAT00005490"
FT   CDS_pept        complement(join(583796..584233,584284..584624,
FT                   584686..584927,584986..585345,585399..585667))
FT                   /locus_tag="ANIA_04910"
FT                   /old_locus_tag="AN4910.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005490"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005490"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005490"
FT                   /db_xref="GOA:Q5B3H0"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3H0"
FT                   /protein_id="CBF76498.1"
FT                   /translation="MFSRSIQRYLVSSTRARPWLPPRRPGRVCAMFSGQNFTQSAIPGA
FT                   PDPQDQPNQDDGKGKDNDQEPNLKSTILKMLESAATTFASIAVLGIAGYSYHKYYKYLI
FT                   LQKMENAFEPGDPALEVAGVGAKQYNHEEHWLVRDEQHKIDQIISGGIPGHYFLLIGEK
FT                   GTGKTSMLLEAMRKINGDGCAIFDAHGDQEIFRIRLGKALDFEFHEDYIGSLFSIKGPR
FT                   DTTALLDIERAFNKLEKVAMKRRSNGKAPLVLIINSTHMVRDDPDGQDLLEMIQQRAEQ
FT                   WAASNLVTTVFNSDDYWVYERLKRYATRMETIPVVDLPKEKAMAALRKYRKDYFNEHLS
FT                   DEVLKAVYDKVGGRLSYLSRVAKAPDFMKLCNDICEAEKTWFLNKCWILGEEMDDDVMD
FT                   QQKYASAAMVMAKALVDKEKAMEKTYDEEKGHILPEIPLHEARQIMTRADFIQSYDHEN
FT                   VFTINSRAMVRADSVPMQHAFREVCSQPGFEEHLEATLERISAIESLGRTRELTIKDLW
FT                   DHGKYQIAMRDTKGREQGTLEFFTKPVEKDDD"
FT   gene            586441..587491
FT                   /locus_tag="ANIA_04909"
FT                   /old_locus_tag="AN4909.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(586441..586685,586738..586810,586872..587167,
FT                   587203..587335,587424..587491)
FT                   /locus_tag="ANIA_04909"
FT                   /old_locus_tag="AN4909.4"
FT                   /note="transcript_id=CADANIAT00005491"
FT   CDS_pept        join(586650..586685,586738..586810,586872..587167,
FT                   587203..587335,587424..587491)
FT                   /locus_tag="ANIA_04909"
FT                   /old_locus_tag="AN4909.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005491"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005491"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005491"
FT                   /db_xref="GOA:Q5B3H1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3H1"
FT                   /protein_id="CBF76500.1"
FT                   /translation="MPMTWNAETEARLLLGILAQVRGVLDYKALATHMGPECSVIALRQ
FT                   HICKLRRDAGIPASSPKKARVHHSEYTPKVSKQTTSVGTSISRVKRPYCFVDHDDEEKE
FT                   DSEKDAKPIIKYEDEKKNKEEKDREPFFVDLIGDNMTVRSVWGTHVILWLNRPRELRQP
FT                   SRHLVYKITFYSYQPASYGQKHKPHTQMPANRVPTGQY"
FT   gene            587954..591898
FT                   /locus_tag="ANIA_04908"
FT                   /old_locus_tag="AN4908.4"
FT                   /product="eukaryotic translation initiation factor 3
FT                   subunit CLU1/TIF31, putative (AFU_orthologue;
FT                   AFUA_3G10800)"
FT   mRNA            join(587954..587990,588040..588105,588172..588227,
FT                   588286..589157,589537..591898)
FT                   /locus_tag="ANIA_04908"
FT                   /old_locus_tag="AN4908.4"
FT                   /note="transcript_id=CADANIAT00005492"
FT   CDS_pept        join(587954..587990,588040..588105,588172..588227,
FT                   588286..589157,589537..591898)
FT                   /locus_tag="ANIA_04908"
FT                   /old_locus_tag="AN4908.4"
FT                   /product="eukaryotic translation initiation factor 3
FT                   subunit CLU1/TIF31, putative (AFU_orthologue;
FT                   AFUA_3G10800)"
FT                   /note="transcript_id=CADANIAT00005492"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005492"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005492"
FT                   /db_xref="GOA:Q5B3H2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025697"
FT                   /db_xref="InterPro:IPR027523"
FT                   /db_xref="InterPro:IPR028275"
FT                   /db_xref="InterPro:IPR033646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3H2"
FT                   /protein_id="CBF76502.1"
FT                   /translation="MAQTNGEMEHSKESPEQITNGNNQEVVQEDDGAGGLFQISVKLPH
FT                   EPYKIQVMVSSQEQVQDVRQSIVELPGTFQYTCFHLEFNGKRINDFVELSEVPGLQADS
FT                   EIVLVEDPYTEKDARMHVVRLRELLGAAGDRVDTINGVNAGLSLHDSIAAEAGSEKSEK
FT                   EHSLAKYDIPGSSSLKTILPRSEAPAPKTVKSISLSPWNPPPHHLRQKGHLLYLQVTTN
FT                   EGEQFQITSHVSGFFVNKCSNSRFDPFPKTIPKKGSAHSLLNLISQLSPSFDAAFKELQ
FT                   ESNNQKDLLTTFPFQNSIPSSPWLVAPPASNVNAHQPDITRSQENYLISGVDNAETLRD
FT                   WNEDIVPGIFKQREPGEHQIDYGGVEGKDVVATHPDFVPVFEKLSKALRIKKHPVWDKD
FT                   NQRHDLEGSVETKGLLGTDGRKYVLDLYRVTPLDVAWNEEEDGDAYPHRMSVLRLELVE
FT                   SYWRAKMSQYVKAEVERRRAAKAEEAAKKEKSSEDTESKEEGSEEKSEEALDQERVDIS
FT                   GFSLALNPDVFSGQIPQTDEEKEQWAQDEKEVRDACDFLRSKVMPELIQDLHDGDVGFP
FT                   MDGQSLSQLLHKRGINIRYLGKLATLAKEKGSRLEALSTLLVQEMVVRAFKHITNKYLR
FT                   NVPAPFAASCVAHLLNCLLGADVNATPRAEIDSSLREIYPEGDFSFEKVTPEALRAEIE
FT                   KQVTLRYRFNLESQWFNSLRHLQLLRDIAIKLGLQLAARDFVFTKAQAEGLKVLPVANG
FT                   VNGTGQDEGSKKKKKNKNGDSGSPARSAAAEKPIVTFTPDDIVNIVPLVKDASPRSSLA
FT                   EEALEAGRISLMQNQKQLGQELILESLSLHEQIYGILHPEVAKLYHQLSMLYYQTDEKD
FT                   AAVELARKAVIVTERTLGVDSADTILSYLNLSLFEHASGNTKVALAYIKHAMDLWKIIF
FT                   GSNHPDSITTMNNAAVMLQHLKQYSDSRKWFEASLSVCESLFGKQSINTATILFQLAQA
FT                   LALDQDSKAAVGKMRDAYNIFLSQLGPEDRNTKEAETWLEQLTQNAVSIAKHAKDIQAR
FT                   RLRRINMGTRTTLGTQIQPQVGQSTADVSAPSQASNSSIDSRNIDELLKFIEGGDTSSS
FT                   RTKQKKRAAASNPKLRGSKKSSA"
FT   gene            592706..595801
FT                   /locus_tag="ANIA_04907"
FT                   /old_locus_tag="AN4907.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            592706..595801
FT                   /locus_tag="ANIA_04907"
FT                   /old_locus_tag="AN4907.4"
FT                   /note="transcript_id=CADANIAT00005493"
FT   CDS_pept        592706..595801
FT                   /locus_tag="ANIA_04907"
FT                   /old_locus_tag="AN4907.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005493"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005493"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005493"
FT                   /db_xref="GOA:Q5B3H3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3H3"
FT                   /protein_id="CBF76504.1"
FT                   /translation="MEDVRPTAKWANRMLRPLASIYHRLEKHHEIVTSVLTSKTREKIG
FT                   AAPAPDTEQRTRPPRRTKSTERGLNHSDDDDELNDPAWIPGKSMDKRRIRHNYSSRGRG
FT                   AGLGPRRRSRLLIRSPEAPKTLPGAIEIATPLITGKLRGSPLTETSPSLKMQLFQNRLS
FT                   ESSGGGSTEHRRSGRTHKAVFRPYQGSWKEILDQSGDPRLVDIAHLLDRIFLKFLGNTR
FT                   VAFDRGGARSLLSTAVRRLPDFIAEEQRIQDELEEGCDIDMCDAYFTELEAVYAPGGDG
FT                   WQPLREAVRAQGIYLVSCMIQNKWITSLAACRLLEECLKHQELDAFESLETKLLANVDT
FT                   YQHPSALDPPRPSGQRDPIQLLGSYYLRHPARHVYVFEELTKLLTRGAVPPEWMVTTLW
FT                   KKCVDKAIRSVSTEDRGYAAARRLIEAVILSSAGIYSSASPKMPPLANHRGQALRPVRP
FT                   RETRASTTTSNLSNDQSLCPIPVQDALSNLVSSLLAALCGICIARSQAVDAVARSAGLK
FT                   AREMVGDLAFTVQRAVGNETIILELEQAAFRPLRCGYVLLADCTLQCGQSGTPEVIYHC
FT                   DSGSRRNIESFFKASASRQDVVRELARLVSQVFHHFGHTQDQGPVRTPYQIRARVSQLA
FT                   QLTSTTGVALLLGKVAAETAMELAERTLDTDDHTWAVEVQEIVASSQQGETSQRSPSNS
FT                   HSITSLYRWEDTIGEWVARTPAARPRAVTTAVAGKAQLKKHRRPRMVACSTSSSSASSI
FT                   CSEESVSSVTSSAPSPEPQTPVTAYAEKPQARRRGRPRIVSRTASTSRASSTCSEEGVS
FT                   TEISSMSFEKPQVLNTGQRRRRGRPRLIASPANSLPAKSCLEDTSSVASSPASVSRKRP
FT                   CVDRDSRSWPFKKTYHTRSSERVVSKGDNPTNDPDCSSYQPSSGATHVPAAAQTNTGLR
FT                   DVLQKNPVGQGDATTRNTRMVPVPTLEVVIVNKSPSSNCAAASKHPMQPVKRRTRHSSI
FT                   TPRLSPRLPRRRQSVPARVTRRSLETVIPGPEDDSDDELSFL"
FT   gene            597285..599311
FT                   /locus_tag="ANIA_04906"
FT                   /old_locus_tag="AN4906.4"
FT                   /product="ferric-chelate reductase, putative
FT                   (AFU_orthologue; AFUA_3G10820)"
FT   mRNA            join(597285..598094,598145..598206,598253..599311)
FT                   /locus_tag="ANIA_04906"
FT                   /old_locus_tag="AN4906.4"
FT                   /note="transcript_id=CADANIAT00005494"
FT   CDS_pept        join(597434..598094,598145..598206,598253..599311)
FT                   /locus_tag="ANIA_04906"
FT                   /old_locus_tag="AN4906.4"
FT                   /product="ferric-chelate reductase, putative
FT                   (AFU_orthologue; AFUA_3G10820)"
FT                   /note="transcript_id=CADANIAT00005494"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005494"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005494"
FT                   /db_xref="GOA:Q5B3H4"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3H4"
FT                   /protein_id="CBF76506.1"
FT                   /translation="MASTLLFMSLVGHSLAADLERRHGDENPFWAALNDDLARYSLLAL
FT                   GCFAACMYMWKMWFRIAAHMRRLASFSNERQNYFVPAHPTLAKIKKHIVYAPLFRNRHN
FT                   REFQLSRAVNMGTLPSRFHTFIIVGIIAMNITLCCVTVPYKSEPDSVAGVILSRTGVMA
FT                   TVNLIPLVLLAGRNNPLITLLQVPYDTYNLIHRWLARIVVCEALAHTFAWLIPKAQSMG
FT                   WEAISQSFAHSTFIQSGLIGTCAFVALLVHSPSAVRHAFYETFLHLHIAFAVLAFAYLW
FT                   IHLDGRNAQNFLLAAIILWALERFARLVIIVYRNVGGRATTAVVEALPGDAMRITLKLS
FT                   RPWAFEPGQHMYLYIPAIGWWTSHPFSIGWSDAEDVMGDEKSLPVSSRDVYGPQKTTIS
FT                   LLVRRRTGFTDKLFQRAVSAVDCKVSLTAFAEGPYGSIHSMDSYGSVILFAGGVGITHL
FT                   VPFCRHLVKGYAEGTVAARRVTLVWIIQSPEHLEWIRPWMTSILAMNRRREVLRIQLFI
FT                   TRPRNTKEIQSPSSTVQMFPGRPNIDTLIGMEVENQVGAMGVLVCGNGSLSDDVRRACR
FT                   TRQDRTQIDFVEESFTW"
FT   gene            599963..601076
FT                   /locus_tag="ANIA_04905"
FT                   /old_locus_tag="AN4905.4"
FT                   /product="Putative uncharacterized proteinTheta class
FT                   glutathione S-transferase ;(EC 2.5.1.18)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q8NJZ8]"
FT   mRNA            join(599963..600205,600254..600307,600358..601076)
FT                   /locus_tag="ANIA_04905"
FT                   /old_locus_tag="AN4905.4"
FT                   /note="transcript_id=CADANIAT00005495"
FT   CDS_pept        join(599970..600205,600254..600307,600358..600976)
FT                   /locus_tag="ANIA_04905"
FT                   /old_locus_tag="AN4905.4"
FT                   /product="Putative uncharacterized proteinTheta class
FT                   glutathione S-transferase ;(EC 2.5.1.18)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q8NJZ8]"
FT                   /note="transcript_id=CADANIAT00005495"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005495"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005495"
FT                   /db_xref="GOA:C8V9G3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9G3"
FT                   /protein_id="CBF76508.1"
FT                   /translation="MSGVTPALRLLKGCFSQFSFNSNLRIPLKHSQLLNSASSRPYNRL
FT                   FSTTSPVMSRPDITLYTAQTPNGIKISIALEELGIPYKVEKIDISKNVQKEPWFLEINP
FT                   NGRIPALTDTFTDGQKIRLFESGSILTYLAEQYDKDYKISYPRGTREYYETISWLYFQN
FT                   AGVGPMQGQANHFSRYAPERIEYGVNRYVNETRRLYGVLDKHLANSKSGYLVGDHITIA
FT                   DISHWGWVAAAGWAGVDIDEFPHLKAWEERLAAREGVEKGRHVPSPHTIKDLLKDKKKA
FT                   EEIAAQGRAWVQEGMKNDAAK"
FT   gene            601264..603625
FT                   /locus_tag="ANIA_10615"
FT                   /old_locus_tag="AN10615.4"
FT                   /product="zinc knuckle transcription factor/splicing factor
FT                   MSL5/ZFM1, putative (AFU_orthologue; AFUA_3G10840)"
FT   mRNA            join(601264..601444,601503..601716,601770..601987,
FT                   602196..602419,602467..602575,602622..602827,
FT                   602877..603625)
FT                   /locus_tag="ANIA_10615"
FT                   /old_locus_tag="AN10615.4"
FT                   /note="transcript_id=CADANIAT00005496"
FT   CDS_pept        join(601300..601444,601503..601716,601770..601987,
FT                   602196..602419,602467..602575,602622..602827,
FT                   602877..603425)
FT                   /locus_tag="ANIA_10615"
FT                   /old_locus_tag="AN10615.4"
FT                   /product="zinc knuckle transcription factor/splicing factor
FT                   MSL5/ZFM1, putative (AFU_orthologue; AFUA_3G10840)"
FT                   /note="transcript_id=CADANIAT00005496"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005496"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005496"
FT                   /db_xref="GOA:C8V9G4"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR031150"
FT                   /db_xref="InterPro:IPR032570"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9G4"
FT                   /protein_id="CBF76509.1"
FT                   /translation="MSWRNQGITGSNNIPLGKRRFGGGEEEDSRTATPASAPGDQRGRS
FT                   PVRADPPADGVKRRKKRNRWGDAQENKAAGLMGLPTMIMANFTTEQLEAYTLHLRIEEI
FT                   SQKLRINDVVPADGDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAIKTIPN
FT                   YHPPSDYRRPTKTQEKVYVPVNDYPEINFIGLLIGPRGNTLKKMETESGAKIAIRGKGS
FT                   VKEGKGRSDAAHASNQEEDLHCLIMADTEEKVNKAKKLVHNVIETAASIPEGQNELKRN
FT                   QLRELAALNGTLRDDENQACQNCGQIGHRKYDCPEQRNFTANIICRVCGNAGHMARDCP
FT                   DRQRGSDWRNAGGFNPGRRAIGGGDAVDREMEQLMQELSGGAPGPDGQPVRRIEAGPDG
FT                   YDDRDYKPWQRAPPPSDVAPWQQRGGRDNRRDDYGSRDNGGAAPWATQGRGGNDYGYGA
FT                   GAYGAPPGAGTAAPWQQAAPPPPGQAAYGYGYPAYPPPAPGMGAPPAPPGLGAPPPPPG
FT                   MSSMYYGASGSPPPPPPGEGPPPPPPSDQPPPPPPPA"
FT   gene            603950..606411
FT                   /locus_tag="ANIA_04904"
FT                   /old_locus_tag="AN4904.4"
FT                   /product="anion transporter (Eurofung)"
FT   mRNA            join(603950..604621,604681..604829,604877..604964,
FT                   605014..605510,605558..606411)
FT                   /locus_tag="ANIA_04904"
FT                   /old_locus_tag="AN4904.4"
FT                   /note="transcript_id=CADANIAT00005497"
FT   CDS_pept        join(604206..604621,604681..604829,604877..604964,
FT                   605014..605510,605558..606411)
FT                   /locus_tag="ANIA_04904"
FT                   /old_locus_tag="AN4904.4"
FT                   /product="anion transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005497"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005497"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005497"
FT                   /db_xref="GOA:Q5B3H6"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3H6"
FT                   /protein_id="CBF76511.1"
FT                   /translation="MEPPSRTSSSHGSLHFPGSNFHSSSSPPASPHSNSQQRSWRSPSK
FT                   LFSQSRRPSGTAGTATGTGRARTEAESSAYVAGGQTPRAHEHESSNAEPKWWRIRLFRG
FT                   MIDDVKRRAPYYWSDWADAWDYRVVPATVYMYFANILPALAFSLDMFEKTHQSYGVNEV
FT                   LLASVLGSFVFSLFAAQPLVIVGVTGPITVFNYTVYDIIAPRGTPYMEFMCWIGIWSLI
FT                   MHWILAIMNACNALTYVTRFSCDIFGFYVAFIYLQKGIQVLTRQWGFAGEASAYLSIMV
FT                   ALLVLMAAWICGELGNSSLFQRYVRKFLEDYGTPLTIVFFTGFVHIGHMRNVEVATLPT
FT                   SKAFFPTADRGWLVHFWNLDVADIFLAIPFALLLTILFYFDHNVSSLIAQGTEFPLRKP
FT                   AGFHWDLWLLGLTTFVAGILGIPFPNGLIPQAPFHTAALCVTRNVADEEDTNKGKTIRV
FT                   TDHVVEQRVSNLAQGLLTLGTMTGPLLIVLHLIPQGVMAGLFFVMGVQALQANGITQKL
FT                   IFLAQDRDLTPRSDPLKGLERRRAIWAFVILELIGFGGTFAITQTIAAIGFPVIILVLI
FT                   PVRSFLLPRWFTQEELSALDGPAASPFTMESVGGVYGHTPEEEMTQSSRGEGVLLPEAH
FT                   GLTHTGAENDIEMGVYEHQARQRKNMGNQSQN"
FT   gene            606642..608267
FT                   /locus_tag="ANIA_04903"
FT                   /old_locus_tag="AN4903.4"
FT                   /product="ATP-dependent RNA helicase dbp8 (EC 3.6.1.-)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B3H7]"
FT   mRNA            join(606642..607159,607208..608267)
FT                   /locus_tag="ANIA_04903"
FT                   /old_locus_tag="AN4903.4"
FT                   /note="transcript_id=CADANIAT00005498"
FT   CDS_pept        join(606642..607159,607208..608267)
FT                   /locus_tag="ANIA_04903"
FT                   /old_locus_tag="AN4903.4"
FT                   /product="ATP-dependent RNA helicase dbp8 (EC 3.6.1.-)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B3H7]"
FT                   /note="transcript_id=CADANIAT00005498"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005498"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005498"
FT                   /db_xref="GOA:Q5B3H7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3H7"
FT                   /protein_id="CBF76513.1"
FT                   /translation="MAPLSTPESISREISVSSDASADESTSLDQMRAPKRRRLSESSTD
FT                   SYTAAPAPLPSLSRIKKKSSSTNATSSRKDDENPVLIKDALEIGLNAEENSFKALNVAP
FT                   WLVGSLTTMAVRKPTAIQRACIPEILKGRDCIGGSRTGSGKTIAFSVPILQKWAEDPFG
FT                   IFAVILTPTRELALQIFEQIKAISAPQSMKPVLITGGTDMRSQAIELAGRPHVVVATPG
FT                   RLADHINTSGTDTVAGLKRVRMVVLDEADRLLSPGPGSMLPDVETCLSFLPGPSQRQTL
FT                   LFTATLTPEVRALKSMPQTPGKPPIFVTEISTEAKDTVPPTLRTTYVQVPLTHREAFLH
FT                   VLLSTESNITKSAIVFTNTTKSADLLERLLRSLGHRVTSLHSLLPQSERNSNLARFRAS
FT                   AARVLVATDVASRGLDIPSVSLVVNFEVPRNPDDYVHRVGRTARAGRTGEAVTLVGQRD
FT                   VQLVLAIEERIGRKMVEYEEEGVNLEARVAKGSLLKEVGAAKREAMVEIDEGRDVLGRK
FT                   RNKLKKVR"
FT   gene            complement(608464..609755)
FT                   /locus_tag="ANIA_04902"
FT                   /old_locus_tag="AN4902.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(608464..609102,609151..609755))
FT                   /locus_tag="ANIA_04902"
FT                   /old_locus_tag="AN4902.4"
FT                   /note="transcript_id=CADANIAT00005499"
FT   CDS_pept        complement(join(608464..609102,609151..609549))
FT                   /locus_tag="ANIA_04902"
FT                   /old_locus_tag="AN4902.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005499"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005499"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005499"
FT                   /db_xref="GOA:Q5B3H8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3H8"
FT                   /protein_id="CBF76515.1"
FT                   /translation="MYQSSLRQSPVKEGRRILSEKNANACLSPARSPAKQTLLNAPSPS
FT                   PKKLLPSPLFAPSFVAQKRSTTEVDAEDAGSQLPESGNERRVDIGHESDAMSIDVSEQT
FT                   RQQEGEQGDIATSRTVPSDPETRKQFIQEKATLLRSRLQNAMRRVRDPQFDRRLSELEE
FT                   HSRKCPRLSAPATKPPGGVGLQQHLEQKYRTEGTGTRVQAKEDKDENGDELMLSTPRAQ
FT                   VQREKQEQREIIQIPNEDDEETTPTQNQIVQRTEAQMNGNENRAPSPTQMVLSSPTYKS
FT                   TAQAGQFDDDRPLAREATAATSPSSSVRGQGRGDGDAVDGLLKLMGTPTTEHGQGHGQT
FT                   AGASV"
FT   gene            610749..613403
FT                   /locus_tag="ANIA_04901"
FT                   /old_locus_tag="AN4901.4"
FT                   /product="glutaminase, putative (AFU_orthologue;
FT                   AFUA_3G10910)"
FT   mRNA            join(610749..611008,611059..611467,611515..612520,
FT                   612571..612701,612750..613403)
FT                   /locus_tag="ANIA_04901"
FT                   /old_locus_tag="AN4901.4"
FT                   /note="transcript_id=CADANIAT00005500"
FT   CDS_pept        join(610749..611008,611059..611467,611515..612520,
FT                   612571..612701,612750..613403)
FT                   /locus_tag="ANIA_04901"
FT                   /old_locus_tag="AN4901.4"
FT                   /product="glutaminase, putative (AFU_orthologue;
FT                   AFUA_3G10910)"
FT                   /note="transcript_id=CADANIAT00005500"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005500"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005500"
FT                   /db_xref="GOA:Q5B3H9"
FT                   /db_xref="InterPro:IPR014870"
FT                   /db_xref="InterPro:IPR032514"
FT                   /db_xref="InterPro:IPR033433"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3H9"
FT                   /protein_id="CBF76517.1"
FT                   /translation="MRLSLAVLTAALQATVGTASTLTPPVLPLIVRNPYLSTWLGNARD
FT                   VPWSKWPMFYTGEEIGLGLMAQVPSTGTVYPLLGKPHESLTESIPLEYPTYLGAKYDAS
FT                   TTNLTYSIKYLADSTPLNITVSFLSPITPTSTLRQSIPASYITVYTESEVTVNVYLDIN
FT                   GRWVSNDANSKITWQFETERASLQTSPTLQRWTLQRENQLLLSELHDRAEWGAIHLTGP
FT                   ADVQYQSGSAPSVRRTFAARGSLTNVNDAGFRTIGDREPVFAFSKSFVPSRKSGLTTDS
FT                   VTFTIALIQDPVVQYASARGLTMMRPLWKSWFNSVESLLSFHYFDFANAASLAFNYSLQ
FT                   LAEDAYQSGAQDYVDIVALSARQVMGATTFSGTPEDPILFLKEISSNGNFQTIDVIFPS
FT                   FPFFLYTNPRWLAYLLEPLIEHMLSGQYPNKYAMHDLGTHFPNATGHPDGKDEYMPVEE
FT                   CGNILIMGLAVVNSMLYDEDSAASSIWSTQGEAAPVTEDNAGFFPLNEFQTLSGIALQD
FT                   GKWGGPASGRRQAEAWIQRSYSLWTQWTGYLIEYALEPERQLSTDDFAGWLALQTNLAL
FT                   KGIIGINAMSKLAEIGGYTEDVVHYKNISDTYITKWEELGMSRDGIHAKLSYNWYGSWT
FT                   TIYNLYADAQLCFHLENTPLDRSPFSPMQDDNSQTPLNSKPQQPKQGFVPQHIYTKQSN
FT                   WYHNVRQRYGLPLDSRHLYTKTDWEFFAVAVASQSVRTEILESVAKWVNETSTDLPFTD
FT                   LHDTEGSGGFPGPNFYARPVVGGHFAFLALQRACGGKAVEGLRFLDDDTYSEKVDDAYE
FT                   DFVREDL"
FT   gene            complement(613727..615579)
FT                   /locus_tag="ANIA_10614"
FT                   /old_locus_tag="AN10614.4"
FT                   /product="telomere and ribosome associated protein Stm1,
FT                   putative (AFU_orthologue; AFUA_3G10920)"
FT   mRNA            complement(join(613727..614518,614587..614722,
FT                   614786..614950,615074..615092,615350..615579))
FT                   /locus_tag="ANIA_10614"
FT                   /old_locus_tag="AN10614.4"
FT                   /note="transcript_id=CADANIAT00005501"
FT   CDS_pept        complement(join(613969..614518,614587..614722,
FT                   614786..614950,615074..615092,615350..615370))
FT                   /locus_tag="ANIA_10614"
FT                   /old_locus_tag="AN10614.4"
FT                   /product="telomere and ribosome associated protein Stm1,
FT                   putative (AFU_orthologue; AFUA_3G10920)"
FT                   /note="transcript_id=CADANIAT00005501"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005501"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005501"
FT                   /db_xref="GOA:C8V9G9"
FT                   /db_xref="InterPro:IPR006861"
FT                   /db_xref="InterPro:IPR019084"
FT                   /db_xref="InterPro:IPR039764"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9G9"
FT                   /protein_id="CBF76519.1"
FT                   /translation="MADVRSKNLYELLGNDPELDPNREPEPPTRALDKPAPRHGKRDAP
FT                   KEAPSRPEGQTSRRGPRATGNEAAFRDRNAGSRSNREKPVDEAGKESNVRYDRGGRPAR
FT                   RDRQSRTGQADTRKQVNQGWGNQDGEKTWDDEKAADNIAKADENEPQTPAEESEEPADK
FT                   SKSFAEYLAEKAAREDLAAKPVRAPNEGTKTDKWANAKEFKRNEEEEAYIPGKEKESKG
FT                   VKQRKEKTYLDVDMRFVEPPRTGGGAPRGRGRGGRGAGRGDRGSGRGGRGNGPRSERPA
FT                   PVTVDEKNFPSLGGK"
FT   gene            complement(616307..618569)
FT                   /locus_tag="ANIA_04900"
FT                   /old_locus_tag="AN4900.4"
FT                   /product="MEAB protein
FT                   [Source:UniProtKB/TrEMBL;Acc:P87205]"
FT   mRNA            complement(join(616307..616611,616667..617161,
FT                   617215..617431,617764..618569))
FT                   /locus_tag="ANIA_04900"
FT                   /old_locus_tag="AN4900.4"
FT                   /note="transcript_id=CADANIAT00005502"
FT   CDS_pept        complement(join(616307..616611,616667..617161,
FT                   617215..617431,617764..617949))
FT                   /locus_tag="ANIA_04900"
FT                   /old_locus_tag="AN4900.4"
FT                   /product="MEAB protein
FT                   [Source:UniProtKB/TrEMBL;Acc:P87205]"
FT                   /note="transcript_id=CADANIAT00005502"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005502"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005502"
FT                   /db_xref="GOA:C8V9H0"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9H0"
FT                   /protein_id="CBF76521.1"
FT                   /translation="MVSMVEASILNHNDMAMDQVAPKSEPLNEGSISSAVSTPDPEGEV
FT                   LTQDVAQTQKRKGGRKPIYATSEERKQRNRQAQAAFRERRTEYIRQLESTIKRNEESLQ
FT                   TLQQNHRTAADECLMLRYKNSLLERILLEKGIDVQAELRLKAGTPNGPGKPSPITTKAP
FT                   SLQQAAISRSSAQRHPSGLAPKEPFSVPQSRDGGFGIPSPQFQATPPSHVSSPSHAKSP
FT                   NYGFQGALSPAGVDPQAQRSQMLTHSRNISQTSPPMSVGQPEPTEPKSAVSASMGSRAP
FT                   RLPSAYYPSPFQKHYDQLEQEYDAQADMIDDEHESSVGTSSFVPGYNPSSSVSNASHPM
FT                   NPHGMNPYNHSSGEAVNGAYGNTSAMMGNYEPMLDADPFGLSASMHFQTPFSYEQNNAR
FT                   Q"
FT   gene            620187..621801
FT                   /locus_tag="ANIA_04899"
FT                   /old_locus_tag="AN4899.4"
FT                   /product="microbody (peroxisome) biogenesis protein peroxin
FT                   19 (Eurofung)"
FT   mRNA            join(620187..620531,620607..621415,621469..621801)
FT                   /locus_tag="ANIA_04899"
FT                   /old_locus_tag="AN4899.4"
FT                   /note="transcript_id=CADANIAT00005503"
FT   CDS_pept        join(620315..620531,620607..621415,621469..621570)
FT                   /locus_tag="ANIA_04899"
FT                   /old_locus_tag="AN4899.4"
FT                   /product="microbody (peroxisome) biogenesis protein peroxin
FT                   19 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005503"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005503"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005503"
FT                   /db_xref="GOA:Q5B3I1"
FT                   /db_xref="InterPro:IPR006708"
FT                   /db_xref="InterPro:IPR038322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3I1"
FT                   /protein_id="CBF76523.1"
FT                   /translation="MASTASAAGDSQPPPEQTQQQTTTTVQSDANTQESTTTPASTEAP
FT                   KPEPSQQQQKQSGDDDGDDDSDFDELDEVLDDFKPKPQTDTPAPQPPKPPVPAPEDFDE
FT                   LAFMNQLEKDMAKMMGQAAQQSGVSDPAGFEDTINQGADAFTKQLEESGIAPGDFIKQL
FT                   LADVMAEEGEKGQSSASAPTGASVGAAPAPAGSEAGAGPESFNDAIQRTINRMKESGDK
FT                   ATAAASEDNADDLIAQLLKAMEAGGDGSGGDEGDLTKIFMGMMEQLSNKDMLYEPMKEL
FT                   DTKFGPWLKENKGKGKVSDADMERYEKQAQLVGEIVRKFEEPSYTDEDPGCREYVWEKM
FT                   QAMQAAGNPPDELVANPWMDDLKNGGGGIPDCPQQ"
FT   gene            complement(621883..624785)
FT                   /locus_tag="ANIA_04898"
FT                   /old_locus_tag="AN4898.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(621883..622228,622279..623206,
FT                   623319..623812,623887..623944,624249..624302,
FT                   624475..624700,624754..624785))
FT                   /locus_tag="ANIA_04898"
FT                   /old_locus_tag="AN4898.4"
FT                   /note="transcript_id=CADANIAT00005504"
FT   CDS_pept        complement(join(621987..622228,622279..623206,
FT                   623319..623812,623887..623944,624249..624302,
FT                   624475..624700,624754..624785))
FT                   /locus_tag="ANIA_04898"
FT                   /old_locus_tag="AN4898.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005504"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005504"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005504"
FT                   /db_xref="GOA:Q5B3I2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3I2"
FT                   /protein_id="CBF76525.1"
FT                   /translation="MAWMQEPPNKPDPHNFLSNIARQSSPSRYAILQLTCQPKPQDSRA
FT                   MITQSALRTIAHLWIVSTFLALAFDPLGIKYEVTGTHLARRITETGDSERPYEVDGNTF
FT                   IANTDSSASFSLEDCQNQQTDPPSVADGSSSMSVASVDSSDTSESEAETAASNTASSNI
FT                   DSESAESKTADNYAGELSTTESDADGSDNSEPTTVSVAASGAVESEATGSERASDTGDS
FT                   DTGGSDTTGASDTTESNAAGSNPAEADSGESGADETEAGHTKTETMEASPVLVAQTTIP
FT                   YDSEFDLRARGSAFPSAFLQSPFITRGHRCDPIYYPSLPTSYSSKRATVGSGTSSAAIY
FT                   QELFVLLVIQAAFRSYNLRESQSPTRQPPFHHRYNLRRQRAKLLLSYQAIAMFAALAPM
FT                   QPVSNNPSQYPWTPVHPSPLSPRRLSTTAAPFAAAAAASTPTPQPQFQPPVFTFTPSPS
FT                   PNQRNLGVTSPSRNLKANADANANTNGTTSPTPSSTYANRYRNTISNPLFAHSTKRTYT
FT                   SSASPRARSVRRNAFLNRVKQDRDNGRVDARAEQLAYMDDIAEQKEWAESMKRRAEEIQ
FT                   AEYGLGIEEWEGEDEYECLDAGVADEAAIRALDEYIEQERAMEMALLEGVDGDTNMSAG
FT                   HLPGGTGHKANDAASSFSDEEYDNIFMDLVDHNPPEDTEMSG"
FT   gene            complement(624967..626488)
FT                   /locus_tag="ANIA_04897"
FT                   /old_locus_tag="AN4897.4"
FT                   /product="cell wall protein, putative (AFU_orthologue;
FT                   AFUA_3G10960)"
FT   mRNA            complement(624967..626488)
FT                   /locus_tag="ANIA_04897"
FT                   /old_locus_tag="AN4897.4"
FT                   /note="transcript_id=CADANIAT00005505"
FT   CDS_pept        complement(625418..626233)
FT                   /locus_tag="ANIA_04897"
FT                   /old_locus_tag="AN4897.4"
FT                   /product="cell wall protein, putative (AFU_orthologue;
FT                   AFUA_3G10960)"
FT                   /note="transcript_id=CADANIAT00005505"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005505"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005505"
FT                   /db_xref="GOA:Q5B3I3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3I3"
FT                   /protein_id="CBF76527.1"
FT                   /translation="MRVTALPFFLYSLSLVAVVAGQSTQVTDSISDVTDALPTPTQTSA
FT                   TDTDSDTETTTSESSSTTTTEPTTTSSSTSSSDDETSSGTTTSSSSTSTSDPTTTTTSD
FT                   TDTTTTSSSTDPDPTTTSTSSSDDDSSTTRTPTVTTITTTQTIDGTPVPTTYTSTNSEA
FT                   SESTESPGLSGSSGDSDSGLDSNQKKIIIGVVVGVGGAILIGAIGVVAWRIRARRRAAA
FT                   DDDATDLMSGTAVGSGVREKAPSPSGGTPFRSTLDQYHNPGPVNAASNF"
FT   gene            630036..631413
FT                   /locus_tag="ANIA_04896"
FT                   /old_locus_tag="AN4896.4"
FT                   /product="protein-tyrosine phosphatase 2 (AFU_orthologue;
FT                   AFUA_3G10970)"
FT   mRNA            join(630036..630204,630272..630537,630589..631413)
FT                   /locus_tag="ANIA_04896"
FT                   /old_locus_tag="AN4896.4"
FT                   /note="transcript_id=CADANIAT00005506"
FT   CDS_pept        join(630036..630204,630272..630537,630589..631413)
FT                   /locus_tag="ANIA_04896"
FT                   /old_locus_tag="AN4896.4"
FT                   /product="protein-tyrosine phosphatase 2 (AFU_orthologue;
FT                   AFUA_3G10970)"
FT                   /note="transcript_id=CADANIAT00005506"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005506"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005506"
FT                   /db_xref="GOA:C8V9H4"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9H4"
FT                   /protein_id="CBF76529.1"
FT                   /translation="MAHPTIKIDTSVQANKRSHPDNEDGVGVVDGSDDDNPEMELGDNE
FT                   HVPPFLRQSVLDIRHKFEELEYMQGTRILEGSRANDPSHRWALDADPEVRARNRYANVQ
FT                   AWANSRIHLRVPEGECDFINASPIVLRDSVSQEERKYIATQGPRLDDLYHFWNMVFHET
FT                   GEVAVVVMLTQTMEAGREKCSQYFPLEIENPMYLRQDNSNPHLESEQQELEGGDVLGHI
FT                   TLLESTWDLECRSEIRRLQLTLGSDSKTVWHFLFAGWADYSKPVGDDRDALLHLIKLSA
FT                   SKASSPQNPRIVHCSAGVGRTGTFIALDHLLQELESGQLLKVTDEDIDPVFETVNLMRE
FT                   QRMMMVYNEMQLIFIYEVLREQVDIILEKTYGISRQRSVARSAKIAKLSEEDYLPAPKP
FT                   ELEAAGDLSDTRAPEHSDTD"
FT   gene            complement(632653..633402)
FT                   /locus_tag="ANIA_04895"
FT                   /old_locus_tag="AN4895.4"
FT                   /product="VanZ domain protein, putative (AFU_orthologue;
FT                   AFUA_3G10980)"
FT   mRNA            complement(join(632653..633266,633378..633402))
FT                   /locus_tag="ANIA_04895"
FT                   /old_locus_tag="AN4895.4"
FT                   /note="transcript_id=CADANIAT00005507"
FT   CDS_pept        complement(join(632653..633266,633378..633402))
FT                   /locus_tag="ANIA_04895"
FT                   /old_locus_tag="AN4895.4"
FT                   /product="VanZ domain protein, putative (AFU_orthologue;
FT                   AFUA_3G10980)"
FT                   /note="transcript_id=CADANIAT00005507"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005507"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005507"
FT                   /db_xref="GOA:Q5B3I5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3I5"
FT                   /protein_id="CBF76530.1"
FT                   /translation="MRIRYPFAGAFIFLLILSAYIGLLPHSESSSIPANLQPNDKLLHV
FT                   VIFFLISLIFYWIPDTSRRRTLHLTLVVCTLALGVGSEILQGILPNGRSFDPFDLLANI
FT                   VGSLGAVGLCGWYHRRMLERRRKSRFGSLGEGGEDDVELGMSPDHREREQLEPQESGVV
FT                   NLEQEVDNWDENAVDTWDTEDGDDPSSGLTGKAAADKDQKGLAEGKRND"
FT   gene            634021..638034
FT                   /locus_tag="ANIA_04894"
FT                   /old_locus_tag="AN4894.4"
FT                   /product="transcriptional activator spt7 (AFU_orthologue;
FT                   AFUA_3G11000)"
FT   mRNA            join(634021..635092,635142..636268,636317..637002,
FT                   637056..637119,637281..638034)
FT                   /locus_tag="ANIA_04894"
FT                   /old_locus_tag="AN4894.4"
FT                   /note="transcript_id=CADANIAT00005508"
FT   CDS_pept        join(634021..635092,635142..636268,636317..637002,
FT                   637056..637119,637281..637634)
FT                   /locus_tag="ANIA_04894"
FT                   /old_locus_tag="AN4894.4"
FT                   /product="transcriptional activator spt7 (AFU_orthologue;
FT                   AFUA_3G11000)"
FT                   /note="transcript_id=CADANIAT00005508"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005508"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005508"
FT                   /db_xref="GOA:Q5B3I6"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR006565"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR037782"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3I6"
FT                   /protein_id="CBF76532.1"
FT                   /translation="MSLGHHNAWLPPGHLRPPDDMHDARTFNGYPKPFSGSRTPQMRGS
FT                   IDADGPHTGNLISEADTVSEEDPRIALFRDLYTRTEAKINGLFSGEKLPEDTLDDAVAV
FT                   LEGAEAEDKRAHEPAPPKKPARKLDDDDYDDYDDDDDDDDAKPASSPALKVSAPAQQPT
FT                   ALPSPGRPFSASMPAAGESTKEAKKESLEDIRKKLEEDKKATEEAAKRSFHTLFYTLEN
FT                   DRDAMLDQQRLEESERQVEAEMSGQASAGNNAASGSSGHGSLSSANLGASSLTLKNLIA
FT                   RIDMKRNMVQASDAELRSLMSEVRKNRSKWASEDKIGQEELYEAAEKVLSELKAMTEHS
FT                   SAFLTRVNKRDAPDYYNVIKHPMDLGTMTKKLKALQYKSKQEFVDDLNLIWSNCFKYNT
FT                   NPEHFLRKHAMYMKKETEKLVPLIPDIVIRDRAEVEAEERRLQLADDGGEESDDEPIMS
FT                   SRGRKAPGKSSKKGAAPASKTPSGSEPPAGSGSQPSAPVRSDSDAAVEGVQNGFATPPP
FT                   GTSTPSDPAGAGLATSGGQDDSMDLDGLVTPPTALSALATPGVELADPEYKVWKQVTKK
FT                   DRALIAAERHRLFKGDKLNSDEPALLRTKAGMRRWLRNQHQISTDGDSSNDLGPKPNAA
FT                   SETLAEGIEVEEDRVIPDYYDVMSGIPDLPPHLLWREDSEGNLVDNSEDFLRVLPKGLF
FT                   TQPDSKLSRKMDANMRQMQETRKICSKIGIVKQMQLQSQMYQNQFQKYQPEPFVEQDVE
FT                   AHVMNDNGPVIAPWVCKAALQRSVAKIFYHTGFEEYQPSAIDAATDMASDFFVKIGQTL
FT                   KSYMEAPKVPVADSVEATSSPQWKRAYTEPEMMLHTLSSVGIDIEGLESYIKDDVERLG
FT                   TKLVTAHDRLRSLLSELLRPVLQDGGEDGSMAFADGSEQFVGGDFAEDIDEDFFGFKEL
FT                   GLDKEFGLATLSVPLHLLQNRMYNAAQAQNTNTSQSVTVFPPPPPYPRITTENSSWTNF
FT                   ESTEAATAAFSSWIQRYKPGSSEPNKKKVKKNSGVAMGVADAPGEDEAATGTNGAKAPN
FT                   LKSEGSSNDLINGNAGAETLDAPGAEDSTNADQVKGNDNAVPITNGTAGDAA"
FT   gene            complement(639083..640056)
FT                   /locus_tag="ANIA_04893"
FT                   /old_locus_tag="AN4893.4"
FT                   /product="eukaryotic translation initiation factor eIF-2C4,
FT                   putative (AFU_orthologue; AFUA_3G11010)"
FT   mRNA            complement(join(639083..639279,639334..639623,
FT                   639941..640056))
FT                   /locus_tag="ANIA_04893"
FT                   /old_locus_tag="AN4893.4"
FT                   /note="transcript_id=CADANIAT00005509"
FT   CDS_pept        complement(join(639083..639279,639334..639623,
FT                   639941..640056))
FT                   /locus_tag="ANIA_04893"
FT                   /old_locus_tag="AN4893.4"
FT                   /product="eukaryotic translation initiation factor eIF-2C4,
FT                   putative (AFU_orthologue; AFUA_3G11010)"
FT                   /note="transcript_id=CADANIAT00005509"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005509"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005509"
FT                   /db_xref="GOA:Q5B3I7"
FT                   /db_xref="InterPro:IPR003165"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3I7"
FT                   /protein_id="CBF76534.1"
FT                   /translation="MAQSETRNAGDPSLDRLRLLTDMCRNIDLPYGTFSIDYYGTNDAS
FT                   FEIYIHLPPGDHNSVDKNGNPLPGTLIERDVTSPHDWDFLLYSHIALQGNSRPVHYHVV
FT                   LDEIKHRPQELQNMIYDHCYQYMRSTTSVSLFPAIYYAHLISNRARHHDDAPASSGPQS
FT                   GPEVKLTNPKPKEKKADPRLLPIHGTSNRLPFGMWYI"
FT   gene            complement(642939..646655)
FT                   /locus_tag="ANIA_04892"
FT                   /old_locus_tag="AN4892.4"
FT                   /product="mRNA 3'-end-processing protein rna14
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B3I8]"
FT   mRNA            complement(join(642939..643138,643280..644008,
FT                   644056..645055,645105..645536,645584..646492,
FT                   646554..646655))
FT                   /locus_tag="ANIA_04892"
FT                   /old_locus_tag="AN4892.4"
FT                   /note="transcript_id=CADANIAT00005510"
FT   CDS_pept        complement(join(642939..643138,643280..644008,
FT                   644056..645055,645105..645536,645584..646450))
FT                   /locus_tag="ANIA_04892"
FT                   /old_locus_tag="AN4892.4"
FT                   /product="mRNA 3'-end-processing protein rna14
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B3I8]"
FT                   /note="transcript_id=CADANIAT00005510"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005510"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005510"
FT                   /db_xref="GOA:Q5B3I8"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR008847"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3I8"
FT                   /protein_id="CBF76536.1"
FT                   /translation="MAEDDAEKAFFEAQAMNAGSMGYNGAEDQNANASDSDEYDPSSTL
FT                   QDQYPAPSENLQLQETDTPTSVSQPQPSFREDADPAGNAHPSQPPSRPESQASTSVPAT
FT                   GVSVQPKTRTIGGFVVEDEDEDDAGDADYEPPAVLGVEDMNIIPSQPIPGNANEATSTP
FT                   DVSLDEAAQESASAKNVPNSSLSSVSLAFKNDGSMDLGQNLYNSRTSLQPEIARESATA
FT                   TPAPDSPSTAKGRLPHDRVGILEDRIREDPRGDIPAWLELINEHRSRNRIDSARDVYER
FT                   FLKVFPLSAEMWVAYATMESELNELFRLEQIFNRTLLTIPAVQLWTVYLDYVRRRNPLS
FT                   TDTTGQARKVISSAYELALQHIGMDKESGSIWADYIQFIRSGPGNVGGSGWQDQQKMDL
FT                   LRKAYQRAICVPMQAVNTLWKEYDQFEMGLNKLTGRKFLQEQSPSYMTARSSYTELQNF
FT                   TRDLNRTTLPRLPPVPGSEGDFEYLQQIEIWKRWINWEKGDPLVLKEDDLTAYKGRVVY
FT                   VYKQALMALRFLPEIWFEAADFCFLNDMETEGNEFLKNGIDANPESCLLAFKRADRLEI
FT                   TSESEQDPIKRGAKVREPYDRLLDALYDLIAKARTREAQDVARLEETFKLRPDTQPAAN
FT                   DDDDDDQSETKAKESVKNAQIEAVRHAHSIQIGILSKTVSFAWIALMRAMRRIQGKGKP
FT                   GEVPGSRQVFADARKRGRITSDVYIASALIEYHCYKDPAATKIFERGAKLFPEDENFAL
FT                   EYLKHLIDINDIINARAVFEMTVRKLAANPENVHKTKPIFAFLHEYESRYGDLVQVINL
FT                   ETRMRELFPDDPTLEQFAHRFSAPNFDPTTFRPIISPSQTRPKTVYPGGQVPSRHGTPS
FT                   SRFPEASVTNSPKRPLEDFDDDMSRPRKFVRGESPLRTTTQRRQLDQQKRTQTALQVPS
FT                   SGSQYRSQGSPAPLPRDIVYLLSVIPPASTYTAGRFSAEKMIDLVRRLDLPASISQIPL
FT                   PQSARGLGTGQTTIGGQQFSDDGGYYYKGGVVDMCALHFMDDGVFRLYVAGLAGNILAR
FT                   ILFFGSGGLLAYLLRTVQIWDPEIPRR"
FT   gene            647018..648015
FT                   /locus_tag="ANIA_04891"
FT                   /old_locus_tag="AN4891.4"
FT                   /product="Histone chaperone asf1 (Anti-silencing function
FT                   protein 1) [Source:UniProtKB/Swiss-Prot;Acc:Q5B3I9]"
FT   mRNA            join(647018..647126,647183..647222,647270..647578,
FT                   647634..648015)
FT                   /locus_tag="ANIA_04891"
FT                   /old_locus_tag="AN4891.4"
FT                   /note="transcript_id=CADANIAT00005511"
FT   CDS_pept        join(647018..647126,647183..647222,647270..647578,
FT                   647634..648015)
FT                   /locus_tag="ANIA_04891"
FT                   /old_locus_tag="AN4891.4"
FT                   /product="Histone chaperone asf1 (Anti-silencing function
FT                   protein 1) [Source:UniProtKB/Swiss-Prot;Acc:Q5B3I9]"
FT                   /note="transcript_id=CADANIAT00005511"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005511"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005511"
FT                   /db_xref="GOA:Q5B3I9"
FT                   /db_xref="InterPro:IPR006818"
FT                   /db_xref="InterPro:IPR017282"
FT                   /db_xref="InterPro:IPR036747"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3I9"
FT                   /protein_id="CBF76538.1"
FT                   /translation="MSVVSLLGVKVLNNPAPFTSSYQFEITFECLEQLQKDLEWKLTYV
FT                   GSATSSEYDQELDSLLVGPIPVGVNKFIFEADPPDLRRIPTSEILGVTVILLTCSYDGR
FT                   EFVRVGYYVNNEYDSEELTADPPAKPIIERIRRNILAEKPRVTRFAIKWDTEESAPAEY
FT                   PPDQPEADGLDDDGAAYGQEEAELEAALLKELQEAEKNESTKGEDHDMEGADNGEEDIS
FT                   DAESEDIEDESDDDEDEVDEEEGNDADEDVEMGDDSEPKDDNANPAAHHSQQEVMVH"
FT   gene            complement(648849..652306)
FT                   /locus_tag="ANIA_04890"
FT                   /old_locus_tag="AN4890.4"
FT                   /product="Putative SNARE-dependent exocytosis protein Sro7
FT                   (Eurofung)"
FT   mRNA            complement(join(648849..648982,649047..649328,
FT                   649379..649500,649547..650102,650148..651728,
FT                   651774..652113,652177..652306))
FT                   /locus_tag="ANIA_04890"
FT                   /old_locus_tag="AN4890.4"
FT                   /note="transcript_id=CADANIAT00005512"
FT   CDS_pept        complement(join(648957..648982,649047..649328,
FT                   649379..649500,649547..650102,650148..651728,
FT                   651774..652113,652177..652263))
FT                   /locus_tag="ANIA_04890"
FT                   /old_locus_tag="AN4890.4"
FT                   /product="Putative SNARE-dependent exocytosis protein Sro7
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005512"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005512"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005512"
FT                   /db_xref="GOA:C8V9S7"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013905"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9S7"
FT                   /protein_id="CBF76540.1"
FT                   /translation="MAHFLRGKQAGIQKDFSGSLAPELFDIDDLLRCGINSQTSALAYD
FT                   PVQSLLAVGTSESQFGHGQVYVFGQGRVSVIFSLPRKASAKFLQFCGDKLISVDSKSEI
FT                   SVFSLETKKLLVSYAPPSIASALLSDPSLDYAFIGLQNGDVIAYDLDRETVTPYKISNL
FT                   WAQRNPRARICPVISLAFSPRDIGKILIGYPDGAVTFSFKQNVAQHYFEYEVPPGALGG
FT                   NGIAPYRDIRKPKLTKALWHPNGIFILTVHDDNSLVFWDTKDGRKLLARSITTPNIDQP
FT                   GVGPRGPAAPESAISLKDPITDVAWCVKANGDDSGLLIAGGKPKDERCKNLTFIDLGPS
FT                   PNYQTSSWAMITTYLENPKTIAEISIPPGAEVVRFCLIPRNSPYYGGAHDPIAILALLT
FT                   SGELITLSFPSGHPIPPTNMLPPSLTLIHPFVNKITLTPVDRADWLGLKERRSQGPKFI
FT                   LGGAEERKQLKRLESRNIITAAHADGTVRIWDVGHDDEIENSELIQVDLARALGRVGVV
FT                   DVTEMSLGGSSGELSVGLRSGEVAIFRWGSNQNFGLEQPPGTNNGPGELTDITHRTDPS
FT                   LKHGLLPLTLLSMQQGPVTALKHSPIGFVAAGFEGGSIAIIDLRGPAIIHTANISELSK
FT                   QNKRSSFLKTRSSSETIPEVPTAIEFGILTLEGEEFSSICCFVGTNRGNLATFKILPSS
FT                   GGAFVASFAGAVALEDKIINIIPINADDGSLALATGKAFGGLRNGTRVHGAVVAVTVNS
FT                   CRIFKPATSKGAHRSWDDYLCDSASVVNLPGRGCSLVGLFGDGNARAFSIPGLKEIGCA
FT                   KIGHMADMSRLSQSTVSPNGSVLFWTSPSEIGLINVWGAGIELRPSEDQLFNPQAVSPP
FT                   RPTITNLQWISGTQYISTADMDILIGGPDRPPSKRMIEQMRLEEQERRQAAREGRSTPA
FT                   RQNTNDEGYFAYMQRQVQERTEKLSFAGDNMDRLEETSSGWARDVNKYVQNQKKKAVLG
FT                   VLGSKFGL"
FT   gene            complement(652765..653794)
FT                   /locus_tag="ANIA_11253"
FT                   /old_locus_tag="AN11253.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(652765..652891,652950..653794))
FT                   /locus_tag="ANIA_11253"
FT                   /old_locus_tag="AN11253.4"
FT                   /note="transcript_id=CADANIAT00005513"
FT   CDS_pept        complement(join(652765..652891,652950..653794))
FT                   /locus_tag="ANIA_11253"
FT                   /old_locus_tag="AN11253.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005513"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005513"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005513"
FT                   /db_xref="GOA:C8V9S8"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9S8"
FT                   /protein_id="CBF76542.1"
FT                   /translation="MFPPLPAPSDPEKEVSDKLVSILRRHFLVPIHVDRIWPLAGHLHS
FT                   FYLVQLSNETHLLLKCSPKPTTPLIRREHIMLDTEARALSLLSHMPCIPQLLHYDPLGD
FT                   LLGPSFLLRHYIPGTSLDKIDSQLSIQERDSIERSLGLLAKRIAQHTSESFGSLGQVAS
FT                   AGGTKSWREGFLILFEGLLRNAEDVFINLPYGEIRYQVHRASPALDEILTPRLVVIDFG
FT                   QPSQVLVNESKRLCGISSFRTAVWGDVFMAKIFENPSPSVIDGFGSCYAKTQTGGTRQL
FT                   LYSCYRAVNDVVLQYYRKSRDTAAEIKARRELMTALAKMAAV"
FT   gene            complement(654721..655814)
FT                   /locus_tag="ANIA_04889"
FT                   /old_locus_tag="AN4889.4"
FT                   /product="THUMP domain protein (AFU_orthologue;
FT                   AFUA_3G11060)"
FT   mRNA            complement(join(654721..654822,654872..655012,
FT                   655072..655286,655340..655496,655559..655687,
FT                   655773..655814))
FT                   /locus_tag="ANIA_04889"
FT                   /old_locus_tag="AN4889.4"
FT                   /note="transcript_id=CADANIAT00005514"
FT   CDS_pept        complement(join(654721..654822,654872..655012,
FT                   655072..655286,655340..655496,655559..655687,
FT                   655773..655814))
FT                   /locus_tag="ANIA_04889"
FT                   /old_locus_tag="AN4889.4"
FT                   /product="THUMP domain protein (AFU_orthologue;
FT                   AFUA_3G11060)"
FT                   /note="transcript_id=CADANIAT00005514"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005514"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005514"
FT                   /db_xref="GOA:Q5B3J1"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR040183"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3J1"
FT                   /protein_id="CBF76544.1"
FT                   /translation="MSESPANHSHKKRKGGNSWQKHTPRSTIETGDWGVFVTCERGREN
FT                   KCAAEVIDLFTENVDLPGRGGDEAEYGSEEDDIEAQIRKEIEGLKPSTSKKSSLFEAVK
FT                   FDLPCIIFVRFDKSINPEKLVHRICLDSHASPEQKRSRYIQRLTPARSIRKTLSVDLPE
FT                   FAKEMLKAEFHSGGPPKKYAIRPSVRGNKKFDRDTIIKTVADIVGPEHPVDLKNYDLLI
FT                   LVDIVQNVMSMSVVGSDYDKLKRFNLAELYNPEPTPQEP"
FT   gene            656298..658453
FT                   /locus_tag="ANIA_04888"
FT                   /old_locus_tag="AN4888.4"
FT                   /product="Pyruvate decarboxylase (EC 4.1.1.1)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P87208]"
FT   mRNA            join(656298..656487,656549..656629,656690..657917,
FT                   657970..658177,658229..658453)
FT                   /locus_tag="ANIA_04888"
FT                   /old_locus_tag="AN4888.4"
FT                   /note="transcript_id=CADANIAT00005515"
FT   CDS_pept        join(656382..656487,656549..656629,656690..657917,
FT                   657970..658177,658229..658312)
FT                   /locus_tag="ANIA_04888"
FT                   /old_locus_tag="AN4888.4"
FT                   /product="Pyruvate decarboxylase (EC 4.1.1.1)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P87208]"
FT                   /note="transcript_id=CADANIAT00005515"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005515"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005515"
FT                   /db_xref="GOA:P87208"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:P87208"
FT                   /protein_id="CBF76546.1"
FT                   /translation="MADIATRELRQPIDIAEYLFRRLHEVGIRSVHGVPGDYNLAALDY
FT                   LPKCGLHWVGNCNELNAGYAADGYARVNGIAALVTTFGVGELSAINAIAGAYSEFVPII
FT                   HIVGQPHSRSQKDGLLLHHTLGNGDYNVFSSMNKGISVTTANLNDTYDAATLIDNAIRE
FT                   CWIHSRPVYLALPTDMITKKIEGERLKTPIDLSLPANDPEKEDYVVDVVLKYLHAAKNP
FT                   VILVDACAIRHRVLEEVHDLIEVSGLPTFVAPMGKGAVNETHRCYGGVYAGTGSNPGVR
FT                   EQVESSDLILSIGAIKSDFNTAGFSYRIGQLNTIDFHSTYVRVRYSEYPDTNMKGVLRK
FT                   VIQRLGFIKADPVPHISNALPEHEKNSSEQRITHAWMWPMVGQWLKENDIVITETGTAN
FT                   FGIWDTRFPSGVTAISQVLWGSIGYSVGACQGAALAAKEQGNRRTVLWVGDGSLQLTLQ
FT                   EISTMIRNNLNPIIFVICNEGYTIERFIHGWDESYNDIQTWDIKGLPVAFGGKGRYKGY
FT                   KVTTRDELTKLFASEEFSSAPCLQLVEVHMPREDAPASLKITAEAAASRNK"
FT   gene            659394..665036
FT                   /locus_tag="ANIA_04887"
FT                   /old_locus_tag="AN4887.4"
FT                   /product="mitogen-activated protein (MAP) kinase kinase
FT                   kinase (Eurofung)"
FT   mRNA            join(659394..662094,662152..664003,664069..665036)
FT                   /locus_tag="ANIA_04887"
FT                   /old_locus_tag="AN4887.4"
FT                   /note="transcript_id=CADANIAT00005516"
FT   CDS_pept        join(659394..662094,662152..664003,664069..664192)
FT                   /locus_tag="ANIA_04887"
FT                   /old_locus_tag="AN4887.4"
FT                   /product="mitogen-activated protein (MAP) kinase kinase
FT                   kinase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005516"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005516"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005516"
FT                   /db_xref="GOA:C8V9T1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9T1"
FT                   /protein_id="CBF76548.1"
FT                   /translation="MDGQRQQPYVPAPPPSASQPSQAHIMPLPPPPPRYPPAQPQNVMP
FT                   PPPPGPPPGSAYGTSKLTNPQLQSQSTLGWSNWGGRGIPQYLPPPPPPPMTHANQSSFA
FT                   RPSAVQNNNATSATYVPQPGTFGPGVGIPPFDVPSHSYDAPNTMVASERPRPPPNAPYG
FT                   HGTSNASAYQLDGTIPSTPLTHTAPFSHETSHDVPSSAVPTGSPFKSVPQSASQANDLT
FT                   KSSSHRHNNSNTTVGGMSASEAAVQWPLDRVLLWLAKNGFSHEWQETFKTLEIEGADFL
FT                   ELGHGQNGRPNLGKMHTVVYPQLAKECEANGTAFDLTRERDEGKRMRKLIRLIHDDAGP
FT                   DNGGTFNKQHDFDDGHGSVPDEGPEFSPNINNVAQAPGSPSLNATNVSNSPNLKAPKYS
FT                   HKPRSFTTPGSISHDSTTAELAMTEGSSTMLPRSDFSRNVLGTIGIDHQRKSPSMSSDN
FT                   GVFAIPPHRPHEGSPKSGSPAAQHATLYAAPVSSATDLNAKYDARFGHNRVNSGERRYY
FT                   ETLKHDGSRPSPQTTQTAGDNASSYPKDHRMGFLNFFKKKSARNSDPNNPSPDDNTPDS
FT                   PIYSKYHFNSSDVSVNERPLSASLSDYERMMMVRTKPAHRGKRFIFATMDGWNYRLIDT
FT                   TDIDSVEKLRASICQNLGIYDWPDAQIFLTEPGQLEHDEPLNDTFLTLCQRSKSDSIGS
FT                   LKLFVKTPHNVAGLGVSMPDRSAVSPTSAIPRKPLDGEAASRLSPLKPSSPQQLKPPAS
FT                   RLPLRDIQNSAAGTSPVDGEPDGSLQDQERKPQKSYRPTPAPLPRPDAYSETGYRRKEV
FT                   INFDKPRISPYEDKKSEVLVPFRKPPSAPQESNTLSKVNSLRKKDGDRPRPHRSNQPPG
FT                   IKEMMADMGMMSSLIGKPSSPNSGNTTATEDAHSSIDSAVDKSSQSTPPLTNTSYSPTT
FT                   TATTTTTTTTASSSLSRSASQKRKSVGPEFDFEETQVSFQRSPALEEDSDDDSDDGLFA
FT                   IPLANTKNSVKPGSPDTQARPRKPSLTVDTEAKPRTGLSVSFKSPSATRETFASSGGDA
FT                   SNSTAPYFIASNSPEEEKTPIRRNSLRNSFATGDVWASRPPVEGVIDQLDDFFPDIDLD
FT                   APYLDEQGTSPPSSPASKVAIDNELNRKDKQENSHHGMQPPPAPEDNTLGSSEPTMTSH
FT                   GQGIVARRNVSRSGGGLTRMKSIREVAKGANQATRQRSVAASSGNKRSGDVHRRKSTKM
FT                   FGAKIMQISPRRGSQLSQLDPIPQNSISSSSKPQRQPTFRIIRGQLIGKGTYGRVYLGM
FT                   NADNGEVLAVKQVEINPRLAGQDTDKIKEMVAALDQEIDTMQHLEHPNIVQYLGCERGE
FT                   LSISIYLEYISGGSIGSCLRKHGKFEESVVKSLTRQTLEGLSYLHNQGILHRDLKADNI
FT                   LLDLDGTCKISDFGISKKSNDIYGNDSSNSMQGSVFWMAPEVIQSQGQGYSAKVDIWSL
FT                   GCVVLEMFAGRRPWSKEEAIGAIFKLGSLSQAPPIPDDVSMNVTPAALAFMWDCFTVDT
FT                   SERPTAQTLLTHPFCEPDPKYNFLDTELYAKIRPVLEN"
FT   gene            complement(664566..667178)
FT                   /locus_tag="ANIA_04886"
FT                   /old_locus_tag="AN4886.4"
FT                   /product="Golgi complex component Cog3, putative
FT                   (Eurofung)"
FT   mRNA            complement(join(664566..665363,665416..666438,
FT                   666492..666831,666889..667178))
FT                   /locus_tag="ANIA_04886"
FT                   /old_locus_tag="AN4886.4"
FT                   /note="transcript_id=CADANIAT00005517"
FT   CDS_pept        complement(join(664566..665363,665416..666438,
FT                   666492..666831,666889..667097))
FT                   /locus_tag="ANIA_04886"
FT                   /old_locus_tag="AN4886.4"
FT                   /product="Golgi complex component Cog3, putative
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005517"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005517"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005517"
FT                   /db_xref="GOA:C8V9T2"
FT                   /db_xref="InterPro:IPR007265"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9T2"
FT                   /protein_id="CBF76549.1"
FT                   /translation="MAPQIAGQRSRRQTAPSGMPLNLEAAQIEELETIPGKLDSIVDIH
FT                   NELEFSQWYEDVEASLLESSYDEYQACLNELQTSKSHLDVLLSDTSSTLDILSRLSEDF
FT                   RAVGLQTSNFRKQCEGLLSAQKRDTDLITKIDYNLQFYDFLDPASRRLNAPGAGNTVRG
FT                   QDFSDMLRQLDECLDYMETHPEQKEAEVYRSRFRLLLTRALTLIRGHFVSAIRDLYSNV
FT                   SKKVSDKQLNDAALSALLYAKFRVDAPELKQIGLEIQKRAVPPLDPDQGTEAEYQSLLN
FT                   ELHTNYAATREKLIVPLVRKRLNEIAQAPSSSQDLVAFARASISYVRGVCLDEFDLWGE
FT                   WFHGQGGLYDFLETICEPLYDHLRPRIIHEDKILKLCQLCTLLQTRYLFDQEEETEYMD
FT                   ANQLDFSALIQPALEDVQTRLVFRAQAFLRDEIERFKPRPEDLDYPARNKQLSISVSEK
FT                   QISGRKVSHVDAYINPPKHTKSNEEGADVPEKDSRWDFESQNAPAAWYPTLRKAVWLLS
FT                   RIYRLVNSTVFDDLAHQIVHQTTASLHLASASISSKSSTDGQLFLMSHLLILKQQIVAF
FT                   DIEYVAPEVSFDFSGVTNTFWELRERGGLFNPRNLMRLVGHGLLPRVVENMLDAKVELD
FT                   GRLRTVINDFINDFASKMTASLPSKFVDGRNLQHGELIYPTCRNVEAEVSHLRKVLDDY
FT                   LDDIRMKETLVGAVQDRVIQIYEEFFVKFTSSEKNKGIAVSKKGKGREDAVWDVDTFSD
FT                   WCEGIFRVGVASQDDDYDQVTSRSVSRTGSLGSQFR"
FT   gene            667327..669122
FT                   /locus_tag="ANIA_10609"
FT                   /old_locus_tag="AN10609.4"
FT                   /product="mitochondrial protein Fmp25, putative
FT                   (AFU_orthologue; AFUA_3G11100)"
FT   mRNA            667327..669122
FT                   /locus_tag="ANIA_10609"
FT                   /old_locus_tag="AN10609.4"
FT                   /note="transcript_id=CADANIAT00005518"
FT   CDS_pept        667345..669072
FT                   /locus_tag="ANIA_10609"
FT                   /old_locus_tag="AN10609.4"
FT                   /product="mitochondrial protein Fmp25, putative
FT                   (AFU_orthologue; AFUA_3G11100)"
FT                   /note="transcript_id=CADANIAT00005518"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005518"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005518"
FT                   /db_xref="GOA:C8V9T3"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9T3"
FT                   /protein_id="CBF76551.1"
FT                   /translation="MWAIRARQPPVNATVFARQLRATGIRPTAGIGRRHYASERETPES
FT                   HPPSSNWFKNSLGFAVTGTAVFLAYSYATRPDESEFLKKLPKQSKPIEDLSAEYVQKKA
FT                   SLKSPGLYIWGNNKYRVVDPESKESVIKTPRRLSYFDSNVLRDLKLGETSGAAIIENGD
FT                   LVQWGKGYSETEFKPTKTLTGKNLISLSMSHDRIVALSSDGKVYSLPVSKHDQTSGKKA
FT                   EEKSWLPFSSGKSSMSYRLIQPILKLGEKIVAISGGLEHVLLLTSSGRVFSAVSSTENF
FT                   PSFGQLGVPGLTWATRPPGPVDAPHEVKTPNGVKVAQIATGDYHSLLLTKNGNVLAFGD
FT                   NSFGQLGLGFDPNSPFLDTPTPILMESLYRDSSRSPRATGVAAGGANSFFTVDVHQDGQ
FT                   GQGSKSPSKVISDIWTCGRGIWGALGNGKWTHLQDHPTLLKALSGLVEYDEATQRLLPI
FT                   RLNDISVGTTHVAAVLDNQTRLNRSASSLEGADDAGLDVVWWGGNEHFQLGTGKRSNLS
FT                   KPAHINVSPETVSLDDKELARLQIMPAYRGIVGDRSVDMRQRVECGRHVSAIYTACAK"
FT   gene            669275..671374
FT                   /locus_tag="ANIA_10618"
FT                   /old_locus_tag="AN10618.4"
FT                   /product="rRNA processing protein Nop9, putative
FT                   (AFU_orthologue; AFUA_3G11110)"
FT   mRNA            669275..671374
FT                   /locus_tag="ANIA_10618"
FT                   /old_locus_tag="AN10618.4"
FT                   /note="transcript_id=CADANIAT00005519"
FT   CDS_pept        669275..671374
FT                   /locus_tag="ANIA_10618"
FT                   /old_locus_tag="AN10618.4"
FT                   /product="rRNA processing protein Nop9, putative
FT                   (AFU_orthologue; AFUA_3G11110)"
FT                   /note="transcript_id=CADANIAT00005519"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005519"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005519"
FT                   /db_xref="GOA:Q5B3J5"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040000"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3J5"
FT                   /protein_id="CBF76553.1"
FT                   /translation="MPRENQKRGRRATEKAKKEASKRKRDEGIEEPTLKRLKPSADEDN
FT                   AVTAGADYVPLEGEEYDDQYATGAADEMPFYGLLDSEEQEYFSRANEMLELNQFGDAEE
FT                   RRLFVDSVFREARGKELKIACSQSCSRLMEKLISVSDIHQIWRLFNKFIGHFLTLVQHR
FT                   FASHCCERLFISAAPGVTQKASKTKSKKDDDIEMDEDEEPEPELPLAEMFMKVVEELQG
FT                   NWGYLLTERFASHTIRVLLLVLAGEPVDVSSNDSVVASRKKERLGVVGGETQENNPSGE
FT                   KRSVPESFEATLKKVMQDMVSVLDDTYLRALATHPVGNPVLQVLVRLELSHFGKSSAKQ
FT                   PTSIIKRLIPDENFEDDSETTRFIRGLLYDPVGSRLLETMVRCMPGKMFKSLYRNYLRD
FT                   QMSSLARNQTAGYVVLRVLERLGRDDLHAVMEQIVPKIPSLIERSRTIVPKVLIERCLA
FT                   RGVDTKPIAKALESSYDSDPARRLEQMLRLETAMADNKEKSDKNGPPGESNPGSAAAEK
FT                   LHGSLLAQTIVTAPGQLSELVFSSLLALSPEVLLSICKDPTASRVIQQALTSPASSPQF
FT                   RRQFTTRFTSHMNELALDSSGSHVVDALWPATKDIYFIKERMAQELAQNELALRDSFVG
FT                   RAVWRNWAMDLYKRRRGEWAAKAKGRDITNDSAEKPKSRLDMARARYAAKQSEATGANA
FT                   VAAKQ"
FT   gene            671431..673628
FT                   /locus_tag="ANIA_10619"
FT                   /old_locus_tag="AN10619.4"
FT                   /product="glutamate decarboxylase, putative
FT                   (AFU_orthologue; AFUA_3G11120)"
FT   mRNA            join(671431..671643,672108..673628)
FT                   /locus_tag="ANIA_10619"
FT                   /old_locus_tag="AN10619.4"
FT                   /note="transcript_id=CADANIAT00005520"
FT   CDS_pept        join(671431..671643,672108..673628)
FT                   /locus_tag="ANIA_10619"
FT                   /old_locus_tag="AN10619.4"
FT                   /product="glutamate decarboxylase, putative
FT                   (AFU_orthologue; AFUA_3G11120)"
FT                   /note="transcript_id=CADANIAT00005520"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005520"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005520"
FT                   /db_xref="GOA:C8V9T5"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9T5"
FT                   /protein_id="CBF76555.1"
FT                   /translation="MNIVGVCSIDPKIQGSNCKCSGRNFFLVPPPHSNYILTALPRFSQ
FT                   ASRALVRYYRASENRAVDLINEHYGSKPEELQDILQLDLPEQGTGQTGLVSVLRKVLRY
FT                   SVNTWHQGFLDKLYASTNAPGVASELILAALNTNVHVYQVSPALSVIEKHTGKRLAALF
FT                   GLNGPRAGGISVQGGSASNTTSIVIARNNLYPNTKTDGNGDYKFVLFTSAHGHYSIEKA
FT                   AQMLGLGSSAAWSVPIDKEGRMIPSELEKLVQKALSENRTPFYVNATAGTTVLGSFDPF
FT                   DDIAAICKKYNLWLHIDGSWGGSFAFSRRQRHKLAGAEKANSIAINPHKMLGVPVTCSF
FT                   LLASDLRQFHRANTLPAGYLFHNNDDEDAVPVENGIGGFSELNSDSPEIWDLADLTLQC
FT                   GRRADSLKLFLSWTYYGTAGYERQIDNACDTAAYLATIIQDHPDFILVSQNPTPCLQVC
FT                   FYYGPNGKLLHPRGDSIVSDENQRAKANSKVTEQITHAIVGRGFMVDYAPPSGDEKAVG
FT                   DGKFFRCVINVQTTRETVEGLVRAIEEVGPGVVKGLLSEGASAVKKRPGEQGHGPVVHR
FT                   V"
FT   gene            complement(673706..676213)
FT                   /locus_tag="ANIA_04884"
FT                   /old_locus_tag="AN4884.4"
FT                   /product="RINT-1 family protein (AFU_orthologue;
FT                   AFUA_3G11130)"
FT   mRNA            complement(join(673706..675418,675465..675606,
FT                   675659..675964,676018..676142,676199..676213))
FT                   /locus_tag="ANIA_04884"
FT                   /old_locus_tag="AN4884.4"
FT                   /note="transcript_id=CADANIAT00005521"
FT   CDS_pept        complement(join(673790..675418,675465..675606,
FT                   675659..675964,676018..676142,676199..676213))
FT                   /locus_tag="ANIA_04884"
FT                   /old_locus_tag="AN4884.4"
FT                   /product="RINT-1 family protein (AFU_orthologue;
FT                   AFUA_3G11130)"
FT                   /note="transcript_id=CADANIAT00005521"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005521"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005521"
FT                   /db_xref="GOA:C8V9T6"
FT                   /db_xref="InterPro:IPR007528"
FT                   /db_xref="InterPro:IPR042044"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9T6"
FT                   /protein_id="CBF76557.1"
FT                   /translation="MSRPPTLTGSNASDEAAKRFEASIKKLRRLELSQSYVALLKDAEE
FT                   LSKEALRNIKSEARLAIASYTQLRNIVESLDKAQPAAEGASPHLVDYVGQMASRLREQM
FT                   KMEFTNRLRSTLEQMNWPSKELNFPENLRNQWADNVELLLDLQIPELETHDSASQKIVQ
FT                   PPVLFALEAMVHPLELRFKYHFSGDKPTNRLDKPEYFLAHTTDLINNFGAFFTSYLQPI
FT                   FNQKSKTVGDQLAWHFLSASDAYITAILPMVRHKITTYLPQISAHPQLLSHFVHELMDY
FT                   DNGIRETWNYLPYPYSQEDWRGLTWEVLSKEGWFDRWLQVEKDFALARYEEIVDTPDSG
FT                   HLDYDGVEPTATKPTRAAIRVNDLLETITERYQPLSSFSQKLRFLIDIQITLFDRFHER
FT                   LHSALEAYLAMTSTIGRTVQGADGQASVEGIAGLERLCRVFGSAEYLEKKMDDWSNEVF
FT                   FVELWSELQERIKQNKHSGKNVAGTMSVADVASRTSSAINNTSGEISQDETPEGALFDE
FT                   TASAYRRLRQRSESIIISTLVSNVRSALKSYSRASNWSTISGHSVPATGHLPPSADLAQ
FT                   TMRALSTSITFLSRALGVAPLRRIVRQVLLSIQTYIWSNVLLRNTFSASGAAQLASDMD
FT                   HLYSVVDAALGHAVQAGGSKFILQKLNEGLLILNLEAQTPVAEGEDKAPAESAAEKGLG
FT                   LWEVEKRLFKDNESARETLAELGVETLTESEARSILEKRVEIGS"
FT   gene            676690..679350
FT                   /locus_tag="ANIA_04883"
FT                   /old_locus_tag="AN4883.4"
FT                   /product="DNA ligase (Eurofung)"
FT   mRNA            join(676690..678951,679162..679350)
FT                   /locus_tag="ANIA_04883"
FT                   /old_locus_tag="AN4883.4"
FT                   /note="transcript_id=CADANIAT00005522"
FT   CDS_pept        join(676690..678951,679162..679350)
FT                   /locus_tag="ANIA_04883"
FT                   /old_locus_tag="AN4883.4"
FT                   /product="DNA ligase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005522"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005522"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005522"
FT                   /db_xref="GOA:Q5B3J7"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3J7"
FT                   /protein_id="CBF76559.1"
FT                   /translation="MSSPAKKRKRDTQPTRSIASFFQGQTAKQTEKSEQLASLADTEQH
FT                   LSDEALARKLQAEWNNEQDFASPATVPHSEPTAASPSPEKDREQKKAKVGVLSLQSSTG
FT                   TEDTISLSVPFDQSPLVFDSSRYAGELKAHWSAEGGNASYALLTRAFVLANSTTSRIKI
FT                   VDTLVNFLRVLIEGDPSSVLPAVWLATNSISPPYHELELGLGGSSISKAFKKIYGLNSQ
FT                   GLKSLYDRLGDAGDVAFEAKKRQSFTLIKPKPLSIKGVYQSLIKIAMSKGSGSQELKQR
FT                   IVEKLLQDTRGAEESRYIVRTLVQNLRIGAVKTTMLIALARAFLVSKPDNATFTVHSQH
FT                   ELARLKKEELAEIYSSAEELVKASYARHPNYNDLVPCLLEIGVTEELLLRCGLQLHIPL
FT                   MPMLGSITRDLSEMLTKLQGRDFTCEFKYDGQRAQVHCDEAGKVSIFSRHLEEMTEKYP
FT                   DLVSLVPQIRGEGVSSFILEGEVVAVDQNGELQPFQILTNRAKKNVDIGEIKINVCLFA
FT                   FDLMYLNGAPLLERSLRERRELLRSLFMEIPNRFTWVKSLDATSADSEAVLDFFKSATE
FT                   NKCEGIMVKVLDNTLATNGSDSTNSSITATPKAEAKETKKGGRRKALLSSYEPDKRLES
FT                   WLKVKKDYSASSETLDLIPVAGWHGNGRKAKWWSPILLAVRNPETGGLQAVTKCMSGFS
FT                   DKFYQANKEKYEEGSPNVISRPSYVEYNGEPDVWFEPQEVWEMAFADITLSPTYPAAIG
FT                   LRFSDRSLQGISPMPVDDLQLCYRWQENVKGRILAERASAESIVATQLKRPYVALMNII
FT                   DYQT"
FT   gene            680357..682085
FT                   /locus_tag="ANIA_04882"
FT                   /old_locus_tag="AN4882.4"
FT                   /product="pectin lyase (Eurofung)"
FT   mRNA            join(680357..680960,681010..681094,681144..681820,
FT                   682057..682085)
FT                   /locus_tag="ANIA_04882"
FT                   /old_locus_tag="AN4882.4"
FT                   /note="transcript_id=CADANIAT00005523"
FT   CDS_pept        join(680357..680960,681010..681094,681144..681820,
FT                   682057..682085)
FT                   /locus_tag="ANIA_04882"
FT                   /old_locus_tag="AN4882.4"
FT                   /product="pectin lyase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005523"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005523"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005523"
FT                   /db_xref="GOA:Q5B3J8"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3J8"
FT                   /protein_id="CBF76561.1"
FT                   /translation="MAIIRSVIAATALLGAAVNAQVVGTPFGFGAGTTGGGDATPAAPA
FT                   DTAELTEWLADDEPRVILIDKEFNFLGDECTDCECCIPDSNTCGDAGQNAIEVGIGWCG
FT                   DYPTTTCTYDNAGLDGLDVGPNKSIVGVGDAGVIRGKGLRIHGTENVIVQNIHITELNP
FT                   QYIWGGDAISLDGADKVWIDHVKISLVGRQMFVTGYESSGSVTFSNNELDGTTDWSASC
FT                   DGHHYWTILALGENDKVTFANNYIHTTSGRAPKVGAPSFWHVYNNYWSDNTGHAFDVEE
FT                   SGTNVFIEGNVFEDINSAYNDDGTGAIFAVDSGSEATCSSVLGRTCVANSLTNSEYTAV
FT                   ADESVLSAFPADEEGDITILPVDQVAAYVLANAGVGKLSASGSTSGSSSSIAPSSSVPV
FT                   IPTSTPLVYPTFTPPAVETNAIQKEHEVSTPAVPTPTPVPSSVGSHGSTAGSSHPPAFS
FT                   RTSFES"
FT   gene            complement(682652..683810)
FT                   /locus_tag="ANIA_04881"
FT                   /old_locus_tag="AN4881.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(682652..683686,683757..683810))
FT                   /locus_tag="ANIA_04881"
FT                   /old_locus_tag="AN4881.4"
FT                   /note="transcript_id=CADANIAT00005524"
FT   CDS_pept        complement(join(682652..683686,683757..683807))
FT                   /locus_tag="ANIA_04881"
FT                   /old_locus_tag="AN4881.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005524"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005524"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005524"
FT                   /db_xref="GOA:Q5B3J9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3J9"
FT                   /protein_id="CBF76563.1"
FT                   /translation="MVPSNPEKTIRKIDIAQVSLNLQDRLGLAKVKYQNGRLPSRQNGG
FT                   LHISLGLGSSDKPSDSSSDISNSRCETPLTSPLRASSYSYSKELPRSSRNRHAVTFNSR
FT                   VMQPMLSASRKRLRSDSAADIDRPAKASRASWKRSHQLPESSPGFRRHTSTRRGRNNLP
FT                   LISETAPIPELSSPGPGYHAHSDDENDLDLPVHSFQVSSVVGSSPPRTPPPKHSSLSRN
FT                   DRNLRHEDGADLLLYLANSPTPARVANKPQPQEFPPSTPPSQHAALPSLTPTPGGGLFP
FT                   NFGTPNQQFNFADFVNVTPSPAQPAWGGRTPGGLARTPLASKDVRRRSNLDNLLPPGLD
FT                   SPKIREKRPSAVLQLGGELRP"
FT   gene            685991..688584
FT                   /locus_tag="ANIA_04880"
FT                   /old_locus_tag="AN4880.4"
FT                   /product="zinc metalloproteinase, putative (AFU_orthologue;
FT                   AFUA_3G11160)"
FT   mRNA            join(685991..686311,686364..686462,686516..688247,
FT                   688306..688432,688488..688584)
FT                   /locus_tag="ANIA_04880"
FT                   /old_locus_tag="AN4880.4"
FT                   /note="transcript_id=CADANIAT00005525"
FT   CDS_pept        join(685991..686311,686364..686462,686516..688247,
FT                   688306..688432,688488..688584)
FT                   /locus_tag="ANIA_04880"
FT                   /old_locus_tag="AN4880.4"
FT                   /product="zinc metalloproteinase, putative (AFU_orthologue;
FT                   AFUA_3G11160)"
FT                   /note="transcript_id=CADANIAT00005525"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005525"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005525"
FT                   /db_xref="GOA:C8V9U0"
FT                   /db_xref="InterPro:IPR001229"
FT                   /db_xref="InterPro:IPR021917"
FT                   /db_xref="InterPro:IPR036404"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9U0"
FT                   /protein_id="CBF76565.1"
FT                   /translation="MPLFKNLRSRSRSSFRSTSRSTEKSSGTSNGTQSNGDVTSGKSSS
FT                   TTDSASYSSVTPPSSIKPNMSTHNLPSLNGSNGSSNGTSSPLTVPQQRPPPSGSPSQRN
FT                   SYFGGSSLSVNGAARSSPGPSSPYGPRILSITDNAWVNQKILLIYGQIGDPRQHPLDGS
FT                   IVVNHHQDSFPQVSWPVNSSHFKALVHLVPGPNRLRLDFVSTKSSSGNLHHATHSSWIN
FT                   INYLPLTNSPPLHLVILLGKDSKGTFDAVPEKANREGNDIETAIKKYRMAAYLWQAFTG
FT                   EQMFRNNLGRRCFRFEEEWQPGTVSNRDAASGQMRNEAKIHIVRTEKTVAELRDLQLAQ
FT                   QYGPATRKDELFRIAQEAVKKHFHLKPGQKQYVSVLLLDSHWDTESQTITGHAALGSSN
FT                   GDLKMAMFGSHCLQSYPSCLEEVVDAFSDCTRTNTDYVANDCGQAGSSWESANIGIGAH
FT                   LHEVGHLFGCPHQESGVMLRDYVRLNRSFVTREPFSTRTKTQGLHPCLPQDECTWHRLD
FT                   TLRFRFHPCFRLPNDAPMSSDDSVQVWPVENGRILLTATTGIAFIELYGEGDQVCHHFL
FT                   EYLNTESTSNGLPKQVTVTESELRQRVFGTDKEKKKQVKISIFSGTLGSFTVESISSLK
FT                   SKNSQVKLPKGVGYRGCKLGISQLAESQPEQLLLDCAFQYKKLLTSIRVYHNGKLHGME
FT                   FLYEDATSQLFGNRDGMSDDFVLDTRRGEILLGFYVRAGHWIDGIEILTSLGRKSGLFG
FT                   NASGGSGYNLIPPLGYKIAGLTGSCGAWIDGLSLIIMH"
FT   gene            complement(689621..690242)
FT                   /locus_tag="ANIA_04879"
FT                   /old_locus_tag="AN4879.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(689621..690001,690064..690126,
FT                   690187..690242))
FT                   /locus_tag="ANIA_04879"
FT                   /old_locus_tag="AN4879.4"
FT                   /note="transcript_id=CADANIAT00005526"
FT   CDS_pept        complement(join(689621..690001,690064..690123))
FT                   /locus_tag="ANIA_04879"
FT                   /old_locus_tag="AN4879.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005526"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005526"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005526"
FT                   /db_xref="GOA:C8V9U1"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9U1"
FT                   /protein_id="CBF76567.1"
FT                   /translation="MTRSMLTGPVLRKVPSLLPVRLLLSPLRRPFVDLLDLPPLEALPL
FT                   PRSLRQPLRLTLLAHRLVPQLCSLPPHPNLLEPMAPHLRSLLRLKLPLVPLKDRPLLRS
FT                   RLARLPLALPLLPTALRLLVQLQSPQPRRMRQLPMPGLPKGE"
FT   gene            complement(692602..695951)
FT                   /locus_tag="ANIA_04878"
FT                   /old_locus_tag="AN4878.4"
FT                   /product="CP2 transcription factor, putative
FT                   (AFU_orthologue; AFUA_3G11170)"
FT   mRNA            complement(join(692602..693208,693257..694512,
FT                   694578..695084,695202..695339,695413..695951))
FT                   /locus_tag="ANIA_04878"
FT                   /old_locus_tag="AN4878.4"
FT                   /note="transcript_id=CADANIAT00005527"
FT   CDS_pept        complement(join(692904..693208,693257..694512,
FT                   694578..695084,695202..695339,695413..695426))
FT                   /locus_tag="ANIA_04878"
FT                   /old_locus_tag="AN4878.4"
FT                   /product="CP2 transcription factor, putative
FT                   (AFU_orthologue; AFUA_3G11170)"
FT                   /note="transcript_id=CADANIAT00005527"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005527"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005527"
FT                   /db_xref="GOA:Q5B3K2"
FT                   /db_xref="InterPro:IPR007604"
FT                   /db_xref="InterPro:IPR040167"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3K2"
FT                   /protein_id="CBF76569.1"
FT                   /translation="MFRNRRNSQKPNEELIQRFQRNFCDVVAPTTTIGAAAGVTQQLPL
FT                   GHGLPKFSMDADMKLDSIPAPPTHFMAPMVDPNSVQFVNPLNHLHGYYTPNSGNLSAGY
FT                   HSPAGDLHTPGMGLSMITPLSLSQQGPIPANHAGMHIDPFSQQFISPHFQNPQPFAPQV
FT                   SFAPSEFVQGDLAFEAVDDSVDEGSLNDVDMQGAAQSQMASAVRISEQQELQIPGENFR
FT                   YNVTLRAPTAMINHQNEIPVTYLNKGQAYSLSVVDTAPPQTTSQPVKYRTFVRVSFQDD
FT                   EQRSKPAACWQLWKEGRGTSEAHQRGGKLQAVEFVDPTQGNVEDQKNRQIQLESSSFDG
FT                   FCVTWTANPTTKASDCAISVRFNFLSTDFSHSKGVKGIPVRLCAKTEMVAGGSTGESSN
FT                   EAEVCFCKVKLFRDHGAERKLSNDVAHVKKTIEKLRQQIQQSEMGAGNFGKRKRSSAAV
FT                   GFKSSEARPAKLFKHKRTLSMSSQDGAGKMSVADDLHEKLALLQDMFSSTRPVSVFSLR
FT                   GDEQDDPDLYPVQLPESRDFIKKEFRGARHISLDRAALQEVSPTSSHMSISSPCNPMQA
FT                   SVFYDSEYSRQSSEVPDNSGFLKHPVKVQKIPSGNGGTPTGYIEAVDIDPTYRPPAERR
FT                   PRPIACFYVRFPRNGQSQDDYYRAVYLTERTVRDLMEKISMKQRIDPQRIIRVLLVKEN
FT                   GLRIMVDDDVVRELPDGQDMVAEISETAAYDASDTPSPVEVKLRY"
FT   gene            697216..698890
FT                   /locus_tag="ANIA_04877"
FT                   /old_locus_tag="AN4877.4"
FT                   /product="transposase Tan1-Aspergillus niger
FT                   (ANG_orthologue; An07g09460)"
FT   mRNA            join(697216..697779,697826..698890)
FT                   /locus_tag="ANIA_04877"
FT                   /old_locus_tag="AN4877.4"
FT                   /note="transcript_id=CADANIAT00005528"
FT   CDS_pept        join(697216..697779,697826..698890)
FT                   /locus_tag="ANIA_04877"
FT                   /old_locus_tag="AN4877.4"
FT                   /product="transposase Tan1-Aspergillus niger
FT                   (ANG_orthologue; An07g09460)"
FT                   /note="transcript_id=CADANIAT00005528"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005528"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005528"
FT                   /db_xref="GOA:Q5B3K3"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3K3"
FT                   /protein_id="CBF76571.1"
FT                   /translation="MPRVRVSSSQNCHEKEGRLLLAVQAIKKKEITSIREAARRFNVPE
FT                   STLRTRLRGTTNRAESRANGHKLTEIEEEVLKQWILSLDLRGAAPTKAHVREMANILLA
FT                   KRGSTPIQTVGQKWVYNYTQRHPELESRLSRQYDCQRAKQENPKVIQAWFNTVRATIEQ
FT                   YGILPDDIYNFDETGFAMGLCAHQKPGNREWVTAIESISASGWALPPTLIFKGKQYNQA
FT                   WFTGLPPDWRFEISTNGWTTNEISLRWLQKQFIPSTEHRTRGRYQLLVLDGHGSHLTPE
FT                   FDQICTDHNIIPLCMPAHSSHLLQPLDIGCFAVLKRSYASLVDQKMRLGISHIDKLDFL
FT                   AAYPQARISTFKLDTIRNSFRAAGLVPLNPEPVLSKLSIQARTPTPPGSRGSQASTFCP
FT                   HTPANVDELLKQASLLRDFLKQRSKSPPSPSHNALNQLIKGCQIAMQKGILLEQENRAL
FT                   RAENAIQRRKRARTHRWIAHDNGLSVQEATELEEAHNASFQAIPGPCGPPAEGAQTPKA
FT                   RALPTCSTCHRIGHRRNALVQINNN"
FT   gene            complement(702730..706776)
FT                   /locus_tag="ANIA_04876"
FT                   /old_locus_tag="AN4876.4"
FT                   /product="vacuolar assembly protein, putative
FT                   (AFU_orthologue; AFUA_3G11200)"
FT   mRNA            complement(join(702730..703016,703075..705320,
FT                   705370..706325,706376..706402,706450..706776))
FT                   /locus_tag="ANIA_04876"
FT                   /old_locus_tag="AN4876.4"
FT                   /note="transcript_id=CADANIAT00005529"
FT   CDS_pept        complement(join(702730..703016,703075..705320,
FT                   705370..706325,706376..706402,706450..706776))
FT                   /locus_tag="ANIA_04876"
FT                   /old_locus_tag="AN4876.4"
FT                   /product="vacuolar assembly protein, putative
FT                   (AFU_orthologue; AFUA_3G11200)"
FT                   /note="transcript_id=CADANIAT00005529"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005529"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005529"
FT                   /db_xref="GOA:Q5B3K4"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3K4"
FT                   /protein_id="CBF76573.1"
FT                   /translation="MDAPGATEASLSRVEPGQGSPTRPSTHHRRPHRQLHTETGDDDEE
FT                   EQEDPNREREESMTETMSYYGEEEEDDEEEEEPHLKCSHLTKQLGSAYRNGDATSTFLA
FT                   AGDKMVLGTHNGNIHVFSVPLFRSLRVYHAHSATVTSISISPFPPPAPNLKHELATRFA
FT                   ENQSASTKPFSSSGSIRGQSKPTSLPTTPSNSIYIASSSIDGNVCVASLLDTKDVLLRN
FT                   FGRPVQAVALSPEYKSDRTFISGGRAGELILTTGGKVGVSTNSTTLGGAAATASSWLGT
FT                   FGLGGNTGKDTVLHSGEGAISTVKWSLSGKYVAWVNEEGIKIMRSNLHLDSVDSELAWK
FT                   RVSHTDRPNRQGWEEMASVWKARAEWVDESLLESEHLTSNNTGGEASTPTQSTIIKERQ
FT                   EKLVVGWGGTVWVINVYPDRPNKSNRDLRIGSVEVATILRTDCIISGISLYSPSHLVVL
FT                   AYIEAENEPADEQITRRRPRGQEPELRIIDIESKEEVSADTLAISRYENLTASDYHMSV
FT                   LPPWKTNMPVSQRGALEALGTGLWDATMYPARLFSSAASIRSSTSSGDRSSNRAPSTFA
FT                   SRRSVPEEPLAIEVQEVAESSGPKIFVHSPYDCVAALKRDLADHLAWLIEHEKYAEAWK
FT                   LLDEHPEAAGSSEGSDNVSITPGRSQTSLGDLFVDDRSSITATDRGNVPAAVQEKRRIG
FT                   EMWIEQLIRDNRWQEAARVCVQALSATSRWEHWAWTFIKENKFDEITSVIPVDLRPSLS
FT                   SEIYGAILEHYLTRDRQKFSELFETWPFELFDIDSITTSIEEQLESEKMTPDLEDGRIL
FT                   IRCLARLYLTGGHYTDALHCYIRIQDADAAMALVKDHHLLDSLSDDIPAFIMIRVSKEQ
FT                   LKSAPISELAEITAEPIKLLASEAHTGIVPPDTVVRQLQTANKPLFLFFYLRALWRGES
FT                   LSLEAEKPRRGRHRQAATKLAADEGKNLVDQFADTAAELFAQYERPLLMEFLQTSTSYS
FT                   FDVAVTICEQYRFTPELIYLLSKMGQTKRALNLILSDLKDVSQAIAFAKSQDDPDLWED
FT                   LVDYSMDKPRFIHGLLVEAGTSIDPIKLVRRIPSGLEIEGLREGLTGLLREHDLQASIS
FT                   QGAAKVLQSEVAVGMNTLRDGQRRGIKFNIIQESSKSDQVNDEAKAETDSEKTPTPSRG
FT                   SFTQQAGRCAGCHRPFHANEKEILVAFACGHAFHLSHVHQSEPSSPAHTPGLESGVQTP
FT                   RPYPPRTPNLEEPSTTSRTVGPKVTTARLLRDRIGDGCRICALAKELEAVGDSEA"
FT   gene            706963..708418
FT                   /locus_tag="ANIA_04875"
FT                   /old_locus_tag="AN4875.4"
FT                   /product="YagE family protein (AFU_orthologue;
FT                   AFUA_3G11210)"
FT   mRNA            join(706963..707398,707480..708418)
FT                   /locus_tag="ANIA_04875"
FT                   /old_locus_tag="AN4875.4"
FT                   /note="transcript_id=CADANIAT00005530"
FT   CDS_pept        join(707072..707398,707480..708418)
FT                   /locus_tag="ANIA_04875"
FT                   /old_locus_tag="AN4875.4"
FT                   /product="YagE family protein (AFU_orthologue;
FT                   AFUA_3G11210)"
FT                   /note="transcript_id=CADANIAT00005530"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005530"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005530"
FT                   /db_xref="GOA:Q5B3K5"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3K5"
FT                   /protein_id="CBF76575.1"
FT                   /translation="MFARPYVSSICNRPAAVRILRQPQSHYLHASPPLSLPRRKDFFSS
FT                   NAFLAQKHGDTAEGSEESQKQRRRGTRSPAAPTSLRRVAVEAQRSRDSFKSKAQLREAG
FT                   LLQTKFNIRKAREILQEKGYEPDPLGTGLYPQVVHVQIPLDSIRRVSNPSAEGLSPEEI
FT                   GDIFVFPSGTVVSWALPEGFTSFLATRTLLPAAEGAHVDSLETEDLEYVEDAQRDNSSI
FT                   HGDTIVLGTKPSDAALAPQSSGHQSVDTVLTKVAFSSGLARSTKLAVLETLLSNYFEST
FT                   RTIPTLMSQGSRLPYTRDFILRKTGQLLSVRAQLNLYSELTDSLPDIFWDSRHELGLEG
FT                   YYEQVGRALDVGIRIKLLNEKMDYAQEIASVLRERLSETHGLRLEWIIILLIAVEVGFE
FT                   VLRLWKERAHEQASAAEQVQKA"
FT   gene            708683..710547
FT                   /locus_tag="ANIA_04874"
FT                   /old_locus_tag="AN4874.4"
FT                   /product="Ribonuclease T2-like Precursor (RNase T2-like)(EC
FT                   3.1.27.1) [Source:UniProtKB/Swiss-Prot;Acc:Q5B3K6]"
FT   mRNA            join(708683..709099,709161..709455,709509..709701,
FT                   709769..710014,710082..710179,710243..710547)
FT                   /locus_tag="ANIA_04874"
FT                   /old_locus_tag="AN4874.4"
FT                   /note="transcript_id=CADANIAT00005531"
FT   CDS_pept        join(708816..709099,709161..709455,709509..709701,
FT                   709769..710014,710082..710179,710243..710380)
FT                   /locus_tag="ANIA_04874"
FT                   /old_locus_tag="AN4874.4"
FT                   /product="Ribonuclease T2-like Precursor (RNase T2-like)(EC
FT                   3.1.27.1) [Source:UniProtKB/Swiss-Prot;Acc:Q5B3K6]"
FT                   /note="transcript_id=CADANIAT00005531"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005531"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005531"
FT                   /db_xref="GOA:Q5B3K6"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="InterPro:IPR033130"
FT                   /db_xref="InterPro:IPR033697"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3K6"
FT                   /protein_id="CBF76577.1"
FT                   /translation="MSSISGFLGAIPGAQQILQTMAGSLGLAPLSHPEIASSGSTFQQC
FT                   GKLELSCQTSYHGQDTCCFNYPGGQMLQTQFWDADPAVGPENSWTIHGLWPDHCNGGFD
FT                   QFCDSHRKYSNISLILIDAGRRDLLDEMSTYWKDYRGDDPNLWEHEWNKHGTCVSTLET
FT                   HCYSEYYPQQEVVDYFDKTVELFHDLPTYMTLANAGIVPSYTQTYTRHEVEDALSKAHG
FT                   ATVTVRCRSQRLQEVWYFFNVEGPLQTGKFVPSEPDGQTSNCPAKGIIYQPKTPNKDPG
FT                   HGHEPTKTRHPHGPTGAPFIGKGNLVVSTMGQQRGCIIGRGTWYSSGTCADFRAKRASG
FT                   DTFTLSSRKGPCAFKDDIFTCGSYISSPAEFSAEDGKLSYHGNTTFFADKAPKGKVQSD
FT                   IFVSEADHPIELSIAWRG"
FT   gene            complement(711336..713637)
FT                   /locus_tag="ANIA_04873"
FT                   /old_locus_tag="AN4873.4"
FT                   /product="C2H2 transcription factor (Swi5), putative
FT                   (AFU_orthologue; AFUA_3G11250)"
FT   mRNA            complement(join(711336..712930,713007..713637))
FT                   /locus_tag="ANIA_04873"
FT                   /old_locus_tag="AN4873.4"
FT                   /note="transcript_id=CADANIAT00005532"
FT   CDS_pept        complement(join(711336..712930,713007..713637))
FT                   /locus_tag="ANIA_04873"
FT                   /old_locus_tag="AN4873.4"
FT                   /product="C2H2 transcription factor (Swi5), putative
FT                   (AFU_orthologue; AFUA_3G11250)"
FT                   /note="transcript_id=CADANIAT00005532"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005532"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005532"
FT                   /db_xref="GOA:Q5B3K7"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3K7"
FT                   /protein_id="CBF76579.1"
FT                   /translation="MLSNPQSTLHGRHRQHRRQISTPSALDAVKPPGLSPQALQRYHAH
FT                   RRGQSLDQRAVQAQAQRQQLVQDASSTNQTAPQFAPNSTLVPLIPDSQIFGQDDMQASS
FT                   HANYQTPHSLPYLHTNFVKADDQARDARPVNHHLNLIQQQQQQLHNAKLNCHDTHDDQL
FT                   LDNDAWDTYKPDIASSLQQTTTDMRRQSVHSNPSSSYHPHTPKKTNSPTTPFDKTDFAQ
FT                   YCAETQIVPAKDQNAADASSQSAYMQRAKSLQGVAGTSFSQQKIEMPSPPSTDSFAVDG
FT                   FDTFDYQQCSSFDNLATTSHSQYSTSSNSPEVAAIPSSGDHTEKKSKLPICPATPSRLS
FT                   PRKQLATPSAASLVKAKLSPRVASIDNLNLDSRVHASIKETGVSIDEIASYIHGPDPED
FT                   GKWVCLHPGCERRFGRKENIKSHVQTHLGDRQYKCDHCDKCFVRGHDLKRHAKIHTGDK
FT                   PYECLCGNVFARHDALTRHRQRGMCIGGYKGIVRKTTKRGRPKKHRPEMDERRDKATKT
FT                   RQRIAEKSLFNSSESDTSRRTPPSEVFENMSLHGSSSADEMVTFDSQNYLPPEVFTFTP
FT                   PESPNYGTASKPASPRSLTPSSEDEMLPLSSSKRPLENILEHSGLPLLTDAGTCSFSSV
FT                   SSSSSHALSSPHTAPTLSDPSQPSDLDIFINSEPSSAFGKQDFGLGDSDMAAFPDYVNG
FT                   SAFDSSLDLLQGKNFSTGPSMGDDFFSFQFQVDEQASDVMSREFFLD"
FT   gene            715007..715578
FT                   /locus_tag="ANIA_04872"
FT                   /old_locus_tag="AN4872.4"
FT                   /product="Putative uncharacterized proteinUBI1 ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9UV58]"
FT   mRNA            join(715007..715100,715158..715438,715489..715578)
FT                   /locus_tag="ANIA_04872"
FT                   /old_locus_tag="AN4872.4"
FT                   /note="transcript_id=CADANIAT00005533"
FT   CDS_pept        join(715007..715100,715158..715438,715489..715578)
FT                   /locus_tag="ANIA_04872"
FT                   /old_locus_tag="AN4872.4"
FT                   /product="Putative uncharacterized proteinUBI1 ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9UV58]"
FT                   /note="transcript_id=CADANIAT00005533"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005533"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005533"
FT                   /db_xref="GOA:G5EB17"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB17"
FT                   /protein_id="CBF76581.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKRKKTKLAVLK
FT                   YYKVDGDGKIERLRRECPSPECGAGIFMAAMQNRQYCGKCHLTYVFDESK"
FT   gene            complement(715678..717794)
FT                   /locus_tag="ANIA_04871"
FT                   /old_locus_tag="AN4871.4"
FT                   /product="ChitinasePutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q92222]"
FT   mRNA            complement(join(715678..716515,716562..716619,
FT                   716669..716718,716766..716795,716857..717110,
FT                   717170..717270,717325..717405,717544..717794))
FT                   /locus_tag="ANIA_04871"
FT                   /old_locus_tag="AN4871.4"
FT                   /note="transcript_id=CADANIAT00005534"
FT   CDS_pept        complement(join(715851..716515,716562..716619,
FT                   716669..716718,716766..716795,716857..717110,
FT                   717170..717270,717325..717363))
FT                   /locus_tag="ANIA_04871"
FT                   /old_locus_tag="AN4871.4"
FT                   /product="ChitinasePutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q92222]"
FT                   /note="transcript_id=CADANIAT00005534"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005534"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005534"
FT                   /db_xref="GOA:G5EAZ3"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/Swiss-Prot:G5EAZ3"
FT                   /protein_id="CBF76583.1"
FT                   /translation="MSGYKTVGYFVNWAIYGRNYNPQDLPAEKLTHILYAFANVRPETG
FT                   EVYLSDTWSDIEKHYPTDSWNDTGNNVYGCVKQLGLLKRQHRQLKVLLSIGGWTYSPNF
FT                   TNGAGTPENRARFAQTATKLITDLGFDGIDIDWEYPQNDQQAQNYVDLLRRCREALNAA
FT                   QGQRRFQLTVAVPAGPDNYNKLRLQEMTPYLDFYNLMAYDYAGSWDQTAGHQANLYPST
FT                   SNPTSTPFNTVQAVNHYIDAGGVPSNKIILGMPIYGRAFQNTDGPGRPYSGIGQGTWEQ
FT                   GVYDYKALPRPGATEQLDTNIGASWSYDPSSREMVSYDTVAAADLKAAYIQSRRLGGAM
FT                   WWETSADKGGKTANKADGSLIGTFVEDVGGVNNLDRTQNAISYPDSQYDNLKAGFPSS"
FT   gene            complement(719587..720303)
FT                   /locus_tag="ANIA_04870"
FT                   /old_locus_tag="AN4870.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(719587..719715,719772..719937,
FT                   719997..720231,720291..720303))
FT                   /locus_tag="ANIA_04870"
FT                   /old_locus_tag="AN4870.4"
FT                   /note="transcript_id=CADANIAT00005535"
FT   CDS_pept        complement(join(719587..719715,719772..719937,
FT                   719997..720231,720291..720303))
FT                   /locus_tag="ANIA_04870"
FT                   /old_locus_tag="AN4870.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005535"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005535"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005535"
FT                   /db_xref="GOA:Q5B3L0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3L0"
FT                   /protein_id="CBF76585.1"
FT                   /translation="MADGLNQARALRVAELMNDYRTLLVHINQLNVPVPPADQSEEGYR
FT                   VLRECVAAANALMASNYTPSPPPANTSADEAEKAQLQRVILDGSARRFQAHRIYLRTAA
FT                   AKRWIIHRDGLLRGQRPGPQHAGPMKTISNTLREELAQISNQHVFADLRAADVRAGHWL
FT                   AEDPTLDTILSWIRSHP"
FT   gene            complement(721720..722926)
FT                   /locus_tag="ANIA_04869"
FT                   /old_locus_tag="AN4869.4"
FT                   /product="proteasome core alpha 1 component (Eurofung)"
FT   mRNA            complement(join(721720..722183,722229..722441,
FT                   722491..722585,722687..722749,722812..722926))
FT                   /locus_tag="ANIA_04869"
FT                   /old_locus_tag="AN4869.4"
FT                   /note="transcript_id=CADANIAT00005536"
FT   CDS_pept        complement(join(721797..722183,722229..722441,
FT                   722491..722585,722687..722749,722812..722818))
FT                   /locus_tag="ANIA_04869"
FT                   /old_locus_tag="AN4869.4"
FT                   /product="proteasome core alpha 1 component (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005536"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005536"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005536"
FT                   /db_xref="GOA:C8V9V1"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR034642"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9V1"
FT                   /protein_id="CBF76587.1"
FT                   /translation="MSGSAGYDRHITIFSDQGRLYQVEYAFKAITAANITSIGVRGKDC
FT                   AVVLSQKKVADKLIDPSSVTHIFRLSPSVGCVMTGSIADARASVDRARGEAAEFRYKYG
FT                   YEMPCDVLAKRLANINQVYTQRAYMRPLGVAITLCSVDSEKGPQLYKCDPAGYYAGYKA
FT                   TASGPKQQEALNHLEKKLKNKDYAEGSWEEVVELGITALSSVLSVDFKKHELEIGIAGG
FT                   PRTDGKEGTDPHFRALTEEEIDERLQAIAEKD"
FT   gene            complement(723281..724537)
FT                   /locus_tag="ANIA_04868"
FT                   /old_locus_tag="AN4868.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(723281..724537)
FT                   /locus_tag="ANIA_04868"
FT                   /old_locus_tag="AN4868.4"
FT                   /note="transcript_id=CADANIAT00005537"
FT   CDS_pept        complement(723281..724537)
FT                   /locus_tag="ANIA_04868"
FT                   /old_locus_tag="AN4868.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005537"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005537"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005537"
FT                   /db_xref="GOA:Q5B3L2"
FT                   /db_xref="InterPro:IPR019327"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3L2"
FT                   /protein_id="CBF76589.1"
FT                   /translation="MAEEKSSSKRPRSKSSKFKRTKDAEPDADADVNMKTLETNQEDDS
FT                   KENAVERGEKGAVADKRNHRDNKKRRLAEQDEQAHVPVSEEKKEDIGEPKTKKKRVSFS
FT                   AEAKVKSPSPVEGDEEAEADDENGESSKKEKKEKKEKKEKKEKKEKKERKENKKEKGEE
FT                   VKGDMDSTSTMQNSGESPVLAYLSQYYNDRSSWKFQKIREIQLFKHILSLEHVPATYDA
FT                   AILSYLKGLRGEAAKQRLRDLSQAAIKADVEELKEVYVDLSERSVDDQEPSPMENYKKA
FT                   VYAFRTKLTAGESTDDLGEAFERLSEEMLQRFRKRRRAETVYFAVEGKVFTMSNLKAPP
FT                   QKGKNDAQNQQVIKKKKNRTAVIEISSSSDSDSDDEKKSSKKPESVKKQPVKRKKKKTR
FT                   TAVIEFSSSSESSSGDSDS"
FT   gene            complement(724966..728001)
FT                   /locus_tag="ANIA_04867"
FT                   /old_locus_tag="AN4867.4"
FT                   /product="Gamma-tubulin complex protein 3 (Eurofung)"
FT   mRNA            complement(join(724966..726665,726795..728001))
FT                   /locus_tag="ANIA_04867"
FT                   /old_locus_tag="AN4867.4"
FT                   /note="transcript_id=CADANIAT00005538"
FT   CDS_pept        complement(join(724966..726665,726795..728001))
FT                   /locus_tag="ANIA_04867"
FT                   /old_locus_tag="AN4867.4"
FT                   /product="Gamma-tubulin complex protein 3 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005538"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005538"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005538"
FT                   /db_xref="GOA:Q5B3L3"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR040457"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="InterPro:IPR042241"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3L3"
FT                   /protein_id="CBF76591.1"
FT                   /translation="MSSRHHVRPRRIDDALSQLVDSLAPPLPPSAVTDEYSDDAEEALA
FT                   AAEEQYHQRLLDHAWRTIDSHANLADNPAAPSGSLGIGRRGSLTGATGAESINNAADMI
FT                   KRKLLRENESPDKAVRFSNLYSRLLTQPVLSQKWGILYLLYRLSRTENAESFTYDDERP
FT                   RSPLMDQSKLQRMLVKEQRMGGRVAASSEDDGPAVSSSASQMAARVERKASLRRTEDKE
FT                   RERNRDAEHGSAPERLRMSRQNEPFDGHGEEKNEEQERMTQCGESGLLRDLPFNLQGLS
FT                   SSDMQFMSTSTLKLPPTLPLPMVSLLNTLAEPCLLYRGLSAFVESSDGGLVSQSLRAAL
FT                   SNELRSYLGLVATLEGEIRRALAAPEESPGSKSGVTLKRCVVWTRDATMALRLMSLIVE
FT                   EAQKKLLTHVTKPFYGMLRLWIYDGELSDPYKEFFVVEPEVRPSTDPRRIATSVWEDKY
FT                   KLEDDMVPSIITKEFAKKVFLIGKSLNFIRYGCGDSGWVEAYSKEASKELRYGDTASLE
FT                   TSIDEAYKTTMARLIHLMDEKFKLFDHLHALKKYLLLGQGDFIALLMESLASNLDRPAN
FT                   SQYRHTLTAQLEHAIRASNAQYDSQDVLRRLDARMLELSHGEIGWDCFTLEYKIDAPVD
FT                   VVITPWGSTQYLKVFNFLWRVKRVEFSLGSTWRRCMTGARGVLGSVDDKVGADWKRARC
FT                   VIAEMIHFVCQLQYYILFEVIESSWDQLQASICKPGCTLDDLIEAHTKYLNSITHKGLL
FT                   GSSSTKTTGKQEEGFLAQLHHILKIMLAYKDAVDGLYSFSVAEFTRRQELSAKIETRTA
FT                   QGQWGVSERDLLSSRHSQAQRLASASSSFSITPNVGSGADGVATPSSLANHDLSADDHM
FT                   LPSLRTRLRDLSVEFRSRLNVLLGDLAYQPDVDMRFLGVVMNFNEVYEPVRRRRATGTS
FT                   SRDKERERERARRKAPPQSGGTETQSQAKKEKKDSTEQ"
FT   gene            complement(728435..730290)
FT                   /locus_tag="ANIA_04866"
FT                   /old_locus_tag="AN4866.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(728435..730033,730170..730290))
FT                   /locus_tag="ANIA_04866"
FT                   /old_locus_tag="AN4866.4"
FT                   /note="transcript_id=CADANIAT00005539"
FT   CDS_pept        complement(join(728835..730033,730170..730290))
FT                   /locus_tag="ANIA_04866"
FT                   /old_locus_tag="AN4866.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005539"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005539"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005539"
FT                   /db_xref="GOA:Q5B3L4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3L4"
FT                   /protein_id="CBF76593.1"
FT                   /translation="MQPNHYDLLGRQVRGEPRTTTGRVTRDALQSRSGLPLRSEDSWIE
FT                   VSSQPSSSSLSSAATTDDIITTGLRVQQTEPDTYHRRSRRRRLQRLAAVATAQVEYSSH
FT                   EPSSSQDEYEESESESDRVLTSSNEDISPPLPHAGDLVPSSDEDESSTALGMRISSSPF
FT                   VPQPNVFSHPPVSEGPSWTRSTERPYSDVSTSSRRTAIRRNSQADTRSSQRSSNQQHGP
FT                   YNVISPSYHADHDAALRASLSTLLSCAAAARGLSKCESQPAQSGAPRVQPASFRLVSES
FT                   VAMGDEVNEDAPPNIEVRTSPRSQRLKEQQQPVPSYSPRESSSTREKRRTSASRDRGSS
FT                   HAATKRSRRSATTESSSAVMTWVISAGVVVLFSAISFSAGYVLGREVGKLETSTGLGSV
FT                   FGDAGVPGSRASAACGQEAVRGGLKRFRWSPGSSVSGVVA"
FT   gene            complement(731018..733301)
FT                   /locus_tag="ANIA_04865"
FT                   /old_locus_tag="AN4865.4"
FT                   /product="nucleolin protein Nsr1, putative (AFU_orthologue;
FT                   AFUA_3G07710)"
FT   mRNA            complement(join(731018..732757,732823..733301))
FT                   /locus_tag="ANIA_04865"
FT                   /old_locus_tag="AN4865.4"
FT                   /note="transcript_id=CADANIAT00005540"
FT   CDS_pept        complement(731178..732752)
FT                   /locus_tag="ANIA_04865"
FT                   /old_locus_tag="AN4865.4"
FT                   /product="nucleolin protein Nsr1, putative (AFU_orthologue;
FT                   AFUA_3G07710)"
FT                   /note="transcript_id=CADANIAT00005540"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005540"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005540"
FT                   /db_xref="GOA:Q5B3L5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034276"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3L5"
FT                   /protein_id="CBF76595.1"
FT                   /translation="MSKTKSVVKKGAESAGKLADKALSKVKDAGVTKATQSPKAKSKQI
FT                   AREIASKEKKPKSKKKEPTPSSSSESESESESESDSSSSESESEDEKPVKKEVKKEAKK
FT                   AESSSESESDSSDSDEEMKDASSSESDSESESEEEKKPAKSAKAEPKVVKKAESSESES
FT                   SDSSDSDSDDESSEEEEVPKAKAKAAESSDSEDSDSESEEEAPAKAKGDAKTSKEESDS
FT                   DSDSSESSSDSDEESGSSGSESEDSDKPADSKKRKAEEEPAAASKKSKTEEGASANLFV
FT                   GNLSWNVTEEWLHQEFEQFGELSARIMTERDTGRSRGFGYVEFTNAADAAKAYEAMKEH
FT                   EIDGRKINLDYATGRPANKDQGGFKERAQNRARSFGDQTSPESDTLFVGNLPFSANEDS
FT                   VHEVFGPQGNVLGIRLPTDMESGRPKGFGYVQYSSVDEARKAYNELQGAEIDGRPIRLD
FT                   FSTPRANNGGGGGGRGGFGGRGGRGGPRGGGRGGRGGFGGRGGGAGGAPNRARGGIPEF
FT                   KGTKMTF"
FT   gene            733597..735491
FT                   /locus_tag="ANIA_04864"
FT                   /old_locus_tag="AN4864.4"
FT                   /product="glucosyltransferase (AFU_orthologue;
FT                   AFUA_3G07700)"
FT   mRNA            join(733597..733837,733901..734063,734120..735491)
FT                   /locus_tag="ANIA_04864"
FT                   /old_locus_tag="AN4864.4"
FT                   /note="transcript_id=CADANIAT00005541"
FT   CDS_pept        join(733597..733837,733901..734063,734120..735491)
FT                   /locus_tag="ANIA_04864"
FT                   /old_locus_tag="AN4864.4"
FT                   /product="glucosyltransferase (AFU_orthologue;
FT                   AFUA_3G07700)"
FT                   /note="transcript_id=CADANIAT00005541"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005541"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005541"
FT                   /db_xref="GOA:Q5B3L6"
FT                   /db_xref="InterPro:IPR004856"
FT                   /db_xref="InterPro:IPR039488"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3L6"
FT                   /protein_id="CBF76597.1"
FT                   /translation="MAPSVPSSYRPRKKRKSAALFAGSNNPLTIDAGEGKAAPAFPLVS
FT                   FLWGARAGVSQWLVLPLILMTVGLFRWAVSLWGYSGFNTPPMYGDFEAQRHWMEITIHL
FT                   PLSKWYTYDLQYWGLDYPPLTAYHSWLLGKIGSVFDPTLFALDDSRGIEGSLLKVFMRA
FT                   TVVVSEYLVYIPAIVTFLRRYTRMQAVPVWSSSIALSAILLQPATILIDHGHFQYNTVM
FT                   LGLFVASLDAIMAGRMLWACIFFVGALGFKQMALYYAPVMFAFLLGICIFPRIRLVRLF
FT                   CIALVTIASFTALLLPLLLGATSTEAGKQPVPEPPLLQAFPVNLDHGSSLYLILFQLTQ
FT                   IVHRIFPFSRGLFEDKVANAWCAIHTFYKLHHFEPELLKRVSLGATLASILIPCAIVFR
FT                   HPRASILLPAFATVGWGFFLFSFQVHEKSVLLPLLPMTLLIAGDGGLNKDTRSWVGWAN
FT                   ILGSWTLYPLLKRDGLQVPYFVVTCLWAYLLGLPPTSWQIYRHQRPVGEVEADTEPHGL
FT                   TRLIHILFYLAMVGWHVLEAFIPPPPGKPDLWVVLNVLIGAGGFGISYLWCLWKLISLS
FT                   RRIDSKVEDARKKNQ"
FT   gene            complement(735634..736276)
FT                   /locus_tag="ANIA_04863"
FT                   /old_locus_tag="AN4863.4"
FT                   /product="cytochrome c oxidase copper chaperone Cox17,
FT                   putative (AFU_orthologue; AFUA_3G07690)"
FT   mRNA            complement(join(735634..736000,736056..736114,
FT                   736190..736276))
FT                   /locus_tag="ANIA_04863"
FT                   /old_locus_tag="AN4863.4"
FT                   /note="transcript_id=CADANIAT00005542"
FT   CDS_pept        complement(join(735860..736000,736056..736114,
FT                   736190..736217))
FT                   /locus_tag="ANIA_04863"
FT                   /old_locus_tag="AN4863.4"
FT                   /product="cytochrome c oxidase copper chaperone Cox17,
FT                   putative (AFU_orthologue; AFUA_3G07690)"
FT                   /note="transcript_id=CADANIAT00005542"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005542"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005542"
FT                   /db_xref="GOA:C8V9V7"
FT                   /db_xref="InterPro:IPR007745"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9V7"
FT                   /protein_id="CBF76599.1"
FT                   /translation="MSWLFGSSSGSAEKTPIPVATEAPAEKPKPCCVCKTEKTARDDCM
FT                   LFSKSDDPTQECKSMIEQYKACMAGYGFKV"
FT   gene            736467..737884
FT                   /locus_tag="ANIA_04862"
FT                   /old_locus_tag="AN4862.4"
FT                   /product="Ran specific GTPase activating protein An-RanGAP
FT                   (Eurofung)"
FT   mRNA            736467..737884
FT                   /locus_tag="ANIA_04862"
FT                   /old_locus_tag="AN4862.4"
FT                   /note="transcript_id=CADANIAT00005543"
FT   CDS_pept        736631..737884
FT                   /locus_tag="ANIA_04862"
FT                   /old_locus_tag="AN4862.4"
FT                   /product="Ran specific GTPase activating protein An-RanGAP
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005543"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005543"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005543"
FT                   /db_xref="GOA:Q5B3L8"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3L8"
FT                   /protein_id="CBF76601.1"
FT                   /translation="MAPPKIFSLEGKGLKLDSAADIEAHIQPLLESTDYTEVRLGGNTL
FT                   GVPASERLAAVLSTQKSLEVAELADIFTSRLLSEIPDALTFLLNALLEIPTLHTINLSD
FT                   NAFGANTQKPLVDFLSRHIPLRHLVLNNNGMGPEAGSNIAKALTELAQRKEEARSGGKE
FT                   VPLLESIVCGRNRLENGSMAAWAHAYKAHAAGIRSVKMTQNGIRQEGISHLLKEGLSHA
FT                   SALEVLDLQDNTFTITGSTALAGVVSGWPSLRELGVGDCLLSARGGIKLAQALAKAKNQ
FT                   KVEILRLQYNDISAEGVKQFLHAAKTALPALRRIELNGNKFQEEDVNVTELSELLESRK
FT                   EAHGKDDDPEDMWGIDELDELESEDEEEEEEEEEEEEEEQKAEKVVKDAEIAENEKVAQ
FT                   AQDNDVDKLAEAFGKTGI"
FT   gene            738455..740164
FT                   /locus_tag="ANIA_04861"
FT                   /old_locus_tag="AN4861.4"
FT                   /product="transcription elongation factor S-II
FT                   (AFU_orthologue; AFUA_3G07670)"
FT   mRNA            join(738455..738579,738948..740164)
FT                   /locus_tag="ANIA_04861"
FT                   /old_locus_tag="AN4861.4"
FT                   /note="transcript_id=CADANIAT00005544"
FT   CDS_pept        738989..739903
FT                   /locus_tag="ANIA_04861"
FT                   /old_locus_tag="AN4861.4"
FT                   /product="transcription elongation factor S-II
FT                   (AFU_orthologue; AFUA_3G07670)"
FT                   /note="transcript_id=CADANIAT00005544"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005544"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005544"
FT                   /db_xref="GOA:C8V9V9"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR003617"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR006289"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="InterPro:IPR035100"
FT                   /db_xref="InterPro:IPR035441"
FT                   /db_xref="InterPro:IPR036575"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9V9"
FT                   /protein_id="CBF76603.1"
FT                   /translation="MALDAKEIELKAKALTKAATQNEPPANIVSLLKELQQGVKASEDL
FT                   LRSTRVGIIVNKFKQHKAPEVARLSSEIVSKWRNEVNKQKASGSASASQRSSASPRPPQ
FT                   NGTASPASATPSDKMSKLAVPPDKRTWKADGIDINQTGNRARDNCIGLMYDGLCLHSAE
FT                   PPKAVLSKAAAVEAAAYDAYGPETKEPYRTKIRSLFQNLKNKSNPTLRVRVLSNEVTPE
FT                   RFVKMTHEELRSDEQREKDRKIQKENMDKAMVAQAERSISTSLQCGKCGQRKVTYTEAQ
FT                   TRSADEPMTLFCTCMHCGKSWRQ"
FT   gene            complement(740988..742200)
FT                   /locus_tag="ANIA_04860"
FT                   /old_locus_tag="AN4860.4"
FT                   /product="pectin methyl esterase (Eurofung)"
FT   mRNA            complement(join(740988..741542,741586..742200))
FT                   /locus_tag="ANIA_04860"
FT                   /old_locus_tag="AN4860.4"
FT                   /note="transcript_id=CADANIAT00005545"
FT   CDS_pept        complement(join(740988..741542,741586..742200))
FT                   /locus_tag="ANIA_04860"
FT                   /old_locus_tag="AN4860.4"
FT                   /product="pectin methyl esterase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005545"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005545"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005545"
FT                   /db_xref="GOA:Q5B3M0"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3M0"
FT                   /protein_id="CBF76605.1"
FT                   /translation="MPKLRSWASLLLNVLLASAAGIPSSRYRNCQRSRKACPEGTLVVS
FT                   ASDPKADFSTVQAAVESLPHDNSSQTILILAGTYTEQVNVTRPGPVTLLGQTDHVTDAS
FT                   KNQVTINWAQANHDSTGQSVDNVFGSVLTVAPTLNASYTGSGPTGFPVPEDTPFGSVDF
FT                   RAYNIDFTNTWADYSDGPAHALSFSRANGGFYYCGFYSYQDTVYVGKLGNAYFHRSIIA
FT                   GQTDFIYGFGTAWIQSSDILLRNCGGGITAWKGTNTTFENKYGVYIVDSSVQAANASIA
FT                   PEIVGACPLGRPWNELHRSIFVRSYEDASIDPEGYIDWVVDGVSRLSNKTFMAEYRTFG
FT                   PGFNVSSRASTNASIVLSAKEYAPYDSPAKVFLTPDGKANNIGWIDWQA"
FT   gene            complement(743454..747076)
FT                   /locus_tag="ANIA_04859"
FT                   /old_locus_tag="AN4859.4"
FT                   /product="Plasma membrane H(+)ATPasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:O93862]"
FT   mRNA            complement(join(743454..746215,746282..746505,
FT                   746569..747076))
FT                   /locus_tag="ANIA_04859"
FT                   /old_locus_tag="AN4859.4"
FT                   /note="transcript_id=CADANIAT00005546"
FT   CDS_pept        complement(join(743867..746215,746282..746505,
FT                   746569..746968))
FT                   /locus_tag="ANIA_04859"
FT                   /old_locus_tag="AN4859.4"
FT                   /product="Plasma membrane H(+)ATPasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:O93862]"
FT                   /note="transcript_id=CADANIAT00005546"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005546"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005546"
FT                   /db_xref="GOA:G5EB90"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB90"
FT                   /protein_id="CBF76607.1"
FT                   /translation="MAERKISYAADVENGDHSRPTDVNDSAGLDEYGALNRYISTARDN
FT                   RRGSTSSAGALSMKQKKKPWYKFWAKAGGENGEEGFVAPEDWLETDLNGLPSSQIEPRR
FT                   KRGGWNELTTEKTNFFVQFIGYFRGPILYVMELAVLLAAGLRDWIDLGVIIGILMLNAV
FT                   VGWYQEKQAADVVASLKGDIAMKAVVKRDGQEQEILARELVTGDIVVIEEGTIVPADVR
FT                   LICDYDKPETYETYKEYLATANDDTLKENDDDDDDHGIEARLGVSLVAVDQSAITGESL
FT                   AVDKYMADTCYYTTGCKRGKAYAIVTATAKHSFVGKTAALVQGAQDQGHFKAVMDNIGT
FT                   SLLVLVMFWILAAWIGGFYRHLKIATPEHSDNTLLHWTLILLIIGVPVGLPVVTTTTLA
FT                   VGAAYLAEQKAIVQKLTAIESLAGVDILCSDKTGTLTANQLSIREPYVNEGVDVNWMMA
FT                   VAAIASNHNVKNLDPIDKVTILTLRRYPKAREILARNWVTEKYTPFDPVSKRITTICTC
FT                   DGVRYTCAKGAPKAILAMSECSPEEAQKFREKASEFARRGFRSLGVAVQKEGEPWQLLG
FT                   MYPMFDPPREDTAHTIAEAQHLGLSVKMLTGDALAIAKETCKMLALSTKVYDSERLIHG
FT                   GLAGSAQHDLVEKADGFAEVFPEHKYQVVEMLQQRGHLTAMTGDGVNDAPSLKKADCGI
FT                   AVEGSTEAAQAAADIVFLAPGLSTIVDAIKLARQIFQRMKAYIQYRIALCIHLELYLVT
FT                   SMIIINETIKADLIVFIALFADLATIAVAYDNAHFEARPVEWQLPKIWVISVVLGVLLA
FT                   AGTWIMRASLFLENGGIIQNFGSPQPMLFLEVSLTENWLIFVTRGGKTWPSWQLVGAIF
FT                   VVDVLATLFCVFGWLAGDYVETSPPSQATFSTNNDTDIVTVVVIWAYSIGVTIIIAVVY
FT                   YLLTIIPALDNLGRKNRSVVDTKVENLLNHLSKLAIEHEVDANGKSRYTLGARAEPEDD
FT                   E"
FT   gene            complement(757309..758961)
FT                   /locus_tag="ANIA_10617"
FT                   /old_locus_tag="AN10617.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            complement(join(757309..758143,758188..758734,
FT                   758784..758961))
FT                   /locus_tag="ANIA_10617"
FT                   /old_locus_tag="AN10617.4"
FT                   /note="transcript_id=CADANIAT00005547"
FT   CDS_pept        complement(join(757309..758143,758188..758734,
FT                   758784..758961))
FT                   /locus_tag="ANIA_10617"
FT                   /old_locus_tag="AN10617.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005547"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005547"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005547"
FT                   /db_xref="GOA:C8V9W2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9W2"
FT                   /protein_id="CBF76609.1"
FT                   /translation="MSQMDPKIYLLLFLSPVLAFSGLILIYILTRPIRLFLYDRRFYLK
FT                   GGIHAPMIPRDIISVTRFFFAVVKAQNEHRLYEFFKKSLEHGDPASPNCVESNIFGSFR
FT                   VIQTREPEHLKAVLTGKFADFGKGELFHKLWIPFLGDSIFTTDGKEWQGSRNLIRPMFI
FT                   KDRISDLDIFERKTQTMLSLYSPCGEPTDVVDLFYRMTLDAITEFLLGKGINSLENPQA
FT                   DFALAFADVQRIQTLLTMLGPAQYLYPRGRYNQGLKVINDFVWPFVHDTLGFQADDLKS
FT                   SDKSFTFLHALANYTRSPKTIRDQVVSILLAGRDTTAATLSWAFYELSHYPEAYSKLRA
FT                   EILDKVGPTRAPTYDDLKNMPYLRHTINEVLRLYPAVPYNIRFALTDTTLPIGGGVNGD
FT                   LPITILKGDAVAYSTYAMQRRADLYPPVSEKFADPAIFSPERWEVWSPKPWHYVPFNGG
FT                   PRICIGQNFALAEMGYTIVRILQRYERIEYVGDWERQFHKSEIVGTPGMGVKLRLYEAR
FT                   KP"
FT   gene            complement(759256..759943)
FT                   /locus_tag="ANIA_10608"
FT                   /old_locus_tag="AN10608.4"
FT                   /product="metallo-beta-lactamase superfamily protein
FT                   (AFU_orthologue; AFUA_3G07630)"
FT   mRNA            complement(join(759256..759551,759601..759943))
FT                   /locus_tag="ANIA_10608"
FT                   /old_locus_tag="AN10608.4"
FT                   /note="transcript_id=CADANIAT00005548"
FT   CDS_pept        complement(join(759256..759551,759601..759943))
FT                   /locus_tag="ANIA_10608"
FT                   /old_locus_tag="AN10608.4"
FT                   /product="metallo-beta-lactamase superfamily protein
FT                   (AFU_orthologue; AFUA_3G07630)"
FT                   /note="transcript_id=CADANIAT00005548"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005548"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005548"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9W3"
FT                   /protein_id="CBF76611.1"
FT                   /translation="MITEAKEAKGLSKDLIADLHPNRPDYRGFSIGENIISLQADPSFE
FT                   ELEAAGATVQKHDSAHTVLDDFFLISGEIPRRTPYEAGLKHGMRFDKEDNEWTSDEAIA
FT                   DERFIMCNVKADKGIVMLTGCSHAGVVNCTQHALELAGGSIPLHAVIGGFHLATSDANQ
FT                   IERSIKDLLKFDPAVLLPGHCTGWRAKFAIEKRQPGLLVPCSVGYNITF"
FT   gene            761517..763630
FT                   /locus_tag="ANIA_04857"
FT                   /old_locus_tag="AN4857.4"
FT                   /product="ABC1 domain protein (AFU_orthologue;
FT                   AFUA_3G07620)"
FT   mRNA            join(761517..762377,762430..763630)
FT                   /locus_tag="ANIA_04857"
FT                   /old_locus_tag="AN4857.4"
FT                   /note="transcript_id=CADANIAT00005549"
FT   CDS_pept        join(761569..762377,762430..763630)
FT                   /locus_tag="ANIA_04857"
FT                   /old_locus_tag="AN4857.4"
FT                   /product="ABC1 domain protein (AFU_orthologue;
FT                   AFUA_3G07620)"
FT                   /note="transcript_id=CADANIAT00005549"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005549"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005549"
FT                   /db_xref="GOA:C8V9W4"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9W4"
FT                   /protein_id="CBF76613.1"
FT                   /translation="MASATLCRALRPGPSPPPSLTSITFTQRHLRSLPPRPCPAQPLCH
FT                   QRHVHSGGFQPFVPISPSSLGKPVPARTYRRTRKWLRRFFYLSLATGIVYVFDNQFYAS
FT                   SITRTARTFSLGVLVALDYKINFRPNPPLAGSIADVHARNAERLSDLLRHNGGLYLKIG
FT                   QAIAMQSAILPPEFQKMFARMFDDAPQNSWKDVEKVIREDFGKSAEEVFGVSFSGDPTK
FT                   GVMERVARASASVAQVHWARLADGREVAIKIQKREIAQQIQWDLWAFKVVTWIYSRIFD
FT                   LPFYSLVPYVSERLFLETDFENEADNSEMMAKLVAGESRLRDRVYVPKVWRELSSKRVM
FT                   TAEWIEGVRLWDKDAITRTWRGGWREGSPGCGGTPLDSPRANRSAPARSSFKIKPERND
FT                   WRGRNGRGGLGLSLKEVMTTMVDLFSAQMFLWGLVHCDPHPGNIFIRRKPNGHSELVLI
FT                   DHGLYIHMDPEFRHQYARFWKALLTFDNATINEIVKGWGVNNPDIFASATLMKPYRGGN
FT                   LSTQQGIERLSKAERAQRHYDMQQASRKAVREILGDETKWPQQLIFIGRNLRIVQGNNQ
FT                   FLGSPVNRIKITGLWASRALVESPDLRLTEKIRNYGRHLLFRVVLFSSDLFFWFTKVRQ
FT                   FLHLGGGMEDDLEAQMQSVAKDMGVELNHSIFEG"
FT   gene            complement(764009..765213)
FT                   /locus_tag="ANIA_10616"
FT                   /old_locus_tag="AN10616.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(764009..765080,765176..765213))
FT                   /locus_tag="ANIA_10616"
FT                   /old_locus_tag="AN10616.4"
FT                   /note="transcript_id=CADANIAT00005550"
FT   CDS_pept        complement(join(764009..765080,765176..765213))
FT                   /locus_tag="ANIA_10616"
FT                   /old_locus_tag="AN10616.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005550"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005550"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005550"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9W5"
FT                   /protein_id="CBF76615.1"
FT                   /translation="MGESQSDFETEQPRTRHRKSAPPEPIIESSSESGTRHYLAPVTSR
FT                   PDSRIAGSSISSVDYHERPLSLPDGRNTIHSPRAPLEGYFAHESPETFSVASLHQPLRG
FT                   TASSDHIRLSDPTPTDPGRLSPRFPPYPPPVSPHRQPHVSSPRYSPSLPSPTPRTPPSR
FT                   GRSEERTYAQELHLRSRSPKAFAPRPEERHLPKHDPTDPAFNLGAFRSSNPRTSRIGDQ
FT                   ELPWKITIPGDDDDEAATSTSVSWSHETEGVLNGTGTGTDTSTRLPTYQEDEEEHGPSK
FT                   FQPQDEKQGQPIPHPSSASEPTPPQAQPNTTTPDHPHRSGARTINALQGPVELPARTDD
FT                   NSSEEIMMSSTAYPGQEWRPLGFSEWEDQ"
FT   gene            complement(766416..768727)
FT                   /locus_tag="ANIA_10607"
FT                   /old_locus_tag="AN10607.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(766416..768727)
FT                   /locus_tag="ANIA_10607"
FT                   /old_locus_tag="AN10607.4"
FT                   /note="transcript_id=CADANIAT00005551"
FT   CDS_pept        complement(766655..768727)
FT                   /locus_tag="ANIA_10607"
FT                   /old_locus_tag="AN10607.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005551"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005551"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005551"
FT                   /db_xref="UniProtKB/TrEMBL:C8V9W6"
FT                   /protein_id="CBF76617.1"
FT                   /translation="MPTESPAASSSPTAPIVRPADIYKRMREEQQDRRPSPAAPSTDER
FT                   ASGGVTVLESSENTVPPAAQAPEPIYEAEQASVKKASTPPAASNDPPALSLPEVKRLSA
FT                   FGSGFFSEPERDPQNNQEPGDQPHQLHHNPSLGFRSAVNQAFDVPETPSTVADSIARSN
FT                   SDSTAGISPIIPRRGNTDDKTPTIHEEPNENTETPTEGNMVFKPGHRRDLSIPSPGNSP
FT                   SRRPVVAGPDATASSELAQISSGSPVESPLATQPQQHVFNPDIPQPSREATRGDLPAPL
FT                   NVQTNIVSNPAVSTDIPVIIPAMSTENSPEDTENDRLRKEIIRSLSRENSPSDNQENGT
FT                   PPHTSGENNLLPREYEAHRAAPQTATSPGSEPSGPTFDTILATSQALSTGNLTPPPSHV
FT                   SQPKLKKRFSWEESSEDEDPVPVTQAQPARPPPMPGQFPFSQDSVLPESVVAPTKQQSE
FT                   IADASEERVGPPTPEKPKLTLVPPVAMDAPSIPLSDHGHEPALSQTTETLARAEEGDSS
FT                   SHMPPTLERPTHTPPVSDETGLLGFKDILNMQSPYERIQSFDRTRDQFATINTGLGNWL
FT                   QVTFHAHPEHHDVISRNSKPLSEEFKNSVPRTKFPKLASLGNLASSLQDGSHHSTSGHI
FT                   RRPSAPLGSMRQQSGKDFLHTAGVLGGQAGKAAKGLFSKGRSKLKGAGGSEKVEP"
FT   misc_feature    767838..771823
FT                   /note="contig 1.233 996..4981(-1)"
FT   gene            769704..771384
FT                   /locus_tag="ANIA_09526"
FT                   /old_locus_tag="AN9526.4"
FT                   /product="Putative ER-Golgi SNARE complex subunit Sed5
FT                   (Eurofung)"
FT   mRNA            join(769704..770211,770261..770442,770489..771049,
FT                   771103..771384)
FT                   /locus_tag="ANIA_09526"
FT                   /old_locus_tag="AN9526.4"
FT                   /note="transcript_id=CADANIAT00005552"
FT   CDS_pept        join(769956..770211,770261..770442,770489..771049,
FT                   771103..771138)
FT                   /locus_tag="ANIA_09526"
FT                   /old_locus_tag="AN9526.4"
FT                   /product="Putative ER-Golgi SNARE complex subunit Sed5
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005552"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005552"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005552"
FT                   /db_xref="GOA:Q5AQA4"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR021538"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQA4"
FT                   /protein_id="CBF76619.1"
FT                   /translation="MTGPTIQDRTSEFQAILGQAQKRAASSKVGSQRQALLTDSQRQQA
FT                   NGSPNGTAAGGKRRSEFARRAAEIGRGITATTAKLRRLAELAKRKTLFDDRPVEISELT
FT                   YVIKQDLASLNQQIASLQALTLSQHPKSNRSKTDQEGEHNDNVVVMLQGKLADVGANFK
FT                   DVLEVRTKNIQASRSRTENFVSSVSSKSQAALDPQRSDSPLYPSGRRTPQPGGSSDLLT
FT                   LEPSNPSPLGRPSMQSDQQLLMMEEAESSNSYIQSRGEAIDAIERTINELGGIFGQLAQ
FT                   MVSEQSEMIQRIDANTEDVVDNVQGAQRELMKYWTRVSGNRWLIAKMFGVLMIFFLLWV
FT                   LISG"
FT   misc_feature    771824..826838
FT                   /note="contig 1.83 1..55015(-1)"
FT   gene            complement(772027..773074)
FT                   /locus_tag="ANIA_04855"
FT                   /old_locus_tag="AN4855.4"
FT                   /product="DUF1275 domain protein (AFU_orthologue;
FT                   AFUA_3G07550)"
FT   mRNA            complement(join(772027..772646,772699..773074))
FT                   /locus_tag="ANIA_04855"
FT                   /old_locus_tag="AN4855.4"
FT                   /note="transcript_id=CADANIAT00005553"
FT   CDS_pept        complement(join(772027..772646,772699..773074))
FT                   /locus_tag="ANIA_04855"
FT                   /old_locus_tag="AN4855.4"
FT                   /product="DUF1275 domain protein (AFU_orthologue;
FT                   AFUA_3G07550)"
FT                   /note="transcript_id=CADANIAT00005553"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005553"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005553"
FT                   /db_xref="GOA:Q5B3M5"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3M5"
FT                   /protein_id="CBF76621.1"
FT                   /translation="MQHPPRVLKEIETAPLGSTPTAPNTSNNRLTYWDTATGPQGQQDD
FT                   SRYPGGLWSVGGSTTVSLAGNTVTLSDEEPVSWQSSFSRHMKCNVNTQHTDIFLVMCGF
FT                   VSGLVDGLSFNAWGSFSSMQTGNTVFIALGVSGQPAYPAYLWAKSLIALTVFLIGNVIF
FT                   IRVGRVLGACRRSSLVLSFGVQTICILVAALLVQLGVVDPKPEDPRAPIQWMQVLPISL
FT                   LAFQAAGQITASRILKFDELPTVVLTTLLCDLLVDPELSAPLRANGKRNRRIGGFVALF
FT                   LGAMTAGGLSKVTEMAASLWFAMCIKLIITASWFVWKGERSKKMEGDGSV"
FT   gene            777397..778586
FT                   /locus_tag="ANIA_04854"
FT                   /old_locus_tag="AN4854.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(777397..777624,777681..778043,778116..778160,
FT                   778220..778586)
FT                   /locus_tag="ANIA_04854"
FT                   /old_locus_tag="AN4854.4"
FT                   /note="transcript_id=CADANIAT00005554"
FT   CDS_pept        join(777436..777624,777681..778043,778116..778160,
FT                   778220..778432)
FT                   /locus_tag="ANIA_04854"
FT                   /old_locus_tag="AN4854.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005554"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005554"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005554"
FT                   /db_xref="GOA:Q5B3M6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3M6"
FT                   /protein_id="CBF76623.1"
FT                   /translation="MAPYYALLTDRGIAAESHSHLYKRDLTVNHTQAVTLGVMAAYVVV
FT                   IAILWNVPYLRYSLWPFKMLVIAFHEFGHAITACCTGGRVKSISLDPHEGGVTHMQGGM
FT                   AAITLPAGYLGSSIIGALLIFAGFNIIASKVASIVLGVCFLLTLWWARRDLLTIVTVLL
FT                   AVGLLVACWFIAHGEALKWVVLFIGVMSALYSVWDICDDLILRKVNSSDASVFAQRYGG
FT                   SSRCWGLLWSLISLIFIAIAIVAAIAAFPQSFSQQEDDSKSFLPTKF"
FT   gene            complement(778716..781455)
FT                   /locus_tag="ANIA_04853"
FT                   /old_locus_tag="AN4853.4"
FT                   /product="pH signal transduction protein PalI, putative
FT                   (AFU_orthologue; AFUA_3G07530)"
FT   mRNA            complement(778716..781455)
FT                   /locus_tag="ANIA_04853"
FT                   /old_locus_tag="AN4853.4"
FT                   /note="transcript_id=CADANIAT00005555"
FT   CDS_pept        complement(779682..780920)
FT                   /locus_tag="ANIA_04853"
FT                   /old_locus_tag="AN4853.4"
FT                   /product="pH signal transduction protein PalI, putative
FT                   (AFU_orthologue; AFUA_3G07530)"
FT                   /note="transcript_id=CADANIAT00005555"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005555"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005555"
FT                   /db_xref="GOA:O93956"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/Swiss-Prot:O93956"
FT                   /protein_id="CBF76625.1"
FT                   /translation="MLLKPATPLTILLLIAFVLLLLSVISTPIVKSIPLATFDNVEYGV
FT                   FGYCKAGTCTAIHIGYTTGLLRLPLRSEVANLSAEEIENTGSTDSDFNLPSDARRSLSS
FT                   ILIVHPIAAFLTLICLCLAAAAHLHAPSHSPRYLLALLILLLPTLLVSLLAFLVDILLF
FT                   VPHLSWGGWIVLAATIILVTCGVVTCAMRRTLVSRKARKRRIAENAEMSGQNYYNRQNA
FT                   AAAALNESKPIAPEAKETFVAATQSSESGPTFATFRTNTRSSDDDRTPLNNHSDPSAQD
FT                   AGYQSRIPGDPVPYNAPRDDFGNPLPPGAYNSAPRMRTPGPPGPPPPDSRVRDQYSDPR
FT                   RGPPTGFAPRGRGGYPPRGGYGRGGPYGGPLRAQFSCSSHRAGWLYGPNARRTCRTDGT
FT                   WRIPAATGSGRIW"
FT   gene            783360..787321
FT                   /locus_tag="ANIA_04852"
FT                   /old_locus_tag="AN4852.4"
FT                   /product="exo-beta-1,3-glucanase, putative (AFU_orthologue;
FT                   AFUA_3G07520)"
FT   mRNA            join(783360..783566,783903..783959,784074..784104,
FT                   784367..784532,784592..784866,784923..785341,
FT                   785383..785751,785807..787321)
FT                   /locus_tag="ANIA_04852"
FT                   /old_locus_tag="AN4852.4"
FT                   /note="transcript_id=CADANIAT00005556"
FT   CDS_pept        join(783360..783566,783903..783959,784074..784104,
FT                   784367..784532,784592..784866,784923..785341,
FT                   785383..785751,785807..787087)
FT                   /locus_tag="ANIA_04852"
FT                   /old_locus_tag="AN4852.4"
FT                   /product="exo-beta-1,3-glucanase, putative (AFU_orthologue;
FT                   AFUA_3G07520)"
FT                   /note="transcript_id=CADANIAT00005556"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005556"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005556"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3M8"
FT                   /protein_id="CBF76627.1"
FT                   /translation="MHAFWRAPWMKSKVGVSDDQRDHLLPENRDDDHRLGKGTPSRVAN
FT                   TQERYVGFGIGGAGNIRRFESFSCFQHGVGVFSREVQEIFVSVMLLSVYTDIDGVCCSA
FT                   ASMALHTAFLWRLFSLFCLCAWATAQKARINFVPGLDSNLTPEYSPPRPSGIPFTIQNY
FT                   AAQPWHDLINVTHGANKPAASCAVSSGSSKFWYEEIEHNGQSSFLVPGYRDNYKVFRNV
FT                   VTDYGADNTGQSDASSAIQKAIRDGPSGGPARDEKAMGSTGQPAIIYLPGGTYLLGAAL
FT                   QLYIGTVLIGDPTNPPILKATPGFSGDHIIYAKDPNFGGTINFYIGIKNIVLDSTGLDS
FT                   TLSMNLLDWTVSQATQLANVGFNMPPASQHVGLTTQYDYNSNIILQNDLWFNGGSIGMK
FT                   LSGQQWVIKNTVFAGTTTGIVAGGTDIILLGCQFSNGKTGIDATGTSGSLTVIDSSGSG
FT                   LESFLISSTPNGAGNAIILENIQNTGTTVNLGGQAVVSGSVPNTWVRGDMYAAGSPNMQ
FT                   RVNGQTVTTQRSSALLNGTKYFTKSPPTFQEFSKDQVLNIKSVPGRQVYGDGATDDTQN
FT                   INEILAENADCGVIYFPAGTYMVTDTIFVPTGRRIVGDPYASVISGVGAKFQDPMSVRP
FT                   MVRFGYPGDVGVAQVSDMLFTVGDILPGCKIVSPPDSIGSIANHTQVEVNIAGSKPGDV
FT                   GFWNSHIRIGGAVGSKVESQCAGSPDKCKAAWAALHLTSTSSAYIENMWGWTADHDLDG
FT                   SNGQTISTGRGALVEATAATWLVGTGFEHHTLYQYNFEYARNVFSTMQQSESAYWQGPG
FT                   NMLAPAPWQDNMIPSDPNFAQCAADDALCRMGLFERIHASSSLFLYGGCNWVFFNNNSD
FT                   CNAPSGKCQKNAIQITDSSAVYLYGTNTKSTINMVLSGNQAIATEDENAGGWGGVIAAY
FT                   LYSV"
FT   gene            787778..790280
FT                   /locus_tag="ANIA_10603"
FT                   /old_locus_tag="AN10603.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(787778..787823,787879..790280)
FT                   /locus_tag="ANIA_10603"
FT                   /old_locus_tag="AN10603.4"
FT                   /note="transcript_id=CADANIAT00005557"
FT   CDS_pept        join(787778..787823,787879..790280)
FT                   /locus_tag="ANIA_10603"
FT                   /old_locus_tag="AN10603.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005557"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005557"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005557"
FT                   /db_xref="GOA:C8VA67"
FT                   /db_xref="InterPro:IPR021840"
FT                   /db_xref="UniProtKB/TrEMBL:C8VA67"
FT                   /protein_id="CBF76629.1"
FT                   /translation="MLAPAAGNVSLRTVSSSRPQLIRTESQQSAAASDDYYSFSSRTPT
FT                   SRSASGGSRTTVVRYATPNSHPVSRTSSPAVSRTLLAPPAALSRAEHSPIRQAEQRETF
FT                   VTQIDSTTQSSEGRNAHLGLSMDGASSEPVRDSYAGREPTPGMDDSPYIRFAINQLTRE
FT                   GEDDDPRRSEESGYESTPPDRLVWDGSLGHFVRAVTPAPQQQSPQRDPQTSVDPEAFVA
FT                   IEPPEGNLIYPALDFVPVVLRPWALSIAIFCVLLMIAGIAFSNVWSEDHDGVWGYNGRS
FT                   GARYFVVQFLPQILGIIISISTFVIQAAVYRAMPFVIMASERPYKSVLQGLPIVSKSFL
FT                   LPDFSHFMHGEALVGFSLLTIWISNFIAVPLLSCFFQVKWFVIDGEGSWRWAAVRPVGW
FT                   TLIAVYGLLAIGLLTLLLRFLRTWSGLMWDPVCLADLITIIQRSNVLPDFEYTETATNV
FT                   GELLKSRPLRLGYWQLSQGRHPEIFYGMGEAGGTVGNPSLHTPPRNSREHLSKVSFDAE
FT                   RQSMTGKDGYEELYSSAVRYRWAPWFLRKPAVIVWTVIICALFVAFVVVSFVNGGVEEG
FT                   FPPHLSTRPSSTAFSSSNFLYSFIPALIGNLLFLAWQHIDVYFRALQPYVMLSSPEGAT
FT                   AEQSLLLAYSSLPPLHVTITAIINKHYKVAWISLLSVLSGAIPILAGGVFIALTYPENT
FT                   IKITPLMSAFYAIVAFCAIYTVSFLAVWPGRRRYLPHSISTLADQISFLYQSPLLSDKL
FT                   LREPRSKTDLVTRLVIAPPGNKDYPTYGFGIYVGRDGREHLGIDRYSRPGRADMLITTN
FT                   SMK"
FT   gene            790661..793338
FT                   /locus_tag="ANIA_10606"
FT                   /old_locus_tag="AN10606.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(790661..790720,790781..791365,791416..791556,
FT                   791608..792297,792595..792686,792729..793338)
FT                   /locus_tag="ANIA_10606"
FT                   /old_locus_tag="AN10606.4"
FT                   /note="transcript_id=CADANIAT00005558"
FT   CDS_pept        join(790661..790720,790781..791365,791416..791556,
FT                   791608..792297,792595..792686,792729..793338)
FT                   /locus_tag="ANIA_10606"
FT                   /old_locus_tag="AN10606.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005558"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005558"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005558"
FT                   /db_xref="GOA:C8VA68"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VA68"
FT                   /protein_id="CBF76631.1"
FT                   /translation="MVYPGRPSSGCQTCRTRRIKCDETRPHCNACVRSGRECPGYPHPL
FT                   DIVLRPQKAFNRKNPAMVAQRSTTDNDIDTKADKSRSCGLRPLPCLPVTSGSTTFPQVP
FT                   GGLYLPMEDTVTAFFFNSYIYTPRDPLIRPGSMEYLPQLYAAAPFDSHLRLSALAVAFF
FT                   CVAAWTRQENLVWRAQQCFGMALARTRSALQGDIERDYDNILMTLMLLYLYEEFISIKE
FT                   NKPSPKHHLRGAVALINCCSPERRKLPLSDTLTNAIQGEIVYSAVDERCPLLQTPKSWP
FT                   LSEGIPELASSRLMMIATPFVKLRERWMKFFARADTANIEETEAILSEARTFDDRFLGW
FT                   TYSLPKHWYPMPAAFFPQSVRDAGAYEGRCDCYTDVWIAETWNNYRIFRLSVQNLIYRC
FT                   LSLLPNRTDEIESTLRTTRALATDICASVPFYLGSQTGSMRITDSRVEYPAAEPKHSRQ
FT                   QAPLIGGWFIRPALDTLCSMENLPEDLVEWARGQSIASPTLILANSQRQPNSASTSADR
FT                   RLGLTNKMVFSWFRSNQTPTTTTSPSSSVEPESPLQHLTPTSVEPTLTEAPLVKPTAGT
FT                   DDLPKLWTPSTNKKLFFGGAVFFALSLLTTRRALVRRFKATIPPYYTSSVYHKPEVNGG
FT                   MEAFEALHLATINVLSFSMMASGGVLWAMGVNSVEDIRAYVKKRMAAGDRELSQTDKEM
FT                   EKEVEEWVMKYLGKRIENGKLKDLSEPKGST"
FT   gene            complement(793417..795946)
FT                   /locus_tag="ANIA_04850"
FT                   /old_locus_tag="AN4850.4"
FT                   /product="G-patch domain protein, putative (AFU_orthologue;
FT                   AFUA_3G07480)"
FT   mRNA            complement(join(793417..794433,794479..794819,
FT                   794867..794927,794975..795174,795223..795298,
FT                   795339..795718,795789..795946))
FT                   /locus_tag="ANIA_04850"
FT                   /old_locus_tag="AN4850.4"
FT                   /note="transcript_id=CADANIAT00005559"
FT   CDS_pept        complement(join(793417..794433,794479..794819,
FT                   794867..794927,794975..795174,795223..795298,
FT                   795339..795718,795789..795918))
FT                   /locus_tag="ANIA_04850"
FT                   /old_locus_tag="AN4850.4"
FT                   /product="G-patch domain protein, putative (AFU_orthologue;
FT                   AFUA_3G07480)"
FT                   /note="transcript_id=CADANIAT00005559"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005559"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005559"
FT                   /db_xref="GOA:C8VA69"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036443"
FT                   /db_xref="UniProtKB/TrEMBL:C8VA69"
FT                   /protein_id="CBF76633.1"
FT                   /translation="MSHLQPEDTRYLPGPPPRPFPRRDDRDGRMYDDNSPSRSRSPGGP
FT                   SHTPPRGPAADRRRDYSRGHSGSRSRYRSRDRDEFRRRSSRSPPRRPRHGYRDRDREGY
FT                   RSRSRSRSYSRSRSRSPRRGRSYYGQESREVMMDGLPVDMVEEDVGQLLPSLSAQTQYP
FT                   KVALQAFISRELKDFYHIDGLEEVRVIRDRQTRISRQLGFLRFRSLNHSRAFMEQNFPT
FT                   IYLCGPSAQDDRGTKVRIAYSREKEDRAKARAEGDWTCKMCSIVNYSTRHKCFRCQAPR
FT                   PDAGPTGPPGIAPPKVKNHGDNDAAPENQPSQFLLFRGLETSVTEELLAKGVAKLYRPN
FT                   SDGNSANQKKGAKVASTTGDSNLGAREGSIRRVLLVRDRRTNESWRYGFAEFATIQDAQ
FT                   AAISRLHSFEKFTISSRPVMVSYIHAGVFVPVMNPSESTEKFTFSPLNNPAMKLMYWDE
FT                   DAYVMELTVSTEPAPQGSDKPAAQQEGKAKEASDKAKKRKADAASSASGTKKMAMPSHL
FT                   QFWSNRHAELHGIKKDPEGKGSADQNSSDEAAAPPRQSYADPNRNCCYLCMRQFKTMAE
FT                   VNRHERLSQLHRGNLQKDEVVAKATNKLIKHGIIPQPPEYRDRARERRQAFGRSKNATA
FT                   KPAPPPEREPSPPVQTTSKGASLLSKMGWSAGTGLGAQGTGMTAPITTEVYAQGVGLGA
FT                   QGGKLGEASEEAARNTRNRYDEFLEKTRQTARERYEQLGK"
FT   gene            complement(796612..797579)
FT                   /locus_tag="ANIA_04849"
FT                   /old_locus_tag="AN4849.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(796612..797327,797480..797579))
FT                   /locus_tag="ANIA_04849"
FT                   /old_locus_tag="AN4849.4"
FT                   /note="transcript_id=CADANIAT00005560"
FT   CDS_pept        complement(join(796612..797327,797480..797579))
FT                   /locus_tag="ANIA_04849"
FT                   /old_locus_tag="AN4849.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005560"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005560"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005560"
FT                   /db_xref="GOA:Q5B3N1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3N1"
FT                   /protein_id="CBF76635.1"
FT                   /translation="MKFQMLLFFVSLVLAQVTSVALSIDGSDAVESTGFLESNTGTGYL
FT                   VKRKNVLNFCSRASDCAENEACQLFVCVESNHSQAQPDTEDEGNCKTDEDCGEGAECMG
FT                   GFCIDRDVTVEASLTGDAMCQKDKDCGSVGRCLNGLCLAPSKLRFARRSPQLVCHTDRD
FT                   CASPSGPGHCTHGGICIAPPINKVEARSPQIQCRTDQDCASPHGPGQCIAGGICIAPTR
FT                   QLETRSPQVQCHTDQDCASPDGPGYCIGGGICVADPPSQFLVESAAADV"
FT   gene            complement(799674..800188)
FT                   /locus_tag="ANIA_11449"
FT                   /old_locus_tag="AN11449.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(799674..799725,800145..800188))
FT                   /locus_tag="ANIA_11449"
FT                   /old_locus_tag="AN11449.4"
FT                   /note="transcript_id=CADANIAT00005561"
FT   CDS_pept        complement(join(799674..799725,800145..800188))
FT                   /locus_tag="ANIA_11449"
FT                   /old_locus_tag="AN11449.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005561"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005561"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005561"
FT                   /db_xref="UniProtKB/TrEMBL:C8VA71"
FT                   /protein_id="CBF76637.1"
FT                   /translation="MSRFDQLELYFADIRLAHDHRTWDRDKYDYG"
FT   gene            800908..802723
FT                   /locus_tag="ANIA_04848"
FT                   /old_locus_tag="AN4848.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(800908..801323,801379..802723)
FT                   /locus_tag="ANIA_04848"
FT                   /old_locus_tag="AN4848.4"
FT                   /note="transcript_id=CADANIAT00005562"
FT   CDS_pept        join(800908..801323,801379..802285)
FT                   /locus_tag="ANIA_04848"
FT                   /old_locus_tag="AN4848.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005562"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005562"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005562"
FT                   /db_xref="GOA:Q5B3N2"
FT                   /db_xref="InterPro:IPR031348"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3N2"
FT                   /protein_id="CBF76638.1"
FT                   /translation="MAEPISLASGLLALATFAFQSSVSLYDTVKSFHSHPTRVRQLIEE
FT                   LEALSGVLGPLVDRVQATNDTDLSALNLPLLSCGKACKLFQKEIMKCAGRSSATRTSFR
FT                   DWAKLKYMGDDVDGFRRVLAAYKSTITIALTDANLQKSTVTAETLKNYESLIKTAKEDL
FT                   EDHLAAIDEKLEFMLRKAVTGSDEDSLELQRIKEERLSAEKCLQICDQLSDHISQIQIS
FT                   PASNDSTSPYDPGAFPERLTSAALQECKSSLEHTSAKLHKHIHSLIDRLIVKSASGTTS
FT                   QEDLTDLARLRDEWEMTRQCIDICSKADNHFKETITTVDNYATGDAVQFMVSTDGQVIH
FT                   GRNHGLGWRSRQVGGHLNDTSLQQLSRDFTTINIHHTTNTDSSSPKNTPATADDTASSE
FT                   SASEFDRRYGRGSQLTPKSAPNITTSWKSSMESGLGRASKS"
FT   gene            complement(802796..804380)
FT                   /locus_tag="ANIA_10602"
FT                   /old_locus_tag="AN10602.4"
FT                   /product="aldehyde dehydrogenase family protein, putative
FT                   (AFU_orthologue; AFUA_3G03250)"
FT   mRNA            complement(join(802796..804258,804362..804380))
FT                   /locus_tag="ANIA_10602"
FT                   /old_locus_tag="AN10602.4"
FT                   /note="transcript_id=CADANIAT00005563"
FT   CDS_pept        complement(join(802796..804258,804362..804380))
FT                   /locus_tag="ANIA_10602"
FT                   /old_locus_tag="AN10602.4"
FT                   /product="aldehyde dehydrogenase family protein, putative
FT                   (AFU_orthologue; AFUA_3G03250)"
FT                   /note="transcript_id=CADANIAT00005563"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005563"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005563"
FT                   /db_xref="GOA:C8VA73"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C8VA73"
FT                   /protein_id="CBF76640.1"
FT                   /translation="MRGTYKNGQETPPTATTISVVNPATEEALATINATPSEAVDEIIT
FT                   ASWKTFHSGVWSRKDPSDRFAVLSRASTLLRGRINDFVALETVQTGRPIREMRTQLARV
FT                   PEWLDYFASLARVHEGRVTPFKGAVTNTLTRIPLGVVVLITPYNHPLLIAMKKIAAALA
FT                   AGNVVIVKPSELAPLSVLKLGALFKEAGLPDGVLQIVSGYGRETGKYLCEHPKISKIDL
FT                   TGGIATYRAIAPVAAMNMIPITAELGGKAPVCIFPSTDVETAVKAALFAGFIASGQTCV
FT                   TGSRILVHKDIYDSFRSLLEKRVRALRVGDPTDEKTQIGSVISAAAIERCEAFVSRATA
FT                   EGGTILCGGTRLTPTPEKKGYFFAPTVIETASTSDLANNEVFGPVLALIKCSDEDEIVR
FT                   IANGTSYALGASVWSNDFTQAHSVADKIEAGIVWINGHHLNDPSSPWGGFKESGVGKEN
FT                   GVEAYESYTKVKSTVMNYGVKPVWFDDEVADARYG"
FT   gene            complement(804434..805552)
FT                   /locus_tag="ANIA_10605"
FT                   /old_locus_tag="AN10605.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(804434..804784,804855..805188,
FT                   805262..805430,805480..805552))
FT                   /locus_tag="ANIA_10605"
FT                   /old_locus_tag="AN10605.4"
FT                   /note="transcript_id=CADANIAT00005564"
FT   CDS_pept        complement(join(804434..804784,804855..805188,
FT                   805262..805430,805480..805552))
FT                   /locus_tag="ANIA_10605"
FT                   /old_locus_tag="AN10605.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005564"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005564"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005564"
FT                   /db_xref="GOA:C8VA74"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR005592"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8VA74"
FT                   /protein_id="CBF76642.1"
FT                   /translation="MYFLLSVIFHFPVFCAGFPPAVSREISTTLLTKLTLMSQYSAASG
FT                   CSENNNSSVGSSVYCGAEMCPLIDSANTELLYAFSEIYPGDTAGYIAADHTNALLIISF
FT                   RNSVTPTNFITDWAFLQVSAPTACSGCRAHKGFWSAAVAADKALDGSIREAKARYPEYE
FT                   LTLTGHSLGGALATLHAIFLRNRGVAVDSYTFGAPSVGDYAMADYITNGPGSDNGRNYR
FT                   VTHLNDVFPKMLYRASRMPVADRLVQEYSQSGPEYWITSGFGEPVTTADVHILEGVDNE
FT                   QGNLGREPGSLRDHMWYLGATDACPLG"
FT   gene            complement(806002..806946)
FT                   /locus_tag="ANIA_04846"
FT                   /old_locus_tag="AN4846.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(806002..806585,806655..806946))
FT                   /locus_tag="ANIA_04846"
FT                   /old_locus_tag="AN4846.4"
FT                   /note="transcript_id=CADANIAT00005565"
FT   CDS_pept        complement(join(806002..806585,806655..806946))
FT                   /locus_tag="ANIA_04846"
FT                   /old_locus_tag="AN4846.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005565"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005565"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005565"
FT                   /db_xref="GOA:Q5B3N4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3N4"
FT                   /protein_id="CBF76644.1"
FT                   /translation="MFFSRFILHSTLLSVTIAAKCYYTDGTFALDEQQPCFPEKEHSAC
FT                   CGIAKTNGDENDYCLTNGLCLGQVKGYTGFVLLNSCTDSSWESDDCPNFCPKSMQASYG
FT                   IHILPCLENSNNQWCCSTDGSDCCDNAFELDMGKLMYPGPGGNWTNPTSVINPPTSTYA
FT                   STTSSAGDNASQIATTTVTVTSDPDSGSNSSSSETCDNGTGTCQDSKTTIVGVGVGLGV
FT                   ALVVCLASSAAALCFQRRQFNRRLEETKASYLASGYLPAPRAQAELYASNARPPIAELP
FT                   ANKRTSIFEM"
FT   gene            complement(808475..810032)
FT                   /locus_tag="ANIA_04845"
FT                   /old_locus_tag="AN4845.4"
FT                   /product="GPI anchored protein, putative (AFU_orthologue;
FT                   AFUA_5G09960)"
FT   mRNA            complement(join(808475..808584,808655..808676,
FT                   808887..809725,809780..810032))
FT                   /locus_tag="ANIA_04845"
FT                   /old_locus_tag="AN4845.4"
FT                   /note="transcript_id=CADANIAT00005566"
FT   CDS_pept        complement(join(808475..808584,808655..808676,
FT                   808887..809725,809780..810032))
FT                   /locus_tag="ANIA_04845"
FT                   /old_locus_tag="AN4845.4"
FT                   /product="GPI anchored protein, putative (AFU_orthologue;
FT                   AFUA_5G09960)"
FT                   /note="transcript_id=CADANIAT00005566"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005566"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005566"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3N5"
FT                   /protein_id="CBF76646.1"
FT                   /translation="MTSLRGRWPLLFLFCISLFTLCDASSPKRRSLFQPIQSKPRQKTS
FT                   ELRGNSSIADIAARDIFDPFSTSLEKRQYTCPSGYSLCTTSRRCCPSPADACCSDGTCV
FT                   IRGTEECCLTGGACPEGQSCCRDGCIPADGKCCSVGDGYCEADEKCCSNGVTCAPLDGE
FT                   CCNVRGYCPRGQRCVVLNGERGCCPLSGCYSTDYDSDDDDDDDDEETSITTSSSSSSVT
FT                   TYTQIIYWYYWVYWYIEVWWYIEIDIQTSTLSLTSSSTRTSSTATVSASNSAAASSIFE
FT                   GISESVSASATTTPDLDDVPTRTTTTTTAGPTSTDDADSDSGPVVTGGSGPTGDSSGGV
FT                   NETSVPNVDKAASLSSEGMWATGVLIPKHRLAPKYNALRPLYSVHTQITAHPVNSFRPR
FT                   YTANRELC"
FT   gene            complement(810708..811993)
FT                   /locus_tag="ANIA_10604"
FT                   /old_locus_tag="AN10604.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_2G17760)"
FT   mRNA            complement(join(810708..810751,810799..810989,
FT                   811036..811662,811715..811993))
FT                   /locus_tag="ANIA_10604"
FT                   /old_locus_tag="AN10604.4"
FT                   /note="transcript_id=CADANIAT00005567"
FT   CDS_pept        complement(join(810721..810751,810799..810989,
FT                   811036..811662,811715..811918))
FT                   /locus_tag="ANIA_10604"
FT                   /old_locus_tag="AN10604.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_2G17760)"
FT                   /note="transcript_id=CADANIAT00005567"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005567"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005567"
FT                   /db_xref="GOA:C8VA77"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C8VA77"
FT                   /protein_id="CBF76648.1"
FT                   /translation="MIYPQDPDCRDGEANLRLTEKDPDPSTLEKVNGDLKKLEVTNEKP
FT                   ASHSRSARFLIWTILNVTSTVGIVFTNKSVMSNPSFSNRQVSLACYHFFITGATLWAAS
FT                   HRFFGAFVPKPIGLKQMTPIAAAMAIQVVLQNLSLAHSSVMFHQLARLLLTPAVALLNY
FT                   VLFRIKTPRAALMPLALLCSGVGVVTYYDSLPSADSGSSTSARGVIFALTAVCASSIYT
FT                   VWIGYYHKRYELSSMQLLLNQAPISACLLLCAIPWAETTPAVSSVPTYMWSMVLLSGLL
FT                   ACMVNLSQFYIVDAAGAVSGAVIGQLKTCIIVGLGWAWRNHAVPRQSMMGIIMALIGMS
FT                   MYMNIVLKNR"
FT   gene            complement(812415..813730)
FT                   /locus_tag="ANIA_10601"
FT                   /old_locus_tag="AN10601.4"
FT                   /product="LPS glycosyltransferase, putative
FT                   (AFU_orthologue; AFUA_8G00650)"
FT   mRNA            complement(join(812415..813183,813234..813304,
FT                   813349..813492,813545..813730))
FT                   /locus_tag="ANIA_10601"
FT                   /old_locus_tag="AN10601.4"
FT                   /note="transcript_id=CADANIAT00005568"
FT   CDS_pept        complement(join(812415..813183,813234..813304,
FT                   813349..813492,813545..813730))
FT                   /locus_tag="ANIA_10601"
FT                   /old_locus_tag="AN10601.4"
FT                   /product="LPS glycosyltransferase, putative
FT                   (AFU_orthologue; AFUA_8G00650)"
FT                   /note="transcript_id=CADANIAT00005568"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005568"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005568"
FT                   /db_xref="GOA:C8VA78"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:C8VA78"
FT                   /protein_id="CBF76650.1"
FT                   /translation="MILTRGNSRLIKTTAAVFCACVLLAFLFNHQDGYQSTRKLIHAGR
FT                   SRLENAMFERIKNETLGFQHIYAIGLKERTDKHDSLTLAASATGMNVEWLEGVRPGDVS
FT                   EKALPQGMDNPEIPYAVVLCWRAHMNALRRVVENKYTTALIMEDDADWDVTIRPQLREI
FT                   ARGVRELSSNQKAPRKEPYGTNWDLLWIGGCATLQDKNETDLYMIPDDPTTPSLGHRGP
FT                   WQGPIGPHEDWRNQHPEVSMDSTRFVYRAGHGCCLYGYAVTYQGARKILAALSLERSAE
FT                   VDNSLGDLCGGKNGRQQIRCFGVYPNVIGTFKPAGLSSRHSDIQNYSTTDWVNAESWNM
FT                   VYSTRMNLQRLLAGEETVYSQWNTSFVPWSKGEVKPREVQYPRGYVVRG"
FT   gene            814539..816410
FT                   /locus_tag="ANIA_04843"
FT                   /old_locus_tag="AN4843.4"
FT                   /product="Putative alpha-glucosidasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5B3N7]"
FT   mRNA            join(814539..815022,815073..815835,815882..816410)
FT                   /locus_tag="ANIA_04843"
FT                   /old_locus_tag="AN4843.4"
FT                   /note="transcript_id=CADANIAT00005569"
FT   CDS_pept        join(814539..815022,815073..815835,815882..816410)
FT                   /locus_tag="ANIA_04843"
FT                   /old_locus_tag="AN4843.4"
FT                   /product="Putative alpha-glucosidasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5B3N7]"
FT                   /note="transcript_id=CADANIAT00005569"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005569"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005569"
FT                   /db_xref="GOA:Q5B3N7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3N7"
FT                   /protein_id="CBF76652.1"
FT                   /translation="MSYAHVKPPSEIHRAWWKESSVYQIWPASFKDSNDDGIGDIPGII
FT                   SKLDYIRDLGVDIVWLCPSYKSPQVDMGYDIADYYSIADEYGTVADVEKLIKGCHDRGM
FT                   KLLMDLVVNHTSDKHEWFKKSRSSKDNEFRDWYVWKPPRYDENGNRQPPNNWVSHFQGS
FT                   AWEFDEATGEYYLHLYAVEQPDLNWENPAVRKAVHDIVRFWLDKGADGFRMDVINFISK
FT                   DQAFPDAPEQDKDAVWQWGDKYYANGPRLHEYLQGIGKILKEYDTFSVGEMPFVKDTNE
FT                   VLKAVRYDRNEINMIFNFEHVDIDHGPWGNKFKPGGWKLTDLKAFFERWQVFMYDNGGW
FT                   NALYWENHDQPRSIDRYVNPPQALRPAAGKMLATILALHAGSPFIYQGQEIGMGNVPIE
FT                   WGMEEYKDIDCLNHWKGLLETRPTDTEVQKIARQEYRKKSRDNARTPVQWSSEPNAGFT
FT                   GPNVKPWMSVNPEYTRVNAADQVKDPNSLYHYWASVLHLRKTYLDIFVYGNYELVDRDS
FT                   QEVYAYTRACHTSKALVLANWTDRGLTWNAAAHKADQFEQVLLDTYESANAAQGRFSGG
FT                   QWTLRPYEAVVILLK"
FT   gene            816668..818091
FT                   /locus_tag="ANIA_04842"
FT                   /old_locus_tag="AN4842.4"
FT                   /product="copper-binding protein of the mitochondrial inner
FT                   membrane (Eurofung)"
FT   mRNA            join(816668..817104,817160..817484,817549..818091)
FT                   /locus_tag="ANIA_04842"
FT                   /old_locus_tag="AN4842.4"
FT                   /note="transcript_id=CADANIAT00005570"
FT   CDS_pept        join(816688..817104,817160..817484,817549..817670)
FT                   /locus_tag="ANIA_04842"
FT                   /old_locus_tag="AN4842.4"
FT                   /product="copper-binding protein of the mitochondrial inner
FT                   membrane (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005570"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005570"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005570"
FT                   /db_xref="GOA:Q5B3N8"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR017276"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3N8"
FT                   /protein_id="CBF76654.1"
FT                   /translation="MSVPLRSLMRTLARTTRPPLLSAQCRAQVSQNTPRCTTPSRSQWQ
FT                   PFSTTPARPKAKTMGQLRARNATGPFSWKAALLFVLTGAGMIIYFRVEKERLERKRIAE
FT                   MSKGVGRPKVGGPFVLKDLNGDVFTEENLKGKYSFVYFGFTHCPDICPDELDKMAEIID
FT                   KVKEANKGENIFVPVFITCDPARDTPEVLRNYLQEFHKDIIGLTGTYEQVKQVCKAYRV
FT                   YFSTPRDVKPGEDYLVDHSIYFYLMDPEGDFVECIGRQDTPETATKTIMEHINDWKREG
FT                   KPLKRD"
FT   gene            complement(817752..818339)
FT                   /locus_tag="ANIA_04841"
FT                   /old_locus_tag="AN4841.4"
FT                   /product="Molybdenum cofactor synthesis protein 2B
FT                   (MOCS2B)(Molybdenum cofactor synthesis protein 2 large
FT                   subunit)(Common component for nitrate reductase and
FT                   xanthine dehydrogenase protein H)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q9Y8C1]"
FT   mRNA            complement(817752..818339)
FT                   /locus_tag="ANIA_04841"
FT                   /old_locus_tag="AN4841.4"
FT                   /note="transcript_id=CADANIAT00005571"
FT   CDS_pept        complement(817752..818339)
FT                   /locus_tag="ANIA_04841"
FT                   /old_locus_tag="AN4841.4"
FT                   /product="Molybdenum cofactor synthesis protein 2B
FT                   (MOCS2B)(Molybdenum cofactor synthesis protein 2 large
FT                   subunit)(Common component for nitrate reductase and
FT                   xanthine dehydrogenase protein H)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q9Y8C1]"
FT                   /note="transcript_id=CADANIAT00005571"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005571"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005571"
FT                   /db_xref="GOA:Q9Y8C1"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR028888"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y8C1"
FT                   /protein_id="CBF76656.1"
FT                   /translation="MSARPEPQPGSERNATEPLPSHLDPTTYPRTLTTTHGPTSIPLHL
FT                   ELTYHTLSPTTALQHVSSPSSGANILFLGTTRDTFDDRPVARLSYTSYPALALKSLHKI
FT                   SSEAVEKFGLNGVYIAHRLGEVPVGEASIVVAVGAGHRGEAWRGAEWVLEVVKERVEVW
FT                   KREEFVDGGMEWRENRERDGFGKLKTKKEDSR"
FT   gene            complement(818712..822475)
FT                   /locus_tag="ANIA_04840"
FT                   /old_locus_tag="AN4840.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(818712..820961,821738..821792,
FT                   821886..821943,822055..822078,822451..822475))
FT                   /locus_tag="ANIA_04840"
FT                   /old_locus_tag="AN4840.4"
FT                   /note="transcript_id=CADANIAT00005572"
FT   CDS_pept        complement(join(818712..820961,821738..821792,
FT                   821886..821943,822055..822078,822451..822475))
FT                   /locus_tag="ANIA_04840"
FT                   /old_locus_tag="AN4840.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005572"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005572"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005572"
FT                   /db_xref="GOA:Q5B3P0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3P0"
FT                   /protein_id="CBF76658.1"
FT                   /translation="MRLRSTAGDPEAHLRSTLFHPTGCLDCQLIRPNLLLHHRLILRLF
FT                   RAFGDSLGEAAGHSEGHILTLSSHLPPELASAVHRQPHRTLDETYDVHDSSTFTTQRQQ
FT                   RQQQAAPNPASNPTNYPPHRPSSALDNHPRALRRTSRYSSRRPGSVDASGRPFQIEQTI
FT                   PVIVRPASERSREAAAPRLPPSDIRTEGDDSDSTLDDNLQPGNSEYWPRRSTRVSPHTA
FT                   SAVLWTLEEAIRKPFPFTLDWDEVNASMSDLAGGPGMSGLGSNGRSQNGASRAAQGPIP
FT                   VNPHPASGVRTPTDIMRQRRDREARKKAEQEAKDREQEEAERRRLQQEQAKAQAAQPYP
FT                   AGVAGERPTQRRAAPRVPAGNAPGTTQAPATAAQSRQPAPTFASQQAPQSGPQQTSQAK
FT                   LASQQQVPTATSQQPQQPRRAGFPHAFERWETLSSHWEGLTSYWIRKLEQNNEALERDP
FT                   LSQQMARQVTDLSAAGANLFHAVVELQRLRASSERKFQRWFFDTRAEQERSKELQAELE
FT                   RQIQSERQARTEAMAAAQKAESDKSRIEELLKEMRRELQISKEEARRAWEELGRREQEE
FT                   RDRTNSLRNGEPTLVGGVQVVPMIAGLPRRDPARPPTRDGPYSGAERKPREEMYGDIPI
FT                   SPVGTDPFIEGQSGVQEATPVTGSQSQGHYASYYEPESTYPPRTTAGHEASMGSSEPGD
FT                   DYGYQQTSQSRQMAYPRSEESDEYEQASLEDSEGGYATSTMPPTSGPMYAGYDQSVDYS
FT                   GASWGVGTGWESVTPRHRHPTRLSDVLEEEEPRTTPSRASRASQASRSVQ"
FT   gene            825104..826759
FT                   /locus_tag="ANIA_04839"
FT                   /old_locus_tag="AN4839.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            825104..826759
FT                   /locus_tag="ANIA_04839"
FT                   /old_locus_tag="AN4839.4"
FT                   /note="transcript_id=CADANIAT00005573"
FT   CDS_pept        825104..826759
FT                   /locus_tag="ANIA_04839"
FT                   /old_locus_tag="AN4839.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005573"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005573"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005573"
FT                   /db_xref="GOA:C8VA83"
FT                   /db_xref="UniProtKB/TrEMBL:C8VA83"
FT                   /protein_id="CBF76660.1"
FT                   /translation="MANGYARLPGELNALPKSRNRSQTTVGLPPTPSPQKKRASSFYPP
FT                   RGSDFLDETNPDPFYLEHSLANASSWGSDKQSLRNARSGENIQKYFMLSAVNQSCKDVT
FT                   VPAAAPRTIKSQANIDRSTLSVVELEHQLSLQQLGTQQWGDSQTESTPDLTPSSSFSSN
FT                   HSSPIYPDPVVKATEQLYRLSKQAQDPIVNRAYPYSTALNQSEATIPTEPSSPIRDTKP
FT                   ERVPTASSETVTMLPRSYEASSLRGKPLPSLPAVPRPSTSHPSKKQPPSRLVIEPSMIS
FT                   PPSLINPVTLEPHRSHFDQALFIPANECPSPMPSPGPPSPSVDRHPQVPSMRERPSTSA
FT                   SEMRPEQSVWESDSETEDSDPRSLSRKPMDTLKKVRSRVQLRVAKSTPKLQNNTAQNNA
FT                   ALEKFPTMPDPPSQERCSSPLKTALQTRPGKDILRPTAHQTLRLVAPSTTSLVPPRSRC
FT                   NSAKSQTYGIDRSTAAAAIQAKSRRRQRSISPETSLSAEREKVCTFCREERSDRTFHHG
FT                   LTLSRPPLYKRVWESLRVLACHGEITTTRPRKGI"
FT   gap             826839..826938
FT                   /estimated_length=unknown
FT   misc_feature    826939..871283
FT                   /note="contig 1.82 641..44985(-1)"
FT   gene            complement(828177..829108)
FT                   /locus_tag="ANIA_04838"
FT                   /old_locus_tag="AN4838.4"
FT                   /product="essential protein Yae1, putative (AFU_orthologue;
FT                   AFUA_3G07330)"
FT   mRNA            complement(join(828177..828451,828490..829108))
FT                   /locus_tag="ANIA_04838"
FT                   /old_locus_tag="AN4838.4"
FT                   /note="transcript_id=CADANIAT00005574"
FT   CDS_pept        complement(join(828177..828451,828490..829108))
FT                   /locus_tag="ANIA_04838"
FT                   /old_locus_tag="AN4838.4"
FT                   /product="essential protein Yae1, putative (AFU_orthologue;
FT                   AFUA_3G07330)"
FT                   /note="transcript_id=CADANIAT00005574"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005574"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005574"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="InterPro:IPR038881"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3P2"
FT                   /protein_id="CBF76662.1"
FT                   /translation="MASDSLDDIFGSSPPRAEQPLPQAHKNATVEPSELPSLRRQHVTA
FT                   GYRDGISASKAEHVQNGFDAGFPVGAQLGMRAGTILGILEGILKGYESSPATVKKPGQK
FT                   PPTPSTTATKEADEAKKAKREEILRLYQQSVKELNVQAVFAGVDGGALQAQGSEDKPET
FT                   QLLHKGDRVVSAWESKVPVAAWEEHVMDVLEAKSDDGNGKADETSPGDLWPTIFGAHTP
FT                   QTTAPIDDVSSALDTGPRIQPFGPSVKNFTCACAMRIPPAKHLPRPAGRLGEPSEAVPR
FT                   HIKSPALRKFGCKAAR"
FT   gene            831215..833602
FT                   /locus_tag="ANIA_04837"
FT                   /old_locus_tag="AN4837.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(831215..831276,831327..831642,831695..831881,
FT                   832014..833297,833344..833486,833540..833602)
FT                   /locus_tag="ANIA_04837"
FT                   /old_locus_tag="AN4837.4"
FT                   /note="transcript_id=CADANIAT00005575"
FT   CDS_pept        join(831215..831276,831327..831642,831695..831881,
FT                   832014..833297,833344..833486,833540..833602)
FT                   /locus_tag="ANIA_04837"
FT                   /old_locus_tag="AN4837.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005575"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005575"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005575"
FT                   /db_xref="GOA:C8VA85"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VA85"
FT                   /protein_id="CBF76664.1"
FT                   /translation="MDQARPHVRAIISCTFCRQKKLRCDRLRPCGSCVKRGLNCVFLNP
FT                   SPPPRTAPARSTRQLNQRVRELEKLVNALARTKNSREPDHKSDQTVDSTDDAVTSSLGR
FT                   IQVGETGTSYVSGAHWAALQDSIAEIKECLDSDQSLTQNSSEGPALLLGLCPPGSKEDF
FT                   LAAVPPKPVADRLISRFFNSMEPGASQYNCFWIQPQEVSLTWLSMLFGMMCLAIRLHQR
FT                   AEGEPVDAIGNPEEACNIYRLYAAYCLIRDRYTTPSKYTIEALLTYAQCEYFRSADAQH
FT                   ENWVLFGIIMRLALHMGLHRDGSRYPEISCFEAEMRRRIWTFMIQGDALSSFQSGLPRM
FT                   MYKGVADTKLPRNLLDEDFDETTTSLPPSRPDTDATPLSYVIAKSTLSEVFASITDCVA
FT                   STEPTTYQSIIQLDNQLNEAYAAIPAHLKFRSVAQSVIDLPHIIMRRYSLEILYQKSRC
FT                   ILHRQHLCEGRSDPRYAKSRQICIDAAMSLLQHQATLDAQAQPGGVLCHSRWFLSSLAS
FT                   HDFILAAMILCLELHHQSRNSEQPNGDEPHRIDEFLLALQTSCQIWSRYKESSAEAMQA
FT                   WRSISIMLSKLNATSLNPRTPITNGSDISSINDSLLLSTSDTTDQPTWFEPPSFSNMNF
FT                   ESTAAPALGVPGEVMIDKNFWDFSNGIDWAEFDATVQNLDMAGNRLGIY"
FT   gene            complement(834163..836401)
FT                   /locus_tag="ANIA_04836"
FT                   /old_locus_tag="AN4836.4"
FT                   /product="SD08430p (AFU_orthologue; AFUA_3G07290)"
FT   mRNA            complement(join(834163..834651,834700..836401))
FT                   /locus_tag="ANIA_04836"
FT                   /old_locus_tag="AN4836.4"
FT                   /note="transcript_id=CADANIAT00005576"
FT   CDS_pept        complement(join(834312..834651,834700..836090))
FT                   /locus_tag="ANIA_04836"
FT                   /old_locus_tag="AN4836.4"
FT                   /product="SD08430p (AFU_orthologue; AFUA_3G07290)"
FT                   /note="transcript_id=CADANIAT00005576"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005576"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005576"
FT                   /db_xref="GOA:Q5B3P4"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3P4"
FT                   /protein_id="CBF76666.1"
FT                   /translation="MKRKNNTVSKRRSKPNLSVATGQNGNAHGKMNSNIEMRKRDTSTG
FT                   SSSSARADRFMSRSSFTLDQDPPTPQTPGMTTTSFSDLPSSDKRNFMLLCLLYFLQGVP
FT                   MGLATGSVPFLLKPYLSYGQIGVFSLASYPYSLKLLWSPIVDAVWSRRFGRRKSWITPV
FT                   QVIAGLAMIYLGGHIEDMMKQAGANGGAGVWKFTYWWFLLVFFCATQDIAVDGWAITLM
FT                   SPPNISYASTAQTVGLTAGHFLSYTVFLAFNSKDFANRWFRTTPAEGGLLSLGTYLTIW
FT                   GWAYLVVTTCLALMKKEDHVSERDSISAVYRSMWSVLKLKNVQTIIIVHLIAKIGFQAN
FT                   DGVTSLKLLDKGFGQDNMALVVLIDFPFEIGLGYYAGKWSTEYTPMRLWCWAFVGRLAA
FT                   AILAQFTVMIYPSAPEVPTWYMLTVIFEHVASTFMNTVMFVAVSAFHARVSDPAIGGTY
FT                   MTMLATVSNLGGTFPRYFILKLVDMFTEATCVPPTTNPSPGSLKGDLVTSPFSCAVEPD
FT                   RTRCIDGGGTCDITRDGYYMTNILCVLVGTVTFIMFIKPAVLKLQSLPLRAWRLAPGRE
FT                   "
FT   gene            836895..838039
FT                   /locus_tag="ANIA_04835"
FT                   /old_locus_tag="AN4835.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(836895..836967,837030..838039)
FT                   /locus_tag="ANIA_04835"
FT                   /old_locus_tag="AN4835.4"
FT                   /note="transcript_id=CADANIAT00005577"
FT   CDS_pept        join(836895..836967,837030..838039)
FT                   /locus_tag="ANIA_04835"
FT                   /old_locus_tag="AN4835.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005577"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005577"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005577"
FT                   /db_xref="GOA:Q5B3P5"
FT                   /db_xref="InterPro:IPR018464"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3P5"
FT                   /protein_id="CBF76668.1"
FT                   /translation="MDLNDPTTQLEEELDSEISSIRREIRKLQRRRRFLASSVLSSEAL
FT                   QKRLKPQQASAPILSTLNEDISPLVRAAGSHAQSNHHRIAFSTTTFPFKDPSPVVDGES
FT                   AKDAKNLLGVRIDICVRNGRFTKPYYILLRKVRVPAEDAEKDPADIRLKVHRHTIPAFI
FT                   PVERLERILLSGHPRGPGDGDENGDDSIEQLKKKPTSPVRKQNLQLFVREVRRQLVAWH
FT                   MRLDAIYFIRGQIGIIQRGVDSYPDDEDGPWDRDVLIDVGFDSGVGETRLKKNEFGIAS
FT                   FSPTALEAAYVRVEWEDGRVGRFKISDSGKVERAVVIGDKGRDKVLEAALTGGDRNVLT
FT                   VLDRLRDAAHERRDDAMSNR"
FT   gene            complement(838358..839956)
FT                   /locus_tag="ANIA_04834"
FT                   /old_locus_tag="AN4834.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(838358..839002,839051..839956))
FT                   /locus_tag="ANIA_04834"
FT                   /old_locus_tag="AN4834.4"
FT                   /note="transcript_id=CADANIAT00005578"
FT   CDS_pept        complement(join(838358..839002,839051..839956))
FT                   /locus_tag="ANIA_04834"
FT                   /old_locus_tag="AN4834.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005578"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005578"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005578"
FT                   /db_xref="GOA:Q5B3P6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3P6"
FT                   /protein_id="CBF76670.1"
FT                   /translation="MASTNSVNFDEDQYRREVLSLSSEEEEIAQQQRLAEEAKELGLKV
FT                   PEVEIVASLAASIASGLVDFSSPILSSSSSTGRNSMYEPAHDSPALEQLATSLSEYTIS
FT                   SNPPARGGSTRSTASLSTRPTSYSSSEGRLAQGTDGTAMRSSGNNGSLLSVISGSDKKK
FT                   ERRRSGIKSAIDKIPFRKRRRTPSTVLLPPAAHVTFTKSEGGVEKLYVESKPDEARLSI
FT                   SPENKEEPLKLEVPVFDNEALLRSLANSELKQLRESQTSERNLHVSFQTNLINGLRRSQ
FT                   QPKVEEKLAQNRQLENEKREKNVADAARMEERQLVVEMEQVREFERAKANSRTRIKYME
FT                   GYLSSSSPPDSRSPSLSGSDLTTPSRSFTQQHKAQLAQEYHDYESMSQLHAAKIKVLRD
FT                   RQEIRLQEAIARMDRELDCMTKKHAAELSELQKEHQQEEATILQALNAKKTKLRQKWVL
FT                   EEAILRKKLEIQDGKPYGPLPPLSFSDSQSETRDSAICVSDPDGETETDASSQRKKEP"
FT   gene            complement(840592..840712)
FT                   /locus_tag="ANIA_11448"
FT                   /old_locus_tag="AN11448.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(840592..840611,840652..840712))
FT                   /locus_tag="ANIA_11448"
FT                   /old_locus_tag="AN11448.4"
FT                   /note="transcript_id=CADANIAT00005579"
FT   CDS_pept        complement(join(840592..840611,840652..840712))
FT                   /locus_tag="ANIA_11448"
FT                   /old_locus_tag="AN11448.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005579"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005579"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005579"
FT                   /db_xref="UniProtKB/TrEMBL:C8VA89"
FT                   /protein_id="CBF76672.1"
FT                   /translation="MALPVPHGLSSPEQGCQNPREFEYCS"
FT   gene            complement(841029..842076)
FT                   /locus_tag="ANIA_04833"
FT                   /old_locus_tag="AN4833.4"
FT                   /product="esterase/lipase, putative (AFU_orthologue;
FT                   AFUA_3G07260)"
FT   mRNA            complement(841029..842076)
FT                   /locus_tag="ANIA_04833"
FT                   /old_locus_tag="AN4833.4"
FT                   /note="transcript_id=CADANIAT00005580"
FT   CDS_pept        complement(841201..842076)
FT                   /locus_tag="ANIA_04833"
FT                   /old_locus_tag="AN4833.4"
FT                   /product="esterase/lipase, putative (AFU_orthologue;
FT                   AFUA_3G07260)"
FT                   /note="transcript_id=CADANIAT00005580"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005580"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005580"
FT                   /db_xref="GOA:Q5B3P7"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3P7"
FT                   /protein_id="CBF76674.1"
FT                   /translation="MSFLAYLYRKVVVLLLRAIVGRRSPIPKPDDIYQIQSRDSQRNIK
FT                   AHVYNPGAASKPCSVLINFHGSGFVFPFHGQDEEFCRLMSQRTGYTVLDVQYRLAPENP
FT                   FPAALNDVEDVVNWVLRQPERFDRARIALSGFSAGGNLALAASSTLFPRETFHAVLTFY
FT                   PPVDLYTEPGSKTAPDPTGKPLPAPLARFFDQCYIPSSHDPKDPRISPYYAQPDCFPDR
FT                   VLIITAAGDSLAPEAEQLAVKIREEAGREVVSARMDGCNHGWNVSPKNAVERDARDKAY
FT                   DMVAAMLNGR"
FT   gene            842708..844261
FT                   /locus_tag="ANIA_04832"
FT                   /old_locus_tag="AN4832.4"
FT                   /product="autophagy-related protein Atg29 (Eurofung)"
FT   mRNA            join(842708..842797,842847..842922,842978..842987,
FT                   843035..843228,843283..843339,843389..844084,
FT                   844140..844261)
FT                   /locus_tag="ANIA_04832"
FT                   /old_locus_tag="AN4832.4"
FT                   /note="transcript_id=CADANIAT00005581"
FT   CDS_pept        join(842708..842797,842847..842922,842978..842987,
FT                   843035..843228,843283..843339,843389..844084,
FT                   844140..844261)
FT                   /locus_tag="ANIA_04832"
FT                   /old_locus_tag="AN4832.4"
FT                   /product="autophagy-related protein Atg29 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005581"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005581"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005581"
FT                   /db_xref="GOA:C8VA91"
FT                   /db_xref="InterPro:IPR039113"
FT                   /db_xref="InterPro:IPR039362"
FT                   /db_xref="InterPro:IPR040666"
FT                   /db_xref="UniProtKB/TrEMBL:C8VA91"
FT                   /protein_id="CBF76676.1"
FT                   /translation="MTSPTQSGNTKFTVLIRLPFPRGGFVDPPPVDWNAAKDQALWDIL
FT                   SRPSKGNDIDWKALAESFDVTLEFLLQQAAWLYDRQLSQVRAQMRKVPTAHSNAASPAQ
FT                   GSIYASTALGQPAKTGQSNSSRAPSRLASQPKEAPPVRAPIPRRNSSGNTVQQIKAQTS
FT                   HPGTPTLGTKEPRRESHGRQPSTNRREQAPVSLADQRSPTLEEEDLTSSLSESNSDDES
FT                   DTIAGRKGLGFKRFGRFSTHRPDLRDDDDDDDESPAFLPLSRGHETTSHGTSGHDLSTT
FT                   LRMEQEGVSAVQRRVTGPPPSLRKSVTTESSESSVSSGVPVGRPLNQRGNQINHPSPRR
FT                   TADVNHMSPRRSTTSGRDISDGTPSMGSSFSDLDGDTSVTQSMLEEALLSNMQHGGMAS
FT                   RMSTISQALRSRYLP"
FT   gene            844823..846197
FT                   /locus_tag="ANIA_04831"
FT                   /old_locus_tag="AN4831.4"
FT                   /product="aryl-alcohol dehydrogenase Aad14, putative
FT                   (AFU_orthologue; AFUA_2G11250)"
FT   mRNA            join(844823..844947,845001..845087,845147..845227,
FT                   845284..845848,845901..846197)
FT                   /locus_tag="ANIA_04831"
FT                   /old_locus_tag="AN4831.4"
FT                   /note="transcript_id=CADANIAT00005582"
FT   CDS_pept        join(844823..844947,845001..845087,845147..845227,
FT                   845284..845848,845901..846197)
FT                   /locus_tag="ANIA_04831"
FT                   /old_locus_tag="AN4831.4"
FT                   /product="aryl-alcohol dehydrogenase Aad14, putative
FT                   (AFU_orthologue; AFUA_2G11250)"
FT                   /note="transcript_id=CADANIAT00005582"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005582"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005582"
FT                   /db_xref="GOA:Q5B3P9"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3P9"
FT                   /protein_id="CBF76678.1"
FT                   /translation="MSFWTFAPKPKTPLGYHRVLSPTAGVKVSPLCLGGMNFGEGWEHF
FT                   MGKCSKDDAFALMDAFYNMGGNFIDTANNYQEGDSERWIGEWMESRGNRDQIVLATKYT
FT                   TGFRDQNIDTERIQSNFVGNSVKSLQTSVKHSLRNLRTDYIDLLYVHWWDFTSGVEEVM
FT                   HGLNALVTAGKVLYLGVSDTPAWVVVKANEYARANGLRPFSVYQGLWNPLRRDMESEII
FT                   PMCRDQGMGIAPWGPLAQGKLKTAKARGVKGGGRSDGDMTEDEIRVSDALDEVAKSRNT
FT                   TLAAVALAYLLHKTPYVFPIVGQRKIEHLKANVQALEIELTKEDMDKIDAAVPFDPGFP
FT                   MSFIFPGKYDLTLTAADVPLTRKAGHIDAPPQQGIVPPRKMSQI"
FT   gene            846610..847806
FT                   /locus_tag="ANIA_04830"
FT                   /old_locus_tag="AN4830.4"
FT                   /product="phosphopantothenate-cysteine ligase, putative
FT                   (AFU_orthologue; AFUA_3G07230)"
FT   mRNA            join(846610..846851,846912..847806)
FT                   /locus_tag="ANIA_04830"
FT                   /old_locus_tag="AN4830.4"
FT                   /note="transcript_id=CADANIAT00005583"
FT   CDS_pept        join(846610..846851,846912..847806)
FT                   /locus_tag="ANIA_04830"
FT                   /old_locus_tag="AN4830.4"
FT                   /product="phosphopantothenate-cysteine ligase, putative
FT                   (AFU_orthologue; AFUA_3G07230)"
FT                   /note="transcript_id=CADANIAT00005583"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005583"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005583"
FT                   /db_xref="GOA:Q5B3Q0"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Q0"
FT                   /protein_id="CBF76680.1"
FT                   /translation="MSPADSESAYFNNYPPPKALSKHESLARSFIEYHVESSRRVVLVT
FT                   SGGTTVPLENQTVRFIDNFSAGTRGATSAEYFLEQGHSTNCFLDFMDEAFPSDVSRSDH
FT                   GPIVVRKEYQDEMRDVLRKYRYAKQNNLLLLLPFTTVSEYLFELRMLAKCMNPLGPNAL
FT                   FYLAAAVSDFFIPRDRMAEHKIQSSEIPKEFQGNDEAVGADDLYTGGFEQKQESSKKLV
FT                   INLDPVPKFLHQLVDGWSPEGSMIVSFKLETDPNLLVYKAQTALQRYAHHLVIGNLLST
FT                   RKWEVVFVTPNPPYERWIRVPKSRRSKSISGVEDQVGKAEAAKRSSGDQTLAAPVGEEP
FT                   SKEEKDGEGTSREGTEIESLIIPELVKLHSEMIEKFKR"
FT   gene            complement(848028..849407)
FT                   /locus_tag="ANIA_04829"
FT                   /old_locus_tag="AN4829.4"
FT                   /product="aldehyde reductase I (ARI), putative
FT                   (AFU_orthologue; AFUA_3G09190)"
FT   mRNA            complement(join(848028..848203,848270..848415,
FT                   848468..848523,848577..848661,848714..848910,
FT                   848974..849078,849133..849279,849339..849407))
FT                   /locus_tag="ANIA_04829"
FT                   /old_locus_tag="AN4829.4"
FT                   /note="transcript_id=CADANIAT00005584"
FT   CDS_pept        complement(join(848028..848203,848270..848415,
FT                   848468..848523,848577..848661,848714..848910,
FT                   848974..849078,849133..849279,849339..849407))
FT                   /locus_tag="ANIA_04829"
FT                   /old_locus_tag="AN4829.4"
FT                   /product="aldehyde reductase I (ARI), putative
FT                   (AFU_orthologue; AFUA_3G09190)"
FT                   /note="transcript_id=CADANIAT00005584"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005584"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005584"
FT                   /db_xref="GOA:Q5B3Q1"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Q1"
FT                   /protein_id="CBF76682.1"
FT                   /translation="MALKRTFKLNTGYEIPAVGLGTWQSKPSEVEEAVTAALNIGYRHI
FT                   DAAAVYGNERDVGNGIKASGVPRGEIFLTSKLWNTHHDPENVEAAVDRSLSDLQTDYLD
FT                   LYLIHWPVAFRYSTTTIQPVDEKTGLIDVIDVPIKDTWAAMEALVAKGKVRSIGVSNFN
FT                   RRRIEELLKTAKIPPAVNQIEAHPYLQQRELLEWSKEKGILITGYSPLGNNIYNIPRTV
FT                   DDPLVIEVAKFLNRTPAQVLISWAVQRGTAVLPKSVTPERIKSNFRDFILPEDAFQAIQ
FT                   SLERHQRMNFPARLGVDIFDEVGEESARRSALEWAEGQRLSKSQA"
FT   gene            849926..851236
FT                   /locus_tag="ANIA_10599"
FT                   /old_locus_tag="AN10599.4"
FT                   /product="mandelate racemase/muconate lactonizing enzyme
FT                   family protein (AFU_orthologue; AFUA_1G05520)"
FT   mRNA            join(849926..850101,850155..850264,850321..850432,
FT                   850489..851236)
FT                   /locus_tag="ANIA_10599"
FT                   /old_locus_tag="AN10599.4"
FT                   /note="transcript_id=CADANIAT00005585"
FT   CDS_pept        join(849926..850101,850155..850264,850321..850432,
FT                   850489..851236)
FT                   /locus_tag="ANIA_10599"
FT                   /old_locus_tag="AN10599.4"
FT                   /product="mandelate racemase/muconate lactonizing enzyme
FT                   family protein (AFU_orthologue; AFUA_1G05520)"
FT                   /note="transcript_id=CADANIAT00005585"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005585"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005585"
FT                   /db_xref="GOA:C8VA95"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C8VA95"
FT                   /protein_id="CBF76684.1"
FT                   /translation="MAPIAQIEYFRIPPRWLFVKITDANGNYGWGEASLEGHTEAVEGC
FT                   LDAFAQRFAGMDADDIEHIWQHGYRMGFYRGGPVLMSALSGVDIALWDLKARRLGLPIY
FT                   QLLGGKVRDKLKVYAWIGGDRPGDVEAQARARISQGFKAVKMNATEDLSWLDSPHALDT
FT                   SVERLKTVKSLGIDAGVDFHGRVHKAMAQQLAYKLAPHEPLFIEEPLLSEHPESVAALS
FT                   KLVPIPIALGERLHSRWDIKPFLESASVSILQPDICHVGGISEIRRIATMAEAYDVALA
FT                   PHCPLGPIALAASLQVDAVSANFAIQEMSLGIHYNAGSADIDTYIKNPEVWKVQDGLID
FT                   LLSGPGLGIEIDEEKIRAAAVDAVAWRSPHFVGPGGELREW"
FT   gene            851551..853940
FT                   /locus_tag="ANIA_10600"
FT                   /old_locus_tag="AN10600.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(851551..851556,851594..851673,851729..852421,
FT                   852477..853305,853362..853940)
FT                   /locus_tag="ANIA_10600"
FT                   /old_locus_tag="AN10600.4"
FT                   /note="transcript_id=CADANIAT00005586"
FT   CDS_pept        join(851551..851556,851594..851673,851729..852421,
FT                   852477..853305,853362..853940)
FT                   /locus_tag="ANIA_10600"
FT                   /old_locus_tag="AN10600.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005586"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005586"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005586"
FT                   /db_xref="GOA:C8VA96"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VA96"
FT                   /protein_id="CBF76686.1"
FT                   /translation="MLPTRGHPNKRRSVKERVRVTRACDTCKKKKLRCSGTLPCFLCQR
FT                   SQLRCEYTAGYTRGKVPPVPTISGADSMNNTIQNHHEKTTNSSVESRSPPKPQDTAQNV
FT                   LLAREKQVNLPSSGNSPEPHQTDMEGHYVGPASGVSFLIRVQKRLHEHISFPRTTPIFS
FT                   FGDAPLPKYDPSFLVIPPKDEAKALLDRYFDFVFPTHRFLHQPQAESWLEDFYRDPGVA
FT                   QSPKPGAMAIRALLLMIFAHGKQCLPKSDSSLGSCVNSAVYFAASEHHLAAETGPVRLA
FT                   SVQARLAQCFYLLGQSRINHCWSLFGTTARLAIAIGLHRGRRRDVKDNFVEHECSKRVF
FT                   WCMYSLDNYLSAALGRPRIFHDDEIDQELPAIANDSQITPSGVVPASSNTQSIMLAPVY
FT                   HAKLSKIISGILRDLYSIRRMTLQSQSAAAAKHGAELAQWRQEISAFVDLANVDMLVLT
FT                   YQRQYTVLNLAFFHSQILLYRPFILRDFKNLALPASPESNDLAESVSENARHCLEAAMK
FT                   ITSILRDLCENGKMYHSFWFTHYYAFSAIVVLYVHFIQSCTHTSAESYLAYFQAGERAQ
FT                   YDLAASGSQSSFAQRYAMVLEELRKEAQKCIQQKQQLATGYHHSDQVTDSASADMSAQE
FT                   PNVSRQSFSYEPAVFPQSTFAHTEQAITHSPPLELSNMHPEQQTWIENLIQDSSPRTYI
FT                   PSFTGWGEFDSLALTGLGELGHIFSSNDLPDFRG"
FT   gene            855230..858599
FT                   /locus_tag="ANIA_04827"
FT                   /old_locus_tag="AN4827.4"
FT                   /product="NRPS-like enzyme, putative (JCVI)"
FT   mRNA            join(855230..855508,855568..856316,856422..857418,
FT                   857469..858599)
FT                   /locus_tag="ANIA_04827"
FT                   /old_locus_tag="AN4827.4"
FT                   /note="transcript_id=CADANIAT00005587"
FT   CDS_pept        join(855230..855508,855568..856316,856422..857418,
FT                   857469..858599)
FT                   /locus_tag="ANIA_04827"
FT                   /old_locus_tag="AN4827.4"
FT                   /product="NRPS-like enzyme, putative (JCVI)"
FT                   /note="transcript_id=CADANIAT00005587"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005587"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005587"
FT                   /db_xref="GOA:Q5B3Q3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Q3"
FT                   /protein_id="CBF76688.1"
FT                   /translation="MLAQIGSDISIGSKDASMKSTKLPPTPPDEAEVPLYTIDDILLQR
FT                   ISYPPDAPLVGYPQSQYGISDYAFYTAKELDRFANGAAQALQFSGLPKFSDPSENRVVA
FT                   ILGPSNLDYIVSLFALSRLGYAVLLLSTRLSSEAYTNLLAQTNCCHILYSPTTEKAVEE
FT                   IRGVSPQINIFSIPEHIIYSKCTESSNLRLSRQPELAQKWAFIIHSSGSTGLPKPIFQT
FT                   HAACIANYTTSNSYRALLTLPLYHNHGLCTFFRSMFKAKPIAIYNANLPLTGKNVLEVM
FT                   ETFKPESFHGVPYVLKLLSEVPGGVEALARCQQVLFGGSSCPDELGDYLVDNGVRLISH
FT                   YGATELGQLMTSDRPVGDKLWNYVRPLKVSQPYLRMEELEDGSYECVVLDGLPAKVSSN
FT                   CNDPPNSFRTRDTFLKHPSVPNAWKYLGRIDDRVTLINGEKVLPVPIEHRIRQNKYVKD
FT                   NLVFGVGKPLPGLIIVPSAECQEMTKSEILDKVWPDIEAANKNAEAFSYISRDMVIVLD
FT                   VGCSYPATDKGTMIRNRSYNEFRNVIEASYQRLEEGLSSDRHKLALGTEGLEQYLLKLF
FT                   NTELGYHHMSSDSDFFGAGVDSLQAIKARGIIKRDIDIGPAELGHNVIFDSANIKNLAA
FT                   HLYALRTGNLQDEEDELSVMSQLIDKYSSFQLRPESEEVILLTGATGSLGIYILSRLMQ
FT                   KENVRKVYCLVRASSPNNALDRVLSNLASRSLPMVNVWKIVALPSQLGSEDLGLSPSFL
FT                   SDIRTSMTKVIHSAWAVNFTLGVCSFEAQHIRGVHNLINLCLASQRPSPAEFYFCSSVS
FT                   AAAGTPLPATIAESPVPELAHAQSMGYARSKLVAERIVQAAAEKTGMVAKVLRVGQIVG
FT                   DTVNGRWNTTEAIPLMLQTALTLKALPELDETPSWLPVDIVADAVLDLSGLNKTSASVS
FT                   AVLRQFSYDPNTIYHVQNPRTFSWTKELLPALKEAGLDFEVLPKREWVQRLREGEQDPK
FT                   RNPAVKLLDFFTEKYDNDNPGRSELVFETEKSEAASPSLKGGVELIESGLIRKFVNTWR
FT                   SEW"
FT   gene            859384..860856
FT                   /locus_tag="ANIA_04826"
FT                   /old_locus_tag="AN4826.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_3G09170)"
FT   mRNA            join(859384..859554,859598..859749,859809..860856)
FT                   /locus_tag="ANIA_04826"
FT                   /old_locus_tag="AN4826.4"
FT                   /note="transcript_id=CADANIAT00005588"
FT   CDS_pept        join(859384..859554,859598..859749,859809..860856)
FT                   /locus_tag="ANIA_04826"
FT                   /old_locus_tag="AN4826.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_3G09170)"
FT                   /note="transcript_id=CADANIAT00005588"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005588"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005588"
FT                   /db_xref="GOA:Q5B3Q4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Q4"
FT                   /protein_id="CBF76690.1"
FT                   /translation="MTDLSHKGVTEKKAHYAQHIEDVEKASQVPQYDRFGATAKVDPKE
FT                   IALVRKIDCYMMLTVNLADALGDVFQNFLDRNALVNGKLNSPVEDVNLKGTEYNTCVSI
FT                   LFVGYLVCQVPSNMLLNRVKPAWYMAGFMMAWAIVSTLACVVKDYHGMLACRLVLGIIE
FT                   APFYPGALFMISLFYNRKEATTRMAVLYTGNMLASSFSGLISAAVFATLDKKHGLAGWQ
FT                   WLFLIQGVVTVVVAVAFFLLPNSPKQTLWLTLEERQLAHDRIARDTTQKAEGTSVWTGL
FT                   REACLDYRTWIFALMCNLHFSANGFKNFMPTVVETLGFNSTVTLILTCPPYIVATFTSI
FT                   AVSWSSGRFNERTWHVTVSKLLAIVGFAVACGTLSTGARYFAMILFVGATYGVNNINIA
FT                   WVAATVGQTDEKKAVAIAVTNTLGNLASVYTPYCGQTAMRQDSRLPCTPASGSPLGW"
FT   gene            861933..865708
FT                   /locus_tag="ANIA_04825"
FT                   /old_locus_tag="AN4825.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(861933..862436,862602..862784,862874..863153,
FT                   863202..863267,863326..863865,863915..864107,
FT                   864160..864314,864377..864557,864646..864679,
FT                   864737..865340,865403..865708)
FT                   /locus_tag="ANIA_04825"
FT                   /old_locus_tag="AN4825.4"
FT                   /note="transcript_id=CADANIAT00005589"
FT   CDS_pept        join(861933..862436,862602..862784,862874..863153,
FT                   863202..863267,863326..863865,863915..864107,
FT                   864160..864314,864377..864557,864646..864679,
FT                   864737..865303)
FT                   /locus_tag="ANIA_04825"
FT                   /old_locus_tag="AN4825.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005589"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005589"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005589"
FT                   /db_xref="GOA:Q5B3Q5"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Q5"
FT                   /protein_id="CBF76692.1"
FT                   /translation="MVRCRLVVLLGACILLQAIASPVLDADGLIAPRAAESPPEIAQND
FT                   VDNARHPLLVDATEASIDEARVVVKDAIARMTKLNKARLDNPILGSYKSGPGTNITRSG
FT                   SENSPLLEITKEIAHAAALVAEADMAANLANGTSTLAQQAAGTFWMQDIRRQGTVPWGN
FT                   DPAYKVFRNVVTDYHADPTGASDSTAAIQAAINDGNRCGARCNGSTRKNAIVYFPPGTY
FT                   LVSSTIEANNWPTIKAASSFVGLGVLSTNQYVGGTGPDGGDGQYYVNTARFYSQIRNLR
FT                   IDITATARDAYVCAIHYQIAQATSLQDVELIATTGTTQQGIFSENGSGGIMSDVTFRGG
FT                   NFGFYGGNQQFSAHRMTFIGCATAVQIIWDWTWVWKSLDIQGAEVGLRLVSNDGSGNVG
FT                   SVALIDSKLTSVNTAIIIAPASSTPGTGTTGLVLDNTRIDGPIVDTAGKVYLGAGYYDN
FT                   WVLGPTYRGTTRTWSSAPFSSYPREQSLLGNRVDGLNNAPYFERKKNQYADRPVGDFVQ
FT                   LKSLGARGDGVTDDTAAVQRAFNEHGSGNKIIFVDSGTYILTDTVVVPKDAKIHGEAWS
FT                   QFAASGSAFSDANNPRVMLQIGNRGDVGTVELQDLILTTKGGTAGAVLMQWNVKAASPG
FT                   AAALWDVHARIGGAIGTSLTQTECPPLTTGTNPASCQAASLMLHLTPEASGYFENMWLW
FT                   VADHLIDDLDLNDAYNDMPQLSVYVARGMLIESTSATWLYGTSSEHCVFYQYNFHHAQN
FT                   IFTTVIQTEPPYYQPNPRPPAPFNNQVGKYSSDPAYNCNDANFNGCDEAWAVIITESQN
FT                   IHIGSAGTYSWFSAYTQDCIDRHSCQQALWRLRNNHDNVRLQNVIGIGAEYVLVSDGAG
FT                   VRSVDNLGVTAHPAWAQISIFDAPSHGRI"
FT   gene            866343..867860
FT                   /locus_tag="ANIA_04824"
FT                   /old_locus_tag="AN4824.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(866343..867473,867543..867860)
FT                   /locus_tag="ANIA_04824"
FT                   /old_locus_tag="AN4824.4"
FT                   /note="transcript_id=CADANIAT00005590"
FT   CDS_pept        join(866412..867473,867543..867860)
FT                   /locus_tag="ANIA_04824"
FT                   /old_locus_tag="AN4824.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005590"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005590"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005590"
FT                   /db_xref="GOA:C8VAA0"
FT                   /db_xref="InterPro:IPR003378"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAA0"
FT                   /protein_id="CBF76694.1"
FT                   /translation="MSSVKLGRFTYRLVPQQFRCRMGSHRGIRRRVAVVATLLTLFLIY
FT                   HFTIGSVPYQPSSSQYTNSARTSSDKKQSQCLPLPGIEDVLVVMKTGVTEALDKVPVHF
FT                   KTTLRCIPNYVIYSDFEEKIDGVQIHDAFRNIDPAVKQNVDDFQIYNRLSKRGREGLQT
FT                   QDFADEANSAIGKPNNPGWKLDKWKFLPMVKEAHQYKPDAKWFVFMEADTYYSWPTLLA
FT                   WLSHFDPSEPHYIGTETQIADVIFAHGGSGFVLSNPAMKLAADEYTERADELHEYTDAH
FT                   WAGDCVLGKVLSNVGVNLSFSWPILQNSNIGELDEFTTTFYRRPWCFPAVALHHLSPDD
FT                   IRFLHDFEHRRLAKSSRLPLLHSDIFKELIFPELSNVRNGWDNLSDKEQPTLSTFQECQ
FT                   SYCKETANCVQFVMRDGTCYTGETPRLGSHNSNAQSGWIINKIENMVDQAPQCVRPDFG
FT                   L"
FT   gene            complement(868087..869591)
FT                   /locus_tag="ANIA_04823"
FT                   /old_locus_tag="AN4823.4"
FT                   /product="polysaccharide deacetylase, putative
FT                   (AFU_orthologue; AFUA_3G07210)"
FT   mRNA            complement(join(868087..868493,868558..868643,
FT                   868708..869591))
FT                   /locus_tag="ANIA_04823"
FT                   /old_locus_tag="AN4823.4"
FT                   /note="transcript_id=CADANIAT00005591"
FT   CDS_pept        complement(join(868087..868493,868558..868643,
FT                   868708..869591))
FT                   /locus_tag="ANIA_04823"
FT                   /old_locus_tag="AN4823.4"
FT                   /product="polysaccharide deacetylase, putative
FT                   (AFU_orthologue; AFUA_3G07210)"
FT                   /note="transcript_id=CADANIAT00005591"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005591"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005591"
FT                   /db_xref="GOA:Q5B3Q7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Q7"
FT                   /protein_id="CBF76696.1"
FT                   /translation="MRPMVSLSQAFLALSPFLFTSAVQLLPPPPIPINSTSAFIRTPAS
FT                   SALHSKNRPPVLVIDSFTHPERNELGFWHGPSTNLASEPGNGYVRLFPSDPDQNYHTEL
FT                   GPATCFDMRPYQNMYLHIVFSGSTKFSISLNQHNEKCDSRLSPFLETWDSVETERYARG
FT                   NDVYVPLNHFDIDQSRTVSVSFHGFFSPETVTLYRVEIVPDLPWGFYVPPKLETGKLFL
FT                   RCTRPNSFAFGIDDGLPHLVQDVMNILEEEKILVTFFVVGAGLRDKEANFSQVYEEMLR
FT                   RGHQVALHSDTHQQIEALDTIQAIDEEIVHNIETFQRLLGIHSRYFRPPYGTVGARTRQ
FT                   RLATYVQDPNIINWSVDVEDWLWAESKTPERQRDAFFRDVGRGGNLVVMHYLSPTTVKY
FT                   FREFIRFVKSINLNIMRVDQCLEDPDSPPIDALRLSQQGRARYRVQSNRKSDNNPGKTG
FT                   "
FT   misc_feature    871284..881188
FT                   /note="contig 1.183 1..9905(1)"
FT   gene            complement(<871411..872201)
FT                   /locus_tag="ANIA_09445"
FT                   /old_locus_tag="AN9445.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(<871411..871499,871547..871700,
FT                   871744..871801,871852..872201))
FT                   /locus_tag="ANIA_09445"
FT                   /old_locus_tag="AN9445.4"
FT                   /note="transcript_id=CADANIAT00005592"
FT   CDS_pept        complement(join(<871411..871499,871547..871700,
FT                   871744..871801,871852..872201))
FT                   /locus_tag="ANIA_09445"
FT                   /old_locus_tag="AN9445.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="submitted as non-partial"
FT                   /note="transcript_id=CADANIAT00005592"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005592"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005592"
FT                   /db_xref="GOA:C8VAA2"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAA2"
FT                   /protein_id="CBF76697.1"
FT                   /translation="MDDTSNFVVSTVRDALADVTNVQNTKNIEVSALAREKGRVEPKDY
FT                   DYEKYVTVIPSEKPAEKGENYQDEQSFPEWAANAVKYEWNDEYGDVGPENPHLEEQLFR
FT                   AEFINRTGLKIENLQNIDVVAESHERPSPIRTGNILNKFDDAGLHPIMRQNICLCGYEF
FT                   PTPIQAYAIPAVLTSHDLIAIAQTGSGKTAAFLIPVLSQLMGKAKKLAAPRPNL"
FT   gene            873439..874961
FT                   /locus_tag="ANIA_09446"
FT                   /old_locus_tag="AN9446.4"
FT                   /product="Pantothenate kinasePutative uncharacterized
FT                   protein (EC 2.7.1.33);
FT                   [Source:UniProtKB/TrEMBL;Acc:O93921]"
FT   mRNA            join(873439..873675,873802..874084,874148..874646,
FT                   874694..874961)
FT                   /locus_tag="ANIA_09446"
FT                   /old_locus_tag="AN9446.4"
FT                   /note="transcript_id=CADANIAT00005593"
FT   CDS_pept        join(873463..873675,873802..874084,874148..874646,
FT                   874694..874961)
FT                   /locus_tag="ANIA_09446"
FT                   /old_locus_tag="AN9446.4"
FT                   /product="Pantothenate kinasePutative uncharacterized
FT                   protein (EC 2.7.1.33);
FT                   [Source:UniProtKB/TrEMBL;Acc:O93921]"
FT                   /note="transcript_id=CADANIAT00005593"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005593"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005593"
FT                   /db_xref="GOA:G5EAY3"
FT                   /db_xref="InterPro:IPR004567"
FT                   /db_xref="UniProtKB/TrEMBL:G5EAY3"
FT                   /protein_id="CBF76699.1"
FT                   /translation="MSATDPTPARTPRLEQAITNPGTVKINVKGAFIVDDDPRSKSPVR
FT                   EEGVHYEGQDIRLPHHTGVVSHVAVDIGGSLAKLVYFTRELDSPDNGGRLNFINFETDR
FT                   INLCLEFIKRLKEEHRDSNGGTKEELCVVATGGGAYKYYDKLKETLNVDIMREDEMECL
FT                   ITGLDFFITEIPNEIFTYSETEPMQFAEARPDVYPYLLVNIGSGVSMIKVSGPKQFQRV
FT                   GGTHLGGGTFWGIMSLLTGARTFDDMLAMADRGDNSGVDMLVGDIYGMDYGKIGLKSTA
FT                   IASTFGKVFRLQNRERVASDGEAPQDGSRQKADEPIFKHEDMSRSLLYAISNNIGQIAY
FT                   LQSEKHQVKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRHEGYIGAVGAFLR
FT                   RKPVNWGRRNSIDEHVPAQGL"
FT   gene            877295..878881
FT                   /locus_tag="ANIA_11232"
FT                   /old_locus_tag="AN11232.4"
FT                   /product="phosphatidylinositol:UDP-GlcNAc transferase PIG-C
FT                   (AFU_orthologue; AFUA_3G07170)"
FT   mRNA            join(877295..877673,877732..878881)
FT                   /locus_tag="ANIA_11232"
FT                   /old_locus_tag="AN11232.4"
FT                   /note="transcript_id=CADANIAT00005594"
FT   CDS_pept        join(877295..877673,877732..878870)
FT                   /locus_tag="ANIA_11232"
FT                   /old_locus_tag="AN11232.4"
FT                   /product="phosphatidylinositol:UDP-GlcNAc transferase PIG-C
FT                   (AFU_orthologue; AFUA_3G07170)"
FT                   /note="transcript_id=CADANIAT00005594"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005594"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005594"
FT                   /db_xref="GOA:C8VAA4"
FT                   /db_xref="InterPro:IPR009450"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAA4"
FT                   /protein_id="CBF76701.1"
FT                   /translation="MPSLPDSHPPPVPPPVPVETHPNRTGGLKPPAAEQRALPDPTRLA
FT                   PEDAYYAPSLLRNRPGSSNYEDPIRSLSGTAAAATAASVAALRPPPAVPGAVTRKENRK
FT                   PRTGARKKRKGAWKKLLWVKQSYPDNYTDTETFLDHLQRNPRVRPYDFWPLVADSTVIV
FT                   QHVCSVAIFVCCFVGIVQGRVSPVSVVCWGSVGTAVGWILWDWWAFTEHAENGRAAEHA
FT                   MEGDDGSSSSSAASFVHSTNQRANGQKENQVHGLGLSMAQNEPGPLRRQSTGLSVDSLT
FT                   AQDPGSPSTGCTGGAAAQPQSWQPQSFLSRNRQRLSTVKSAFLIYFSLLGLSPILKSLT
FT                   KSTASDSIWALSCWLLIMNIFSFDYGSGEGAGATKFPASLSTNAAVMASTVLASRLPST
FT                   THVFSLMLFSIEVFGLFPIFRRQLRHISWTGHIFLTLTLVMLAGGAVGITLRGGWMGAI
FT                   IGSILGSILTALAMGGCSWWLISLQKYKNVVSGPWDPARPIIRRHWD"
FT   gene            879496..881834
FT                   /locus_tag="ANIA_11233"
FT                   /old_locus_tag="AN11233.4"
FT                   /product="class V chitinase, putative (AFU_orthologue;
FT                   AFUA_3G07160)"
FT   mRNA            join(879496..879575,879636..880535,880584..880925,
FT                   881076..881160,881208..881834)
FT                   /locus_tag="ANIA_11233"
FT                   /old_locus_tag="AN11233.4"
FT                   /note="transcript_id=CADANIAT00005595"
FT   CDS_pept        join(879496..879575,879636..880535,880584..880925,
FT                   881076..881160,881208..881834)
FT                   /locus_tag="ANIA_11233"
FT                   /old_locus_tag="AN11233.4"
FT                   /product="class V chitinase, putative (AFU_orthologue;
FT                   AFUA_3G07160)"
FT                   /note="transcript_id=CADANIAT00005595"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005595"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005595"
FT                   /db_xref="GOA:C8VAA5"
FT                   /db_xref="InterPro:IPR001002"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018371"
FT                   /db_xref="InterPro:IPR036861"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAA5"
FT                   /protein_id="CBF76703.1"
FT                   /translation="MILKHAALALAALQCVAGLRFAMYIDEWHVNGLPGSDQTQGITHA
FT                   IMGFAKSTDFTGDAPAAFQPFEPVSTFRNRFSPDTKVMIAIGGWGDSAGFSAGAKDEAS
FT                   RERYAKNVAAMLESTGFDGVDIDWEYPGGNGEDYKKVPNDQKVDEIETFPLLLQALRTA
FT                   VGDKKIISIATPGKREDMIAYTTEQGPKIWPSVDMINIMSYDLMNRRNNETKHHTGIAD
FT                   SHDTIKAYLEIGAPPEKINLGFAYYAKWFTTQSDVDCGTYPIGCPTVAMEAADGSDNGK
FT                   SGAMTFEPQNMAAQPSDLKVSTDMTCGLAKGTRCPAGTCCSIYGNCGTGDDFCLAACDS
FT                   NFGECKGVPIQDSWRRARAEGQTDEEGGGQYYMDTQNHLFWTWDTPTLMTRKFTEIVDV
FT                   EKLGGVMAWSLGEDTYNFEHLKAMQEGVAQRAGGTATPARTRCSGGSQSACSKRHGAVG
FT                   VSLSRQQRPAKPHAGNSRSFLIVYKSTSVQFSAAVGFNSMKCFIVLTFVPLVLALTIPN
FT                   TNKNHDASSVEFIQQHQQRLFGTKTTVAEYKRPSLKINHGTIIPANKERTQATATTSNP
FT                   SYIHALRIEQAPYHLIARYSNALFALGLLLLVPLTLGIIELAGRLFRCVSVDECPERGR
FT                   EKQGTESHQEIEEWAFRQRERDNKKRPATVAVEMIDTMKIGS"
FT   misc_feature    881189..1035823
FT                   /note="contig 1.81 1629..156263(-1)"
FT   gene            complement(881908..883115)
FT                   /locus_tag="ANIA_04822"
FT                   /old_locus_tag="AN4822.4"
FT                   /product="tartrate dehydrogenase, putative (AFU_orthologue;
FT                   AFUA_8G01160)"
FT   mRNA            complement(join(881908..882249,882311..882801,
FT                   882875..883115))
FT                   /locus_tag="ANIA_04822"
FT                   /old_locus_tag="AN4822.4"
FT                   /note="transcript_id=CADANIAT00005596"
FT   CDS_pept        complement(join(881908..882249,882311..882801,
FT                   882875..883115))
FT                   /locus_tag="ANIA_04822"
FT                   /old_locus_tag="AN4822.4"
FT                   /product="tartrate dehydrogenase, putative (AFU_orthologue;
FT                   AFUA_8G01160)"
FT                   /note="transcript_id=CADANIAT00005596"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005596"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005596"
FT                   /db_xref="GOA:Q5B3Q8"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Q8"
FT                   /protein_id="CBF76705.1"
FT                   /translation="MAKTYRIATIPADGIGPEVIDAGVIVLKALADKLQSFSLDFTHLD
FT                   WSSETFKATGKYIPDGGLEVLKKNDAILFGAVGAPDVPDHISLWGLRLAICQPFQQYAN
FT                   VRPTRVLRGTQSPLRKCNTGDLDWVIVRENSEGEYAGQGGRSHRGHPWEVATEVAIFSR
FT                   QGVERIMRFAFETAAKRPRKLLTVVTKSNAQRNGMVLWDEVANIVAKDFPEVTMDKMLV
FT                   DAMTTRMVLKPESLDTIVASNLHADILSDLAAALAGSIGIAPTSNLDPTRQNPSMFEPI
FT                   HGSAFDITGKGIANPVATFWTAAEMLEWLGEKDAADKLMQCVESVCESGILTADLGGTA
FT                   TTKEVTSAVVEEINRLN"
FT   gene            complement(883351..885426)
FT                   /locus_tag="ANIA_04821"
FT                   /old_locus_tag="AN4821.4"
FT                   /product="Miscellaneous Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(883351..883873,883939..884473,
FT                   884514..885426))
FT                   /locus_tag="ANIA_04821"
FT                   /old_locus_tag="AN4821.4"
FT                   /note="transcript_id=CADANIAT00005597"
FT   CDS_pept        complement(join(883351..883873,883939..884473,
FT                   884514..885426))
FT                   /locus_tag="ANIA_04821"
FT                   /old_locus_tag="AN4821.4"
FT                   /product="Miscellaneous Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005597"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005597"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005597"
FT                   /db_xref="GOA:Q5B3Q9"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Q9"
FT                   /protein_id="CBF76707.1"
FT                   /translation="MDSGTSRHGSPSKRQKLTPRAHELGVMRKFTDNGSESASFLGSSS
FT                   GIHFIRIVYNAFARRSAHLKKPQQTSKDAQVPGEDDQLHHQYPDLWYPHELDLQANASL
FT                   PTFEALVQWTRPYFENWHAIFPFLSGPTFLVILEHLGRDGFRALSVADGILVRSIVSIS
FT                   LMDRRQTKLRGAQIPIPAALVFRSVHQAMESLYTLLCAPPSIRILQAAFGVQLFLTSLL
FT                   RLNAASRIGGTIIRTAFHLGLHRCPVRFSFSGPEIATRRRLFWSIYCLERYLSQALGIP
FT                   LGIKDDDIDVCYPNAEIHSSVDEGAQLLTIAFLDHRLRLLGYLAKFASLRGRIIEVRNK
FT                   SIIHREDSMDATQALHGELTHWWNEVYDDVYPLGVDDADTIVSSPIAPFHRTLLIALRH
FT                   EAIISLNRPLLAAEAASPEYRTALQICIESSRSLITTLRQFLAESSGSSTPLIWPSFTW
FT                   AVWMSCLILIYAAWEGEFPASSASRSGLAILKHLSQRGNTWAQTCIEAIRDLDSALTTP
FT                   EQQTPANPRTTETSQDDRGKNPNASADTVVSGIHLDHHLQQAPSSTPGEGHLSTPTPHA
FT                   AASHQWNDPSMIFGNQAINNLAAASGLVLGTGLPDLSNGGEGGEEGFGIGDLWSLADGP
FT                   WLIHESHDLAENVQNNADFTL"
FT   gene            885638..886548
FT                   /locus_tag="ANIA_10597"
FT                   /old_locus_tag="AN10597.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(885638..885704,885830..885843,885890..886548)
FT                   /locus_tag="ANIA_10597"
FT                   /old_locus_tag="AN10597.4"
FT                   /note="transcript_id=CADANIAT00005598"
FT   CDS_pept        join(885648..885704,885830..885843,885890..886364)
FT                   /locus_tag="ANIA_10597"
FT                   /old_locus_tag="AN10597.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005598"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005598"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005598"
FT                   /db_xref="GOA:C8VAA8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAA8"
FT                   /protein_id="CBF76709.1"
FT                   /translation="MTDKQNPIACEPCRQKKCKCDRILPACSQCSDPAKCVYPESGKRG
FT                   LPQGYITHLESRLAATERALYSSYSYLRTSSPRSFSIPNSSQPGPSRTAAVNEWSRLPL
FT                   RNADDLELWWAEKTPLYGTAARDAFSEWGLPTRDKGIPAPTSPVNLNSRHVDAGPSTGH
FT                   PREGRAELLAESEPSVYF"
FT   gene            886584..888210
FT                   /locus_tag="ANIA_04820"
FT                   /old_locus_tag="AN4820.4"
FT                   /product="succinate semialdehyde dehydrogenase (Eurofung)"
FT   mRNA            join(886584..886637,886688..886775,886829..888210)
FT                   /locus_tag="ANIA_04820"
FT                   /old_locus_tag="AN4820.4"
FT                   /note="transcript_id=CADANIAT00005599"
FT   CDS_pept        join(886608..886637,886688..886775,886829..888210)
FT                   /locus_tag="ANIA_04820"
FT                   /old_locus_tag="AN4820.4"
FT                   /product="succinate semialdehyde dehydrogenase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005599"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005599"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005599"
FT                   /db_xref="GOA:Q5B3R0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3R0"
FT                   /protein_id="CBF76711.1"
FT                   /translation="MAQQYKLPFELDNPDLLHFDSYVGNAWVTAKSGARFEVVDPGTDL
FT                   PWASCPTNSAEDVDSAVQIAHDAFEKFKKVNPRQRAQWLLKWDSLIREARSDLAKILTH
FT                   ETGKPIAESYGEIDYATGFTWWFAGEAERIQGSIAVPAAPNRRVFTVKQPIGVAAALVP
FT                   WNFPIAMVLRKAGAALAAGCTMIVKPSPETPLTALVLAHLAEKAGFPAGVFNVLTTDLE
FT                   NTPPLSEALCKHPLVKKVTFTGSTRVGKLIASHCAHGLKKVTLELGGNCPFLVFDDADL
FT                   DQALDQLMALKWRHAGQACITANRIYVQAGIYDKFAQLLKERTAKLVIGHGAKEGTTLG
FT                   PLTTPRSIDKAISQVEDARRLGADVILGGSRVQGTQGYFFEPTILKNMTKDMLVSREES
FT                   FAPIAALYRFETEEEAVKLANDTSMGLASYAFSKNIDRMWRLLENLEAGMIGMNTGNSS
FT                   AAESPFGGIKESGYGKESGKEVAVNEYLITKTGTLTIDGQY"
FT   gene            complement(888452..891153)
FT                   /gene="fluG"
FT                   /locus_tag="ANIA_04819"
FT                   /old_locus_tag="AN4819.4"
FT                   /product="Protein fluG
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P38094]"
FT   mRNA            complement(join(888452..888681,888735..889977,
FT                   890029..891153))
FT                   /gene="fluG"
FT                   /locus_tag="ANIA_04819"
FT                   /old_locus_tag="AN4819.4"
FT                   /note="transcript_id=CADANIAT00005600"
FT   CDS_pept        complement(join(888452..888681,888735..889977,
FT                   890029..891153))
FT                   /gene="fluG"
FT                   /locus_tag="ANIA_04819"
FT                   /old_locus_tag="AN4819.4"
FT                   /product="Protein fluG
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P38094]"
FT                   /note="transcript_id=CADANIAT00005600"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005600"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005600"
FT                   /db_xref="GOA:P38094"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38094"
FT                   /protein_id="CBF76713.1"
FT                   /translation="MATLSSLRHLIQTHPLIDNHAHNLLSQSAACKYAKYPFEQIISEA
FT                   QGVALANAPSTLSFHRAASQLATLYQSSSSDWDSVRAARDQSVQRDYEGLIRKCLEGTQ
FT                   VLLLDDLLTENDVELFDWHDRFTASATKRIVRIEALAASVLSQIVHGGPVPQDSSDLSA
FT                   FQTLWESFSRNFSALVSDAIADPAVVGFKSVICYRTGLDVQPTDDRDTERLIRSFARTI
FT                   SQAAVSTPRVEDKPLNDWLVRQTLNLLKAAKVTQPNKPLQLHTGLGDNDINLLKSNPAH
FT                   LQSLIAQYPEVDFVLLHSSYPYTREAGYLACVYPNVYLDLGEVFPMVSRDAQESILRES
FT                   LEIVPSTRLLWSTDGHFFPETFWLANRQFRDALEKVFVDYVQNGDYTIEQAMQAAADIL
FT                   FHNSNRLYELNEQPPSAALSSGHQTVSRISSTDLLEKFIRSNPGVKYVWTQFIDYTATV
FT                   RVRMFPVMEFAKIVRKQRRLGISMATFWMLQDDEVVGGSTTGQFYLIPDLSTLSPNVGI
FT                   DSKSATVMTWWKSEQGESLEECPRTNLLNINNKLKDEFGIQATCGFEIEVVFLKPTTDP
FT                   STGEEDWAPSVTNHSWSQMTRETRRMLPLLEEIAETLASIGIHLQQFHAESAPGQFEFI
FT                   LPPDNPVAAVDTLIKSRQVIANIVEKHGLRATLYPRPYPSAAGTASHAHVSISPSTKEE
FT                   SFLAGVLQHYPAVLAFTLSGDASYDRVKSGIWAGSEWVTWGTQNREAPIRKISPGHWEI
FT                   KSLDGLANMYLAMAAFLAAGYTGVKENLPLTIKDCPYDAASLPESERAALGITTKLPNT
FT                   LAKSLAALESDEILRSLLGENLVEDYIIVKRAESKKLSAMDEKARRKWLVERY"
FT   gene            complement(891930..895902)
FT                   /locus_tag="ANIA_04818"
FT                   /old_locus_tag="AN4818.4"
FT                   /product="sensor histidine kinase/response regulator,
FT                   putative (AFU_orthologue; AFUA_8G06140)"
FT   mRNA            complement(join(891930..892165,892221..893944,
FT                   894007..895304,895379..895520,895571..895902))
FT                   /locus_tag="ANIA_04818"
FT                   /old_locus_tag="AN4818.4"
FT                   /note="transcript_id=CADANIAT00005601"
FT   CDS_pept        complement(join(891930..892165,892221..893944,
FT                   894007..895304,895379..895520,895571..895902))
FT                   /locus_tag="ANIA_04818"
FT                   /old_locus_tag="AN4818.4"
FT                   /product="sensor histidine kinase/response regulator,
FT                   putative (AFU_orthologue; AFUA_8G06140)"
FT                   /note="transcript_id=CADANIAT00005601"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005601"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005601"
FT                   /db_xref="GOA:Q5B3R2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3R2"
FT                   /protein_id="CBF76715.1"
FT                   /translation="MASSRSREQDHIDGRRARELYRYFQPQRSLSADRLLTHSTSDSES
FT                   AQLGDAPAGESIFATTPPSPALSGQVASTTTGLLPEALILGEYNATLNSFAQLAALRLD
FT                   VERVVISVSDRSSMFIIAQSSRSHRNGKKPSEKDDSGTWDGCYPLSSATWAMCKKTVDL
FT                   PPSNRERGEYHFLEINDMSRDERYKNISFVKGDQRFRFYAGMPLTTESHKINIGCFFLL
FT                   DTKPHNGLTVEEKEIMGSISVLIMNFLKVSRQASEGRRAARLSRGLSCFVEGSSSFVDT
FT                   ADPSYTGSVSTLPGSPPFSAPRGNHLSVRSSNSVEGLLKRSHSSDARSFSSISDYKIDP
FT                   GRSSNPPTPLPEWWSGTQRRELEGLDQSHGNSWAFKRAANLLRESLELGGDGGVVFLET
FT                   GTTPALDIDSGSDYTAENVTPASVLAMSTNEEPFAPSPGSTVASPAANLDTGFLQQLIR
FT                   RYSKGKLWSFHRDGSVSSSDDENAKPSRNSARTARAQELTKSAPKRWRSVENTLLNTYF
FT                   PNATQVLFVPLWNAASSQWFAGCFCWNTVESRVFSSSVELSSVLGFGSSIMVEHSRLES
FT                   LISDRQKGDFIGSISPLHGILAAAEFLSGTNLDEFQGQLLDTINACSLTLLDTMNQVLD
FT                   FSKIVSLERKARQMRQNKKQQFAGFSGKASVGLDNSVRTDIALLAEEVVEGVCLGHAYS
FT                   LKSSSNPMSPAADLPKGKRVSHPRAEMGVEVVVDIAQNNWTYNAQPGALRRIIMNVFGN
FT                   AMKYTEAGHVCVRLEAAESNDDRHSQPAEDLITLTVSDTGKGISEEFLRGRLYTPFAQE
FT                   DTLAVGTGLGLSIVRSLVKSLGGSIDIHSRAGEGTTVRVTVPLTRPGDDVEVISPTTTE
FT                   PDIVRSASEKDPPNHCDLLRHNYTNKRAAIIGKGPTDARAHLLWSTISDYLTRWYEFEL
FT                   VSWPSEQPVDIVLADEHMLADLPRTFSTLTSLPPLIILCSRSIDYEVARMQWSPLADVV
FT                   SIITRPCGPYKLARTIQKCFDSAKGTVSEQAQAERTLPFRPKTTLLTAANAIPEEEQKS
FT                   FGILNITPDSTDGASSNTPNSKGSDRSTPSQESSEMSDPMSTLASSCQLRPQPVAESTA
FT                   KLERTPKILVVDDNFINLNLMLTFLRKRRLQYLDSAENGQLAVDAVERTPGGYDLIFMD
FT                   ISMPVMNGFEATRAIRAIERERGTELPTPATIIALTGLSSVRDESEALSSGFDLFLTKP
FT                   VSFKEVSKLLDEWSAKAI"
FT   gene            complement(896724..899486)
FT                   /locus_tag="ANIA_04817"
FT                   /old_locus_tag="AN4817.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_3G07120)"
FT   mRNA            complement(join(896724..897053,897113..898930,
FT                   898981..899316,899387..899486))
FT                   /locus_tag="ANIA_04817"
FT                   /old_locus_tag="AN4817.4"
FT                   /note="transcript_id=CADANIAT00005602"
FT   CDS_pept        complement(join(896866..897053,897113..898930,
FT                   898981..899170))
FT                   /locus_tag="ANIA_04817"
FT                   /old_locus_tag="AN4817.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_3G07120)"
FT                   /note="transcript_id=CADANIAT00005602"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005602"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005602"
FT                   /db_xref="GOA:Q5B3R3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3R3"
FT                   /protein_id="CBF76717.1"
FT                   /translation="MAAAAGQPHEDMGSQQAEKGWWKRVFRSASSGNSRSSQGPEDIDY
FT                   RPRATLGILSDRETDEVPGTVLLLSSNRNEPLGLRHQPQRTSASSLPVSHPPSRSSSRA
FT                   SAPPTKKTADGKIVLNPQPDDSRNDPLNWPVWRRDAALISLGFYCLMGGGMTPILAAGF
FT                   NQVAEAYDVDTQKVAYTTGLYMLGLGIGSVVMSPTAILWGKRPVYLLGATLFIISAVWC
FT                   AVSPNYPSLVVARIFQGIAVSPVECLPSATIAEIYFLHERAYRVGIYTLLLLGGKNLIP
FT                   LVSAAIIGSLGWRWVFWIVAIIVGACLVLIFFFLPETFWDRTPRPRRHRKRPDFYRSVS
FT                   DMVSHGLHRGRTTNAHPRDISEDAPDAVSQKRSKKGHVGFIENEPEDEELEQEKQELPY
FT                   GSDPVSLVQSQSQVADPSVEPSDPESTEKPSLPPLTNGGATRSSDLEAGRFASPSPARS
FT                   ESADPAAGLSLPVQYTNRLRDKTKIPYTYYLRPWNGRISQDRWLRVAIRPFILFAYPAV
FT                   LWSTAVYALSVGWLIVLSEVVSHIYQDRETYNFTALQTGLVYISPFVGGLLGTAVAGKI
FT                   SDIIVRYMTRRNGGVYEPEFRLIMAIPIALSTTIGLMGFGWSAQEKDAWIVPTIFFGLV
FT                   SFGCCLGSTTSITFCVDSYRQYAGEALVTLNWSKNVFHGLVFSLFVVDWMEDDGARTVF
FT                   IALGVIQFGLLLFSIPMYIFGKRARMWTVRKKLMERF"
FT   gene            900833..902598
FT                   /locus_tag="ANIA_04816"
FT                   /old_locus_tag="AN4816.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(900833..900934,901066..902598)
FT                   /locus_tag="ANIA_04816"
FT                   /old_locus_tag="AN4816.4"
FT                   /note="transcript_id=CADANIAT00005603"
FT   CDS_pept        join(900833..900934,901066..902598)
FT                   /locus_tag="ANIA_04816"
FT                   /old_locus_tag="AN4816.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005603"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005603"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005603"
FT                   /db_xref="GOA:Q5B3R4"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3R4"
FT                   /protein_id="CBF76719.1"
FT                   /translation="MPVRQGPWDDHREEAMSGQLSECQAEHYISDGGVNWRLFTPAERR
FT                   NIAIYILGIMMYKFGLEAFNGSIVTLATNRYDYDAYLTNTTPKTFQRVGLMVGLNQACQ
FT                   CVGSILIAPLIRRFPSRLVLAGAVLVFGLLSALLLIIDASTGGRFLPSAFRDHHPEHDF
FT                   HYYGSYDTDGIIPVYCVAGIAYGMVELIRRVIPRDLVGGNVQKLRQVDALVHIFYEVSG
FT                   TAGAFCTALALIPYLGNNYSFLITPICFFLSAAGWFFIGDHGFQSQRTQVLEDQPPYIQ
FT                   AVVVGFWLFLESIWTGGRILFSSRKFIWLLPGYSVALYAHRYLENSVAPAISRRYLGNA
FT                   AWSQIIVGGSNLGELLGALFVILFTNTVATPIPWLRLDALLLLVTWYLPYWRPEMHQVS
FT                   MAWIAAATFLPISFGWAAGDVSLAAYIQAALARVESKTRNVSSLGAVMAFLYSTYIVLY
FT                   AITSPILGSYIDHIYEKTGGPDGNGNIYEAIRNVGSVQFSVVAILVLVATFVPRGSLSL
FT                   NPKMLHDEDLEHELPGLAQLSSKEDFN"
FT   gene            complement(902801..904125)
FT                   /locus_tag="ANIA_04815"
FT                   /old_locus_tag="AN4815.4"
FT                   /product="extracellular serine-rich protein
FT                   (AFU_orthologue; AFUA_6G00670)"
FT   mRNA            complement(join(902801..903586,903648..903716,
FT                   903787..904125))
FT                   /locus_tag="ANIA_04815"
FT                   /old_locus_tag="AN4815.4"
FT                   /note="transcript_id=CADANIAT00005604"
FT   CDS_pept        complement(join(902801..903586,903648..903716,
FT                   903787..904125))
FT                   /locus_tag="ANIA_04815"
FT                   /old_locus_tag="AN4815.4"
FT                   /product="extracellular serine-rich protein
FT                   (AFU_orthologue; AFUA_6G00670)"
FT                   /note="transcript_id=CADANIAT00005604"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005604"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005604"
FT                   /db_xref="GOA:Q5B3R5"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3R5"
FT                   /protein_id="CBF76721.1"
FT                   /translation="MSYNNPSSTLASRFSNSNTATSSTVKATYTVRVGPKEDPHGYVPR
FT                   SLNASVGDLIVFEFYPRNHSVVQADWKAPCMPADGNYFFSGIKNDFNEVNGQVVGRLPT
FT                   WNWTVDREEPTFFYCTGADSCIRNGMVGVINPNITQTWESQRKAALEAPYMLLPGQSMP
FT                   AEGSNPNTETTATHLSPSPSAGTSSTSSPNALSGGAIAGIVVGSVAFLAILCSLLFLLG
FT                   WNRVYKQWLSQGQEGSGDCASSSKNTRTVQWVDSSTPAAIGVGVDSERSEGDRGSTGFP
FT                   GSLRAHGSSLLHEPAADGTMVGLEFGPGSRPGTAPGTGTGTGFVSVDHCLPLAPAQTGT
FT                   SSIFDGGYGISSPLGAQVPFPQQQQQQPHWNWDHSIHPFHLSGCRGEPSELEADNHK"
FT   gene            906152..906412
FT                   /locus_tag="ANIA_11447"
FT                   /old_locus_tag="AN11447.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(906152..906184,906227..906412)
FT                   /locus_tag="ANIA_11447"
FT                   /old_locus_tag="AN11447.4"
FT                   /note="transcript_id=CADANIAT00005605"
FT   CDS_pept        join(906152..906184,906227..906412)
FT                   /locus_tag="ANIA_11447"
FT                   /old_locus_tag="AN11447.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005605"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005605"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005605"
FT                   /db_xref="GOA:C8VAK1"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAK1"
FT                   /protein_id="CBF76723.1"
FT                   /translation="MLTSSLGFHYMIQCLTGKNVSRDPKSLDIPFVMSLVCFQIIWNSV
FT                   LILVNPVAHRILKVSCSLYQPKRCDQS"
FT   gene            908341..910007
FT                   /locus_tag="ANIA_04814"
FT                   /old_locus_tag="AN4814.4"
FT                   /product="UPF0016 domain protein, putative (AFU_orthologue;
FT                   AFUA_3G07080)"
FT   mRNA            join(908341..908934,908992..909880,909940..910007)
FT                   /locus_tag="ANIA_04814"
FT                   /old_locus_tag="AN4814.4"
FT                   /note="transcript_id=CADANIAT00005606"
FT   CDS_pept        join(908341..908934,908992..909880,909940..910007)
FT                   /locus_tag="ANIA_04814"
FT                   /old_locus_tag="AN4814.4"
FT                   /product="UPF0016 domain protein, putative (AFU_orthologue;
FT                   AFUA_3G07080)"
FT                   /note="transcript_id=CADANIAT00005606"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005606"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005606"
FT                   /db_xref="GOA:Q5B3R6"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3R6"
FT                   /protein_id="CBF76725.1"
FT                   /translation="MKFHTTTRVLLLLPAITTVLSDKVSEYNNGNEISVAERDTSTVNA
FT                   VVPGLDELAPKPSPRGTQDAPVDGKDGRPHAGPWVETNAERDRKSSGTLNEQAQQIAES
FT                   AEQLDSNGRPIPYSNDGVMDDRNRAAPKEGTRGTEGGVSGKLKDSTYSGDKSPGSPKEA
FT                   PPLPHSEEQKLPSTGDNSGKDTKGYSSDSTLGVLERPADMPGKPHDIPLPKSPTTVKDG
FT                   LVGLNKEGSSTAGNKVPPEEERDAFHSLLFSFTMIVVSEIGDKTFLVAALMAMRHPRLL
FT                   VFSAAFSALIGMTVLSAVLGHAVPSLIPKTFTKFLAAVLFFVFGAKMLKEGREMSPDEG
FT                   VGEEMREVEQELEEKEHEQLRMSRRRSSVTPHALEAGRLGRKPRSSANRLPSPPESLSS
FT                   SSSRGSSPQPGQRWNDLLVGLNNLFSLLLSPAWVQTFVMTFLGEWGDRSQIATIAMAAG
FT                   QDYWFVTIGAITGHGLCTAAAVIGGSAIAGKVSMRVVTLGGAAAFLVFGCIYLLEALF"
FT   gene            910370..913677
FT                   /locus_tag="ANIA_04813"
FT                   /old_locus_tag="AN4813.4"
FT                   /product="MYB DNA-binding domain protein (AFU_orthologue;
FT                   AFUA_3G07070)"
FT   mRNA            join(910370..910882,911048..912269,912318..913370,
FT                   913422..913677)
FT                   /locus_tag="ANIA_04813"
FT                   /old_locus_tag="AN4813.4"
FT                   /note="transcript_id=CADANIAT00005607"
FT   CDS_pept        join(910702..910882,911048..912269,912318..913370,
FT                   913422..913557)
FT                   /locus_tag="ANIA_04813"
FT                   /old_locus_tag="AN4813.4"
FT                   /product="MYB DNA-binding domain protein (AFU_orthologue;
FT                   AFUA_3G07070)"
FT                   /note="transcript_id=CADANIAT00005607"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005607"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005607"
FT                   /db_xref="GOA:C8VAK3"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAK3"
FT                   /protein_id="CBF76727.1"
FT                   /translation="MAARPQSRSQSRQRQDLSKFQGSPSSRRMTRSQSREIEGLQVNSN
FT                   RLIGNERRSKRVQSKALDPVVEESPLKQPHQTGDRHAKAATPDPDVADITGTTFVQEPE
FT                   TDFEAGILLDALRDIEQNGNDVLELLIPSKGRLVDAVKKANQLSDPRNTQSKRLLRLLK
FT                   ILDEDIKIFGSHTYIDVDGVVRKVSSALADRREDLEDWSPAPILQMANCARFACEILLA
FT                   GTNPNSQRQAIRNIQKLFPRPFMTGLAGAGEEKEAGESVLEKETLNLALEIRTQSLISQ
FT                   LEDNQDSPGSDSKNFVRLCFFTDSSRKSPLRGFNLPNLSNADGTLPAQYTDDVQNRYEE
FT                   ILLGEMDGVFDVNELRSSYNWQRFVLHAAHWVRKRTDELHVEVKKRISTQAVRYTLSNA
FT                   KASSFGSTLGASEAEPSGELQEAGGDTTRQDAVAEGFPAGLEPQPQPQPQQPESRDVHR
FT                   DTERRRSSRPSFLNSASIQRITQRQERLRSGTETSERRQQPDTVQPGTPTGNELPAVDR
FT                   QIPSNRSSQHTLFHERVPSLDDGPTLVTEEPELNFGEDSEFANVDESTHIERSRSPSVA
FT                   PRRTAPWRPEPTSSAQTTDSLMPTQSQMVWEAVKDGLSRQPVSSPRRSVTSRFIDRQPD
FT                   AARVSPIRDDDSQQSAVRRVESRVSRKRARASTVTDSDVEESIFDHDDRSPDIESQRAK
FT                   KPQPERKKRPRLEEAESRRLDTSTDTHQETVVEEPSRPARQRTAQPASISSQRSVGQYT
FT                   AKPRNSWTEAEDNRLIRLMKDHGHKWSLIERQNIAQPAEEGEVRIEGRGQVAFKDRARN
FT                   MKISYYREGLRIPDYLEHVTMKEKDVEKLLERGITNILPHDMEAYNRARAR"
FT   gene            complement(913960..914562)
FT                   /locus_tag="ANIA_04812"
FT                   /old_locus_tag="AN4812.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(913960..914562)
FT                   /locus_tag="ANIA_04812"
FT                   /old_locus_tag="AN4812.4"
FT                   /note="transcript_id=CADANIAT00005608"
FT   CDS_pept        complement(913960..914562)
FT                   /locus_tag="ANIA_04812"
FT                   /old_locus_tag="AN4812.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005608"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005608"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005608"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3R8"
FT                   /protein_id="CBF76729.1"
FT                   /translation="MHLSKTLIPLALLAPLAAAIPDDANPLLDILTADDSTPESAYSVN
FT                   PAVAETAVGAPVGVSGPVATSSPSADDSDSETETEISNASTGSGSVSTSSAEPETTADA
FT                   PSTTTTSIPTNILTAIESDPTGSAAGSMTTVVATTTTHQSGSGAAETSSTATATPSDGS
FT                   EGSAASPTPTDDGAAAVLGSPASMLGAVLLSFAVRFF"
FT   gene            complement(916257..917723)
FT                   /locus_tag="ANIA_04811"
FT                   /old_locus_tag="AN4811.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(916257..916523,916577..916715,
FT                   916761..916853,916943..917017,917060..917068,
FT                   917190..917314,917501..917544,917592..917615,
FT                   917663..917723))
FT                   /locus_tag="ANIA_04811"
FT                   /old_locus_tag="AN4811.4"
FT                   /note="transcript_id=CADANIAT00005609"
FT   CDS_pept        complement(join(916257..916523,916577..916715,
FT                   916761..916853,916943..917017,917060..917068,
FT                   917190..917314,917501..917544,917592..917615,
FT                   917663..917723))
FT                   /locus_tag="ANIA_04811"
FT                   /old_locus_tag="AN4811.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005609"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005609"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005609"
FT                   /db_xref="GOA:Q5B3R9"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3R9"
FT                   /protein_id="CBF76731.1"
FT                   /translation="MPFKTWLTETLGIKVPIVQGGMMWVGRAEMTSAVANAGGLGFLFG
FT                   VNITMLPAINAPDYLAYAKAAVQEGIKIIETAGNPEPILNLNSSLPTGVFGTATNIRGL
FT                   LQRWSRRRMCAQELKIPFIASGGFCDGKGLATALVLGAQGINMGTRWMCTVEAPIHQNV
FT                   KEAIVKMDENGTILVLRKFRNTTRLARNEVTLEVHKIENSKLDPQFQEVAHLMSGARGR
FT                   GVYETGDINAGVWSVGLAAGLIKSIPTCEELARTIEREAVDALSKASSLYSNRASL"
FT   gene            918113..920007
FT                   /locus_tag="ANIA_04810"
FT                   /old_locus_tag="AN4810.4"
FT                   /product="vacuolar carboxypeptidase Cps1, putative
FT                   (AFU_orthologue; AFUA_3G07040)"
FT   mRNA            join(918113..918447,918550..919901,919949..920007)
FT                   /locus_tag="ANIA_04810"
FT                   /old_locus_tag="AN4810.4"
FT                   /note="transcript_id=CADANIAT00005610"
FT   CDS_pept        join(918113..918447,918550..919901,919949..920007)
FT                   /locus_tag="ANIA_04810"
FT                   /old_locus_tag="AN4810.4"
FT                   /product="vacuolar carboxypeptidase Cps1, putative
FT                   (AFU_orthologue; AFUA_3G07040)"
FT                   /note="transcript_id=CADANIAT00005610"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005610"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005610"
FT                   /db_xref="GOA:Q5B3S0"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3S0"
FT                   /protein_id="CBF76733.1"
FT                   /translation="MRSPFTPLAIGFGFLSNAGALTIPSFPQQLLGASAAEEICPLPAK
FT                   VTFDDSNLFPSVQYFQNETILQRQVDRLSRAVQIPTQITDYMTDPNDDAFAPFVDFHKL
FT                   LAGLFPLVYSKAKIEHVNRFNLIITLEPPSETVEKRKPLLFTAHQDVVPINDASDWTHP
FT                   PFSGYFDGEFLWGRGSSDCKNGLIGLLSVAEDLLSQNWTPSRPIVLAFGFDEEAQGYIG
FT                   AARIAPVLEERYGKDGVEFILDEGGGGITTLRSSLSSAGEEFEDESVIYALPDVGEKGA
FT                   VTIVLTLAVPGGHSSVPPRHTGVGIMSEIIYKLENTELDIFTPILGSNHPSRRVFECQV
FT                   RHSPEYVEDWLASALDSDDQAATAEAIARSRGESVRFTLQSSQAADIFNGGIKSNALPE
FT                   KITAVVNYRIALHQTPKMLQDRAEKIIEPIVEKFNLTWSRFLDTNKDEISSEVASSGHL
FT                   TLSTLNSPLEPAPVSPTDIDTSPVWARFAGVARSVFESVPSLKGKTVVVGGDITTGNTD
FT                   TRLYWNLSPNIYRWSPAREGRALNIHTVDERVGIDAHLEAMMLYYDLIRAFDAWDAAEQ
FT                   QTSDL"
FT   gene            complement(920211..922802)
FT                   /locus_tag="ANIA_04809"
FT                   /old_locus_tag="AN4809.4"
FT                   /product="Glutaminase A
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9UVX8]"
FT   mRNA            complement(join(920211..920429,920478..920613,
FT                   920660..920803,920853..921055,921111..921694,
FT                   921755..922197,922256..922548,922609..922802))
FT                   /locus_tag="ANIA_04809"
FT                   /old_locus_tag="AN4809.4"
FT                   /note="transcript_id=CADANIAT00005611"
FT   CDS_pept        complement(join(920360..920429,920478..920613,
FT                   920660..920803,920853..921055,921111..921694,
FT                   921755..922197,922256..922548,922609..922802))
FT                   /locus_tag="ANIA_04809"
FT                   /old_locus_tag="AN4809.4"
FT                   /product="Glutaminase A
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9UVX8]"
FT                   /note="transcript_id=CADANIAT00005611"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005611"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005611"
FT                   /db_xref="GOA:C8VAK7"
FT                   /db_xref="InterPro:IPR014870"
FT                   /db_xref="InterPro:IPR032514"
FT                   /db_xref="InterPro:IPR033433"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAK7"
FT                   /protein_id="CBF76735.1"
FT                   /translation="MRTFLLGILCAPLAILTGAASTFSPARPPALPLAVKSPYLSTWLP
FT                   AGKDGGNGGYLAGEWPAFWEGQITGWAGLIRVDGQVYTWMGLPGSATVNQTAYEYTSTK
FT                   SIFTMHIGDMVEMKITFLSPITPNDLRRQSLVFSYLDVSVTSLDGQSHSVQVYADISAE
FT                   FASGDRSAIAQWNYGVTSDGVAYHKIYRQTPLLFSEHRDQAEWGDWYWATDNVAGLTYQ
FT                   AGPDVDVREAFARNGKLTNNNDVNYRAISNNWPVFGFAHDLGSISSSTKVLFSIGLTQR
FT                   EAIQYSGNSSTLSPLPALWTSYFSTALDALDFFHHDYQKSNSLSSDLDRRIAQDSVAAA
FT                   GHDYLTITSLSIRQAFAATQLCGPANDPYLFMKEISSNGNMNTVDVIFPAHPVFLYTNP
FT                   ALLKYLLRPHLEIQESGNYPNSYAMHDIGAHYPNATGHPDGNDEPMPLEECGNMVIMAL
FT                   AYAQKAGDTAYLESHYTILRRWTDYLIEDSLYPANQISTDDFAGPLANQTNLALKGIIG
FT                   IEAMSVIASLTGDSDDKMNLTNYAHDYIEKWLILGIARNTTYPHTTLSYGSNESHGLLY
FT                   NLYADRELGLNLVPQSVYDMQSNFYPTIKGQYGVPLDTRHQYTKGDWELFTAAVASVST
FT                   RDMFIKLLAQWINETPTNRPLTDLYDTVTGDYPPVVFIARPVMGAAFTLLLLD"
FT   gene            complement(924923..927510)
FT                   /locus_tag="ANIA_10598"
FT                   /old_locus_tag="AN10598.4"
FT                   /product="annexin ANXC4 (AFU_orthologue; AFUA_3G07020)"
FT   mRNA            complement(join(924923..925234,925285..927510))
FT                   /locus_tag="ANIA_10598"
FT                   /old_locus_tag="AN10598.4"
FT                   /note="transcript_id=CADANIAT00005612"
FT   CDS_pept        complement(join(924923..925234,925285..927510))
FT                   /locus_tag="ANIA_10598"
FT                   /old_locus_tag="AN10598.4"
FT                   /product="annexin ANXC4 (AFU_orthologue; AFUA_3G07020)"
FT                   /note="transcript_id=CADANIAT00005612"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005612"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005612"
FT                   /db_xref="GOA:C8VAK8"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="InterPro:IPR037104"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAK8"
FT                   /protein_id="CBF76737.1"
FT                   /translation="MSLQVNDPRSRGRSRSPSGRTRDRSTSRDPRLPSPGPGPDPARKS
FT                   GYLLAETVDEKARTRSRSRGASPLRGYRKTSRYDSDSEHEREREREREARDSYTRLRND
FT                   RDYYYHSDSGESRGATKRSSQRYSQPPQRSSAQLDAYSDEDIYSDSDDDLAYGDIPGSL
FT                   ERGYYGYKGNSAATRPPSEKPLMTGALNAGTSPRHSAEAVSGYSRYAPGHPARTGPPTS
FT                   ETQSAWAPVPDCEKPGFVPPTSAGDSMPGAFPTTTSGLPTTQYVSSDPVQNPYVQWNTQ
FT                   PPTSGAPYAAPVSAASHQRNPSGDPNLYANPPAFKYAQIDPNVRYSAKPATATTYAPPS
FT                   KASGQTSDGQYAGVRYTTAPQYSTTATSGSQYVEIAPGSRHTRPASLSVSTNNLSVSGP
FT                   DPNNPPASPLLEAYKGTYQSISPMPSPILIAPRDDDVSDLEPLDHSTDSERRRRRKSKK
FT                   SKDEEGGLKEPKSDRSKRGSSRIRHGRHESRDSRGGGPDSVALVSPSTDRRKEVSFYDA
FT                   TDDALALRDALSHSRNIDTKTLIQVLPHLTNHEMLDLRKEYKKHVKIHGKGVNLAKHIR
FT                   VKLGNSAFGKVCYATALGRWESEAFWANCYYQSGSSRRELLIESLFGRSNGEMREIKES
FT                   FKDSRYLDSLEKCMKAELKADKFRTAVLLALEEGRQSERDPIDAELVHRDVQALHAALV
FT                   SRNGGETAMIYIIVRRSDSHLREVLRAYDKIYQRNFARDMIQKSQNLVGETLAHILNGA
FT                   INRPMRDALLLHQALRESRSGRERSELLISRLVRLHWEPRHLENVKVEFRRRYGERLEE
FT                   AIAEEILPSSGGSEWGEFCIQLARSSKTHAAKR"
FT   gene            complement(928516..930805)
FT                   /locus_tag="ANIA_10595"
FT                   /old_locus_tag="AN10595.4"
FT                   /product="Septin [Source:UniProtKB/TrEMBL;Acc:Q9C1M0]"
FT   mRNA            complement(join(928516..928616,928850..928872,
FT                   929111..930220,930276..930805))
FT                   /locus_tag="ANIA_10595"
FT                   /old_locus_tag="AN10595.4"
FT                   /note="transcript_id=CADANIAT00005613"
FT   CDS_pept        complement(join(928516..928616,928850..928872,
FT                   929111..930220,930276..930805))
FT                   /locus_tag="ANIA_10595"
FT                   /old_locus_tag="AN10595.4"
FT                   /product="Septin [Source:UniProtKB/TrEMBL;Acc:Q9C1M0]"
FT                   /note="transcript_id=CADANIAT00005613"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005613"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005613"
FT                   /db_xref="GOA:C8VAK9"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAK9"
FT                   /protein_id="CBF76739.1"
FT                   /translation="MAATATRPRTPGRGQAPIDPPPVPSENGHSQTKDSSRRTSSSLGF
FT                   LRRSKSTEPIGSKPRGKKMSKAQMEEELRRQREARPKQPPRLPDFSPPPVIETFGGDET
FT                   RNGVADVTSPLSPSQSRPSRSAMSTPVPPDYSDPYARTESMTHRGRYSYASSYVSTVNN
FT                   PRRLRRRKDPTPYNILVIGARNSGKTSFLNFLRKSLALPPHKHPSRAPDEVEYDSHNPA
FT                   SEGYTSHYLETEIDGERVGLTLWDSQGLEKNVVDIQLRGVTGFLESKFEETLNEEMKVV
FT                   RSPGARDTHIHCTFLILDPSRLDENIAAAERAAQGTPRASDSKVLGVLDENFDLQVLRT
FT                   VIGKTTVVPVISKADTITTAHMAYLRKAVWDSLKKANIDPLEILTLEDQEEYTSSEGED
FT                   EEDGETSEAEDAAGETEGGHTKEETEPKAPESPTQRSEGSQQDVGSQAVPLLPFSILSP
FT                   DKYSLQGDGPIGRKFPWGFADPYNPEHCDFLKLKDSVFSEWRSELREASRVIWYERWRT
FT                   SRLNRHDAIASPKPRSFGGRTGPDFARRPSGLKHAQNGCHCHIPVSLARPVSFGVPRCQ
FT                   SNWKLSELTVG"
FT   gene            complement(932558..934223)
FT                   /locus_tag="ANIA_04807"
FT                   /old_locus_tag="AN4807.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(932558..932788,933095..933380,
FT                   933433..933594,933646..933702,933766..934223))
FT                   /locus_tag="ANIA_04807"
FT                   /old_locus_tag="AN4807.4"
FT                   /note="transcript_id=CADANIAT00005614"
FT   CDS_pept        complement(join(932558..932788,933095..933380,
FT                   933433..933594,933646..933702,933766..934223))
FT                   /locus_tag="ANIA_04807"
FT                   /old_locus_tag="AN4807.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005614"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005614"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005614"
FT                   /db_xref="InterPro:IPR009291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3S3"
FT                   /protein_id="CBF76741.1"
FT                   /translation="MSMYLPRSVEAALAATAIPDYVLDYGKLLPTLGSSATEQLTRLAP
FT                   LVWLHSEDRYRPSGIAEHLDHALPKVNYESIEGVSLPLTLDNLDQLNALGNESVYLTSR
FT                   EGIDANPQPEWFYGADFNENGQASDVSSIIVVNDRGDGEVDAFYFYFYSYNLGNTVLGM
FT                   EFGNHVGDWEHNMIRFQDGAPQAIWYSQHSGGQAFTYDATEKQGKRPVAYSGNGTHAVY
FT                   STPGGHDHTIPGLNLPAGFLVDQTNQGVLWDPALGAYAYAYVPATQTFEPYDSSFPVNW
FT                   LDFNGRWGDDALQGGPELFGQAKYVGGPNGPKFKNIQREKLFERQKLLRLESESGVANT
FT                   IELNKRQNHESGQQFYLVSGAKGTRPRPQFNRTDAAWVVGASQSNTTFRVSLDGVDS"
FT   gene            complement(934837..935756)
FT                   /locus_tag="ANIA_04806"
FT                   /old_locus_tag="AN4806.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(934837..935252,935323..935380,
FT                   935446..935578,935686..935756))
FT                   /locus_tag="ANIA_04806"
FT                   /old_locus_tag="AN4806.4"
FT                   /note="transcript_id=CADANIAT00005615"
FT   CDS_pept        complement(join(934948..935252,935323..935380,
FT                   935446..935578,935686..935756))
FT                   /locus_tag="ANIA_04806"
FT                   /old_locus_tag="AN4806.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005615"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005615"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005615"
FT                   /db_xref="GOA:Q5B3S4"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3S4"
FT                   /protein_id="CBF76743.1"
FT                   /translation="MTDQFAYTYPSPLVGYENLEPLPEERNDDGKSLKNPQHGILSKAY
FT                   EEFPDPLSKGRRGGFDIHIYHFQNNPDQVAYARALWERIRREFPELRIYTFWDKPVGPH
FT                   PVAMFEVNLFTPAQFGAFIPWLVIYRGPLSVLVHPNTEAHEDERNHTQRAMWLGDRIPL
FT                   DLRVFKIMKEKERVEREKNENKEKL"
FT   gene            complement(936163..937384)
FT                   /locus_tag="ANIA_04805"
FT                   /old_locus_tag="AN4805.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(936163..937195,937251..937384))
FT                   /locus_tag="ANIA_04805"
FT                   /old_locus_tag="AN4805.4"
FT                   /note="transcript_id=CADANIAT00005616"
FT   CDS_pept        complement(join(936163..937195,937251..937384))
FT                   /locus_tag="ANIA_04805"
FT                   /old_locus_tag="AN4805.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005616"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005616"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005616"
FT                   /db_xref="GOA:Q5B3S5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3S5"
FT                   /protein_id="CBF76745.1"
FT                   /translation="MPLKLGKAIGDPDDDDYVAQVLAKEARDSSMKYSTLGMEAYMPAR
FT                   PTSSARKPNTRFLRHIIKETDNHNAALKRKEEREARERMRRLRDQSSSSAQASSGDHRH
FT                   GRSHRSDDRDSRRNRTDREERHRSHRSSRKSRSDSLDRDRTRTSRHERDRNDDRHRRSR
FT                   RSYRHHSYSRSRSRSPRGKNSDSHDRRLRRRTRSSSRSRSPEAKKNLKDINSSRDQRSA
FT                   AGIQDRRSDDESDPLEELVGPLPKEEAPVRSRGRGAYKPNNSNIDAHFAPDYDPSLDIQ
FT                   PEEDEVQTSRSSRRPVAGLMTGDDDWELALEALRDRARWKQKGEDRLREAGFNSDIVER
FT                   WKSGTPVATRSDEGLVENVKWSTKSEGREWDRGKFVDDDGQINVKASW"
FT   gene            937722..938719
FT                   /locus_tag="ANIA_04804"
FT                   /old_locus_tag="AN4804.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(937722..937934,937984..938203,938289..938719)
FT                   /locus_tag="ANIA_04804"
FT                   /old_locus_tag="AN4804.4"
FT                   /note="transcript_id=CADANIAT00005617"
FT   CDS_pept        join(937722..937934,937984..938203,938289..938710)
FT                   /locus_tag="ANIA_04804"
FT                   /old_locus_tag="AN4804.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005617"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005617"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005617"
FT                   /db_xref="GOA:C8VAL3"
FT                   /db_xref="InterPro:IPR037475"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAL3"
FT                   /protein_id="CBF76747.1"
FT                   /translation="MAEPNAAQIRQQIKQLEQEHGELKTQLAIVRISEPIFSPDTDRSP
FT                   SKRNSDVSTVDSPSPASLEADLSHYKELFSKLRFSYVEQVTKEKFLRAIVGDPPLVVGH
FT                   NENVELEAQLAEVKAELKARKEEVRLMVEEMEKMARDLATRYNNVQLQMTQLATLPESI
FT                   ENLESTIAALRAKQIANSETSSSQNLPLPATLSLLAKREAELAALNRQIAAAQNTLPRK
FT                   TREAETMERELGILERRKSEAIMQAREAQRKKQEGESDGLEEAGRWYRSAEEALKKLLG
FT                   VQG"
FT   gene            complement(938817..939888)
FT                   /locus_tag="ANIA_04803"
FT                   /old_locus_tag="AN4803.4"
FT                   /product="hypothetical protein similar to 40S ribosomal
FT                   protein S9 (Broad)"
FT   mRNA            complement(join(938817..939402,939464..939562,
FT                   939643..939661,939730..939767,939838..939888))
FT                   /locus_tag="ANIA_04803"
FT                   /old_locus_tag="AN4803.4"
FT                   /note="transcript_id=CADANIAT00005618"
FT   CDS_pept        complement(join(938991..939402,939464..939562,
FT                   939643..939661,939730..939767,939838..939851))
FT                   /locus_tag="ANIA_04803"
FT                   /old_locus_tag="AN4803.4"
FT                   /product="hypothetical protein similar to 40S ribosomal
FT                   protein S9 (Broad)"
FT                   /note="transcript_id=CADANIAT00005618"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005618"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005618"
FT                   /db_xref="GOA:Q5B3S7"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3S7"
FT                   /protein_id="CBF76749.1"
FT                   /translation="MAPVPRVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRV
FT                   QFTLSKIRRAARELLTLDEKDPKRLFEGNALIRRLVRIGVLDESRMKLDYVLALRVEDF
FT                   LERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSYMVRLDSQKHIDFALTSP
FT                   FGGGRPGRVQRKKAAAAAGGGDDEGEEDEE"
FT   gene            940068..941337
FT                   /locus_tag="ANIA_04802"
FT                   /old_locus_tag="AN4802.4"
FT                   /product="60S ribosomal protein L21, putative
FT                   (AFU_orthologue; AFUA_3G06960)"
FT   mRNA            join(940068..940168,940229..940296,940364..940411,
FT                   940530..941337)
FT                   /locus_tag="ANIA_04802"
FT                   /old_locus_tag="AN4802.4"
FT                   /note="transcript_id=CADANIAT00005619"
FT   CDS_pept        join(940133..940168,940229..940296,940364..940411,
FT                   940530..940854)
FT                   /locus_tag="ANIA_04802"
FT                   /old_locus_tag="AN4802.4"
FT                   /product="60S ribosomal protein L21, putative
FT                   (AFU_orthologue; AFUA_3G06960)"
FT                   /note="transcript_id=CADANIAT00005619"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005619"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005619"
FT                   /db_xref="GOA:Q5B3S8"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3S8"
FT                   /protein_id="CBF76751.1"
FT                   /translation="MGHSHGLRSGTRYAFSRNFREKGQIRLSTYLKTYRVGDIVDIKVN
FT                   GAVQKGMPYKVYNGKTGVVYNVTKSSVGVLLYKVVGNRYLEKRINVRIEHVKHSRSRED
FT                   FIKRVKENAEKKKQAKEQGIHLHLKRQPAQPREAHTVEGSTPETITPLPYDTHI"
FT   gene            944229..946493
FT                   /locus_tag="ANIA_04801"
FT                   /old_locus_tag="AN4801.4"
FT                   /product="C2H2 zinc finger domain protein, putative
FT                   (AFU_orthologue; AFUA_3G06940)"
FT   mRNA            join(944229..944519,944832..945945,946129..946493)
FT                   /locus_tag="ANIA_04801"
FT                   /old_locus_tag="AN4801.4"
FT                   /note="transcript_id=CADANIAT00005620"
FT   CDS_pept        join(944229..944519,944832..945945,946129..946418)
FT                   /locus_tag="ANIA_04801"
FT                   /old_locus_tag="AN4801.4"
FT                   /product="C2H2 zinc finger domain protein, putative
FT                   (AFU_orthologue; AFUA_3G06940)"
FT                   /note="transcript_id=CADANIAT00005620"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005620"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005620"
FT                   /db_xref="GOA:Q5B3S9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3S9"
FT                   /protein_id="CBF76753.1"
FT                   /translation="MDQEIPQTNENFDFNVSVFGYDGAVHGDLEAFIPRIIGPGTDFTS
FT                   SVGLANGYYEPPSIFYRPNEPVQTYLGPSSGQFWPSGVHAPADNVSIAHSPELRGVQDR
FT                   LQEALSLVNELISPHQGREQNANDEDKRFRCILCPQPLFCKNKGTFTRHITTTHYPSKR
FT                   YFCHICNQDSNPTSFLRKDKHLLHMRQHGQPRMSREAMEEVTEHLPPPENCAITECEQP
FT                   IRTWEDFINCLCRHCAIPDDWDHDNGSDGDDGDDDDNNGDGGNGGGNRYFPQSGNGNYG
FT                   NTSNGGPYGHYNYDQFGDLSGRSGINPHQYRGVANGGSSKQGGSQVLDLKDVPTGPGRA
FT                   GVAQSKSTFTDLKDSQPHTKNPSALLFGNDSLCPETFRVEVSLRLGDSTRKTCSDLGMK
FT                   EPQEKSSFGKQVVSISVNNEVSRELQRLRYFETCILENQKQGSLLTYVHETFVVSQHGY
FT                   FEHVIESSMQTTRRASPKKRAHLRVRVKAIAGVLALRAAVTKAPLATDNAEVEDGWELG
FT                   IPYPAQDDVFKVLAWLVQVLVFFLRMPPNPRIYVMLACGTLEAPRPH"
FT   gene            946819..949118
FT                   /locus_tag="ANIA_04800"
FT                   /old_locus_tag="AN4800.4"
FT                   /product="WD repeat protein (AFU_orthologue; AFUA_3G06910)"
FT   mRNA            join(946819..947032,947094..947162,947256..947614,
FT                   947669..948037,948088..948853,948913..949118)
FT                   /locus_tag="ANIA_04800"
FT                   /old_locus_tag="AN4800.4"
FT                   /note="transcript_id=CADANIAT00005621"
FT   CDS_pept        join(946819..947032,947094..947162,947256..947614,
FT                   947669..948037,948088..948853,948913..949118)
FT                   /locus_tag="ANIA_04800"
FT                   /old_locus_tag="AN4800.4"
FT                   /product="WD repeat protein (AFU_orthologue; AFUA_3G06910)"
FT                   /note="transcript_id=CADANIAT00005621"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005621"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005621"
FT                   /db_xref="GOA:Q5B3T0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3T0"
FT                   /protein_id="CBF76755.1"
FT                   /translation="MSSPPIAGGDRRDGSPSVGPGGTWHPARAWLEEDETGDDEDDMDY
FT                   EPDSDNHDDRADEEEYPDEDPNVDQSDSELHLGNIHIEFTMDEHDQTGEVSPARLLNIL
FT                   ASGGLQQIFRYHGFATGNAGFDGDDDGEEDEYGILGLGRRVPRRRGPPQYPKIPSDEGI
FT                   KLMRSGKFGTEPSYVDERMKRKKSLAEKVMWRELGVDGQGLQRTRVSSIAQGLIPGTTA
FT                   DKIIHYDAKCYSGQFSDDGNFFFSCAQDFKVRMYDTSNPYEWKYYKTVDYPLASWTITD
FT                   ATLSPDNRFLAYSSLRQLVCLAPTDPADSSDPIILDLASSAQRRVARDIFGRDGFAVWS
FT                   VRFSGDGREIVAGTGDHSVIVYDLETRQSVLRIRNHEDDVNAVCFGDKSSPHILYSGSD
FT                   DSTVRVWDRRSMADGREAGVFVGHTEGLTYVDSKGDGRYVLSNSKDQTMKLWDLRKMMS
FT                   TAKFDTLEPTSYGTGFDYRFDPFPSDFYYPHPHDCSVVTFRGHSVLRTLIRCHFSPPGS
FT                   SDSRYVYSGSEDGKVYVWNLDATLAGTVDVQKATHFSRPRSRRFQGHMYMSRADGNQWK
FT                   TCVRDASWHPNAPVLAATSWNGWGSSTGTCTIHSWNNGADQDECGPKFSYGDSYDAQLN
FT                   ATNLSEKALDMRAWEYEHALNEASL"
FT   gene            949538..951773
FT                   /locus_tag="ANIA_04799"
FT                   /old_locus_tag="AN4799.4"
FT                   /product="RRM domain protein (AFU_orthologue;
FT                   AFUA_3G06890)"
FT   mRNA            join(949538..950600,950658..951259,951333..951773)
FT                   /locus_tag="ANIA_04799"
FT                   /old_locus_tag="AN4799.4"
FT                   /note="transcript_id=CADANIAT00005622"
FT   CDS_pept        join(950140..950600,950658..951259,951333..951445)
FT                   /locus_tag="ANIA_04799"
FT                   /old_locus_tag="AN4799.4"
FT                   /product="RRM domain protein (AFU_orthologue;
FT                   AFUA_3G06890)"
FT                   /note="transcript_id=CADANIAT00005622"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005622"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005622"
FT                   /db_xref="GOA:C8VAL8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034771"
FT                   /db_xref="InterPro:IPR034772"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAL8"
FT                   /protein_id="CBF76757.1"
FT                   /translation="MATEDDNFDIDIYGDGSGYNANDQGDFKQDHDMKQEDTDLILDAS
FT                   DNAQNSGNSTDSGTIQQQPNVTTNGAPVTQSDTNNQQMQKDTTPQQGVKRKELDERPVD
FT                   PDATPALLISELHWWTTDDDIRGWTREAGCEDELKDVTFSEHKVNGKSKGQAFLEFTSL
FT                   PAATATKHHIDSLSTTGQSGRKFLVNYTSPIPNPFRTLPKDNPMRKDNARTGGFNSPNQ
FT                   NNANFGMGNMAGGFRGGRGGFNNRGGMSNMPGYVNRNFNNPMGGFNNPMVGAGFQGNQM
FT                   AMGNYGFGGRGGMMGGNMRGGPGGMRGRGGGMAGGPNMMGMPNMGPMGGMGMNPMAGGM
FT                   NPMMGGIGGNMGMQGGFQGPNQGFNTGFFPQNQGVGDGSWNPHGTKRSRQE"
FT   gene            953252..954217
FT                   /locus_tag="ANIA_10594"
FT                   /old_locus_tag="AN10594.4"
FT                   /product="sorting nexin Snx3, putative (AFU_orthologue;
FT                   AFUA_3G06880)"
FT   mRNA            join(953252..953329,953478..953799,953867..954217)
FT                   /locus_tag="ANIA_10594"
FT                   /old_locus_tag="AN10594.4"
FT                   /note="transcript_id=CADANIAT00005623"
FT   CDS_pept        join(953252..953329,953478..953799,953867..953895)
FT                   /locus_tag="ANIA_10594"
FT                   /old_locus_tag="AN10594.4"
FT                   /product="sorting nexin Snx3, putative (AFU_orthologue;
FT                   AFUA_3G06880)"
FT                   /note="transcript_id=CADANIAT00005623"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005623"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005623"
FT                   /db_xref="GOA:C8VAL9"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="InterPro:IPR042138"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAL9"
FT                   /protein_id="CBF76759.1"
FT                   /translation="MQAVPESRQQTFEEIYGPPENFLEIEVRNPQTHGTSRNMYTSYEI
FT                   VCRTNIPAFKLKHSVVRRRYSDFEYFRDILERESTRVTIPPLPGKVFTNRFSDDVIEHR
FT                   REGLQRFLQIVAGHPLLQTGSKVLASFIQDPNWDRNAW"
FT   gene            954902..957084
FT                   /locus_tag="ANIA_10596"
FT                   /old_locus_tag="AN10596.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(954902..955012,955231..955923,955980..956120,
FT                   956200..957084)
FT                   /locus_tag="ANIA_10596"
FT                   /old_locus_tag="AN10596.4"
FT                   /note="transcript_id=CADANIAT00005624"
FT   CDS_pept        join(954902..955012,955231..955923,955980..956120,
FT                   956200..957084)
FT                   /locus_tag="ANIA_10596"
FT                   /old_locus_tag="AN10596.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005624"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005624"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005624"
FT                   /db_xref="GOA:C8VAM0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAM0"
FT                   /protein_id="CBF76761.1"
FT                   /translation="MIIDRCWSCFSVTRIRPAVRCTDSLTVSGTGFLTQRGKSIPLKLE
FT                   FESCEVRFEGWFTQVDQAKAATHAVHAKSRFGFLLMSGGMTDWQEQCDEARPICKRCIK
FT                   GNRVCGGYRNLNDRKKTSKRSGQIQETSRDFSMTKLLADSLAPPARISGHTLIQERDKL
FT                   CALIEQVARLPQGQGLHGGLLTAIPPILASLGQPIIASSPLPSALSALFLTLVSDKHNE
FT                   KDRGAITEAMASYGRALQLTRRLMEHLNEERRRELIMTIFVLGMYEDMNSEDHIRLTSN
FT                   SHLEGAMAFVRSQKCRSFGEDTTRKIYSALLTRALFACFDDIKSDAPFIFTFNDLQLLH
FT                   AGLLAEKKTDFLNLYNSTLLIIHLQLRHLERDARLTFPANCAVAIAAATKAQDLLEAII
FT                   SLDYQMAEWPSTLLSESRYITVQLSPDDSIDLWSRTAYIYPTLSAGDDWSQYRMLRILA
FT                   HSLRLRAYGLLANPLYAHGLGLEDTQLTKIARGVATARSGIRALANDICASLPYHLGYK
FT                   TGPGSGRRYPNDSFPDEKYARRLSALQISWALYVAGIGEGVDAAQRLWISRQLDIINRE
FT                   MEIGKAAVLAELVRKVAVLEAQNTNPVYLTSSY"
FT   gene            complement(957191..959282)
FT                   /locus_tag="ANIA_04797"
FT                   /old_locus_tag="AN4797.4"
FT                   /product="putative Myb-like transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(957191..957965,958018..958047,
FT                   958099..959282))
FT                   /locus_tag="ANIA_04797"
FT                   /old_locus_tag="AN4797.4"
FT                   /note="transcript_id=CADANIAT00005625"
FT   CDS_pept        complement(join(957191..957965,958018..958047,
FT                   958099..959141))
FT                   /locus_tag="ANIA_04797"
FT                   /old_locus_tag="AN4797.4"
FT                   /product="putative Myb-like transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005625"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005625"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005625"
FT                   /db_xref="GOA:Q5B3T3"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3T3"
FT                   /protein_id="CBF76763.1"
FT                   /translation="MDPNGIFARNYDESLIRELPHLRIAPLREPVSSRNLRIPLTLEPS
FT                   ASGSRDSSTISKAGGSAAGILSPRNNEPNGIAIEASIANTARLLAKNELSTSELLVEPQ
FT                   PPPRPILPAFVNLRALERFPYSSFDDDNHQTRKRRRLGAGTEIDVQPDSFGELLQLPMP
FT                   QAQKEQRPPPFGPFAILNGLNEPPPNAALLPPIEAGSITQLLTKPSRDHIDVEPEPDQV
FT                   VTAASLTPDVQNGERIEGRIADILDSPIAEKPDLRDAVVNNDEVDKTQPEKEPSHAKES
FT                   QPTQETDLPPSPKTRGRSRKNLRKWTDEETVALLRGVMKCGIGNWKEVLAQDESSFNRR
FT                   TASNLKDRFRVCCPSAYRASDPNEAIQHLREALAKTLARIEGDASATPSLTHSGSSSSF
FT                   SSLDTSQNTPEHHSQSDSMPETNQTLPNKFEPATGSLSVISEPYTPAKARRRSRRPFTA
FT                   AEDEALLKGYAVHGFQWTLIQQDKKLNLGHRRATDLRDRFRTKFPHAYREGGAIRDSTL
FT                   QAQMAKDTIVKDGTIPAVRNRQGPQDSKPASTSDRSGKPISLNGVGTVDPVLPSLALPP
FT                   VTREISTGVPLSGLSFLLEEGSTNEDSVDLPPLIWDDLP"
FT   gene            959452..960135
FT                   /locus_tag="ANIA_04796"
FT                   /old_locus_tag="AN4796.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(959452..959610,959715..960135)
FT                   /locus_tag="ANIA_04796"
FT                   /old_locus_tag="AN4796.4"
FT                   /note="transcript_id=CADANIAT00005626"
FT   CDS_pept        join(959546..959610,959715..960135)
FT                   /locus_tag="ANIA_04796"
FT                   /old_locus_tag="AN4796.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005626"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005626"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005626"
FT                   /db_xref="GOA:Q5B3T4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3T4"
FT                   /protein_id="CBF76765.1"
FT                   /translation="MPATILPTWPHIVFAIFEPITLIGGWLAPIFDLQGFIVGQIPLSP
FT                   APEELEVQATSFALAYQLANVYGLMALLGAGVLYATSEPKVLRNYLVALAIGDVGHIYV
FT                   TYLAMGPALFFDVGGWNALTWGNVGVTAFLFVNRLLYCLGVFGYAEGGSVKEPKKRV"
FT   gene            complement(960486..962033)
FT                   /locus_tag="ANIA_04795"
FT                   /old_locus_tag="AN4795.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(960486..960797,960848..961321,
FT                   961383..962033))
FT                   /locus_tag="ANIA_04795"
FT                   /old_locus_tag="AN4795.4"
FT                   /note="transcript_id=CADANIAT00005627"
FT   CDS_pept        complement(join(960486..960797,960848..961321,
FT                   961383..962033))
FT                   /locus_tag="ANIA_04795"
FT                   /old_locus_tag="AN4795.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005627"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005627"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005627"
FT                   /db_xref="GOA:Q5B3T5"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR023578"
FT                   /db_xref="InterPro:IPR036964"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3T5"
FT                   /protein_id="CBF76767.1"
FT                   /translation="MTQYLAYQFAGDSPSAASYMFGQLSYRSVFRPGEERPQFNIAYRW
FT                   WEDEATTILWTFDVEVIKRVIRFKLFSDEQFPRMALHRRPTSTVDDLLKGLFDSQERVF
FT                   YANLPHAQKVDAILQRCKPTAPPMISWGWLPARMEIGRTGDNLESLAVAKAIDAESHLH
FT                   FTRITFEELVRYSLGYPSGQVEWFLRQHTCFYAHLLDHLHAFPEQVERYAEVEKHLQTR
FT                   SPFAHRAVISALQDAGYALELPCMTPGFGFFAGAIQRLFNELLNLKLILKVLNVLGVRF
FT                   ARWYLHAQEMDWSRPFSIVFSFLEDMDSSDSPVSFARNLTRSVERDFALLIEGGTLDKS
FT                   VANRLSERWQLLSVEVWECCKALPETIRFIQECLEPLLTLRNYHSLTAILSGLHKYRVS
FT                   ESSLVRLENGTTALNLNQLLPSEMLYLLNPSQNYALYRQQYQQAPGIPFLIPHLYEYHQ
FT                   LGEPILQNLYEQMSAVIPQL"
FT   gene            complement(967379..968822)
FT                   /locus_tag="ANIA_04794"
FT                   /old_locus_tag="AN4794.4"
FT                   /product="40S ribosomal protein S4, putative
FT                   (AFU_orthologue; AFUA_3G06840)"
FT   mRNA            complement(join(967379..967580,967643..967937,
FT                   968106..968390,968465..968602,968733..968822))
FT                   /locus_tag="ANIA_04794"
FT                   /old_locus_tag="AN4794.4"
FT                   /note="transcript_id=CADANIAT00005628"
FT   CDS_pept        complement(join(967527..967580,967643..967937,
FT                   968106..968390,968465..968602,968733..968746))
FT                   /locus_tag="ANIA_04794"
FT                   /old_locus_tag="AN4794.4"
FT                   /product="40S ribosomal protein S4, putative
FT                   (AFU_orthologue; AFUA_3G06840)"
FT                   /note="transcript_id=CADANIAT00005628"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005628"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005628"
FT                   /db_xref="GOA:C8VAM4"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="InterPro:IPR032277"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAM4"
FT                   /protein_id="CBF76769.1"
FT                   /translation="MPRGPKKHQKRLSAPSHWLLDKMSGTYAPKASPGPHKLRDCLPLI
FT                   VFIRNRLKYALNGRETKAIMMQRLIQVDGKVRTDPTYPAGFMDVITIEKTGENFRLIYD
FT                   TKGRFTVHRIQAEEAEYKLCKVKKVQLGKGGIPFLVTHDARTIRYPDPAIKVNDTVKVD
FT                   IATGKITDFCRFDTGVVCMVTGGRNMGRVGVVTHRERHDGGFNIVHVKDAIDNTFATRE
FT                   SNVFVIGQDKPWISLPKGKGVKLSIAEERDRRRAYALAQ"
FT   gene            complement(970865..972395)
FT                   /locus_tag="ANIA_04793"
FT                   /old_locus_tag="AN4793.4"
FT                   /product="aspartate-semialdehyde dehydrogenase (Eurofung)"
FT   mRNA            complement(join(970865..971728,971791..972048,
FT                   972102..972165,972351..972395))
FT                   /locus_tag="ANIA_04793"
FT                   /old_locus_tag="AN4793.4"
FT                   /note="transcript_id=CADANIAT00005629"
FT   CDS_pept        complement(join(970923..971728,971791..972048,
FT                   972102..972129))
FT                   /locus_tag="ANIA_04793"
FT                   /old_locus_tag="AN4793.4"
FT                   /product="aspartate-semialdehyde dehydrogenase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005629"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005629"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005629"
FT                   /db_xref="GOA:Q5B3T7"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3T7"
FT                   /protein_id="CBF76771.1"
FT                   /translation="MASFPKKKCGVLGATGSVGQRFILLLAEHPFLELHAIGASERSAG
FT                   KKYKDAVRWKQSTPMSEKLSDLVLRNCKAENFTDCDLVFSGLNSDVAGDLEMEFIKADI
FT                   PVFSNAKNYRKHPVVPLVVPTVNPNHLDLIPHQRKHFGLKKGFLVCNSNCAVIGIVIPF
FT                   AALQAKFGPVEEVEVFTEQAVSGAGYPGVPSMDIMDNVIPFISGEEDKLENEAQKILGS
FT                   LTADATAFDEQQGLRIGATCTRVGVTDGHMAFVSLRFKNRPAPSAEQVVQAMREYQSEA
FT                   QKLGCPSAPAEAIKVFDEPDRPQPRLDRDINRGYTVSVGRVREGNQGGYFDIRFAALSH
FT                   NTVIGAAGSSILNAEVAVIKGYI"
FT   gene            complement(972643..974512)
FT                   /locus_tag="ANIA_04792"
FT                   /old_locus_tag="AN4792.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(972643..973031,973069..973545,
FT                   973711..974122,974186..974512))
FT                   /locus_tag="ANIA_04792"
FT                   /old_locus_tag="AN4792.4"
FT                   /note="transcript_id=CADANIAT00005630"
FT   CDS_pept        complement(join(972643..973031,973069..973545,
FT                   973711..974122,974186..974512))
FT                   /locus_tag="ANIA_04792"
FT                   /old_locus_tag="AN4792.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005630"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005630"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005630"
FT                   /db_xref="GOA:Q5B3T8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3T8"
FT                   /protein_id="CBF76772.1"
FT                   /translation="MRPSSLISRGFPANPRMLCRAGSRPIPFASAVRLTSSTSRRGEND
FT                   QKSSHNSSSSSSAGNSANSWSLGRMAVVASLAAGIGYGIGNSDQLLEPKDAGTPRYGTA
FT                   KDFEKAIAELQVKLGEDAISTDEDDLQRHGFSEWSSVNAQRLPVAIAYPSSTEDVSEIA
FT                   KICNKYKMPMVPYSGGSSLEANFSAAYGGLTIDFAYMNKILDLHEADMDVVVQPSIQWM
FT                   DLNEKIKDTGLFFPVDPGPSAMIGGSEGTLGIVTEATLKLAPIPEETRVGVVSFPTIRD
FT                   AASTAMQLVRKGVPVQCMEILDDVQMDVINKAGGTGRTWKTLPTLFFKFSGTKAGVADS
FT                   INLTRNLAKANKAEAFEFAKNDAEAHDLWSARKQSLWSMMALRPEGSEVWSTDVAVPIS
FT                   RLPDIIELEISKKELDDLGIFASILGHIGDGNFHSSIMYDPKNADERQRVEKVVHDMVD
FT                   RALEMEGSCTVTICVFPTLGHERLTPLQGEHGVGLGKKSSLKKELGPNTIGAMRNIKKA
FT                   FDPHWLLNPGKIFDPQG"
FT   gene            975460..979037
FT                   /locus_tag="ANIA_04791"
FT                   /old_locus_tag="AN4791.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(975460..975534,975599..975743,975805..975899,
FT                   975966..976580,976735..976779,976830..978029,
FT                   978078..978206,978253..978369,978417..979037)
FT                   /locus_tag="ANIA_04791"
FT                   /old_locus_tag="AN4791.4"
FT                   /note="transcript_id=CADANIAT00005631"
FT   CDS_pept        join(975460..975534,975599..975743,975805..975899,
FT                   975966..976580,976735..976779,976830..978029,
FT                   978078..978206,978253..978369,978417..979037)
FT                   /locus_tag="ANIA_04791"
FT                   /old_locus_tag="AN4791.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005631"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005631"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005631"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3T9"
FT                   /protein_id="CBF76774.1"
FT                   /translation="MPDTLFLLGREVERLVNAPYAPSLQDLYSLVQQAPLAVVTWAAQK
FT                   PCQVAALVDVLVDGLSRSRSALPLITSFARAQEFRDNLLQRYPYLLDQFLHQTIEGSEP
FT                   GYLPLCIRLLSSPLPCDIIPPANLAVFVMQLIERMRANPCMDTVRPLFSISSCLQATGI
FT                   LSELPLEVMSCFQAELTNTLRNLEDHMGNLLCLATFARLVSSQNSSVDAEDGTNMPTWL
FT                   QTIRHFFGPKRGLKTLDLVVLRVILACSSSYGNLTVEESAESVRLAISICDSVDGEQRT
FT                   RWIEGNSIKLAKLLEKITRDGIDQGVQMLVLPTQIIPRLVKAHAACSGQAAIDNALEYV
FT                   ITSLSTSTTDKASFAKLQISRLVLQGLRFPNLQPAGIVSEQHCNAINNLTKSFPRQQPF
FT                   ASKCDGAVICYSSALRLENDLLCDLLAFWAEATLPRNTKEPSFSSGTAMLIDFLSRSKL
FT                   LLPDSKCATSQIKPLETRSANPTLKIRETVDIPRNNWRNDMRDVMMANSKMLNDSIMQK
FT                   VEDICYDLEQRCGNIEAPLKVAEEERTKYYLETEQLKEQNRGLETQLQQATSTNAELRE
FT                   EMSRLAGHAGSATDRVNELSTSLAQARHELEELQRTSQDALSIQRESFKTRELDLVASL
FT                   TEREERLDELQEEIKCQTVANGELRVNLADTSKVRESLIGEIAAFKAEVSSLQTKLEEN
FT                   KASLTQKDESIKQLVVEKGRADELAKDLQHKLHEETSKAEILGAALQETTERFKSELEE
FT                   LQRQSEAQSLRIAEEAAERKSEVMSLQRIIHETKSDAAKELQTKEKRVQHLERKVQLLR
FT                   EERAAKAREFSEAQQHISRLMGVMGFKPLGPLDNRVSSRQRSRPSSEQPSPNTMQTQTD
FT                   SGAVTFENRQDDPLGTSIEYATPRPNSCSPKRSRNHAFPSVLSSPSQSQESSEKQRKSL
FT                   SQSTRKRLQERKPLGEVDHNSQHQHSTEITTCSRRESFNDSQFSCPPDQNHLGDIDLDL
FT                   DMEFSRDFVFTSTSTSELDGFART"
FT   gene            979702..983885
FT                   /locus_tag="ANIA_04790"
FT                   /old_locus_tag="AN4790.4"
FT                   /product="RNA-directed RNA polymerase (Sad-1), putative
FT                   (AFU_orthologue; AFUA_3G06790)"
FT   mRNA            join(979702..979979,980012..980182,980839..981004,
FT                   981088..981211,981267..981478,981601..982098,
FT                   982349..982626,982715..982826,982939..983135,
FT                   983170..983342,983485..983885)
FT                   /locus_tag="ANIA_04790"
FT                   /old_locus_tag="AN4790.4"
FT                   /note="transcript_id=CADANIAT00005632"
FT   CDS_pept        join(979702..979979,980012..980182,980839..981004,
FT                   981088..981211,981267..981478,981601..982098,
FT                   982349..982626,982715..982826,982939..983135,
FT                   983170..983342,983485..983885)
FT                   /locus_tag="ANIA_04790"
FT                   /old_locus_tag="AN4790.4"
FT                   /product="RNA-directed RNA polymerase (Sad-1), putative
FT                   (AFU_orthologue; AFUA_3G06790)"
FT                   /note="transcript_id=CADANIAT00005632"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005632"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005632"
FT                   /db_xref="GOA:C8VAM8"
FT                   /db_xref="InterPro:IPR007855"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAM8"
FT                   /protein_id="CBF76776.1"
FT                   /translation="MSPAPRNRSKPNLPMMPPSKHRSRPVPQPADQQLILAPWRAWESI
FT                   AVHLSNVTAGVRTLDLWRAFKDEGNVRSIDIFENFQGNRTTRARIRLIPNPEQTSPGTD
FT                   FWKSAFRRITLHNGKSIYISMSLGKKPPNWEVSAQSKGGSVSRQKLRLRFRLRDTTKEW
FT                   PTPICKWIDLNPKASKTSSTAVQDPFDTSHIHLPFAVRYLLEARKLFEHVTLQKKTYYN
FT                   PDGSFRHKSCQEGKSRKNTVLLLPDISNCVIRRYANLADNFLRVRFTDAKHIGRIHATV
FT                   DNTMDEVLTRIKRALANGITIGSTRYEFLAFGNSSSCFSTTRAISGCTAHVKKIDDIEG
FT                   NGYIFSDGVGRISKFLAQIVKSELKIKTPTKEPPSAYQFRLVGCKGMLIVFPQARPQEV
FT                   HIRKSQFKFAALSQGLEIIRWSQFTVASLNRQLILVLSTLGITDKVFHLKLKTMLRNLD
FT                   EAMESDPKAAHLLRKYVDPNQVTLTIYLPKNGEKYEIIEGICILARNPSLHPGGIRVVR
FT                   AVNAPGLHHLKDIVVLPRTGDRDIASMCSGSDLDGDDFLVIWDQDLLPDDWFRSFQLRQ
FT                   LPTRISHGVITLMMVSTKQNAYGSLSYTQKPSTTTRQLYDAVGRIDFGPNIEMDFDKRI
FT                   LNCNVEVHDAIYGFARRLKDEYDIAIRRITAQHEIKTEFEVWLTYYKFHEDIGAMSLAL
FT                   RENFKKRAFEKVGGRTFDALAPLAVAMYRVTYQEMATALAKHPTTLSTDLQCNRPAQHQ
FT                   IGEAELGTCLKKCDTTKQDHQALGPPKYHPDDDPFGLGLRDDADAATIASNNLPSSDCN
FT                   VDRWKISFGFGPLNVLSAQSKLLYMPRLRLKKGLCWILTVTLPRAGGKLTLRRPRRI"
FT   gene            complement(984420..989519)
FT                   /locus_tag="ANIA_04789"
FT                   /old_locus_tag="AN4789.4"
FT                   /product="DNA polymerase (EC 2.7.7.7)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q8X142]"
FT   mRNA            complement(join(984420..989230,989285..989519))
FT                   /locus_tag="ANIA_04789"
FT                   /old_locus_tag="AN4789.4"
FT                   /note="transcript_id=CADANIAT00005633"
FT   CDS_pept        complement(join(984420..989230,989285..989519))
FT                   /locus_tag="ANIA_04789"
FT                   /old_locus_tag="AN4789.4"
FT                   /product="DNA polymerase (EC 2.7.7.7)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q8X142]"
FT                   /note="transcript_id=CADANIAT00005633"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005633"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005633"
FT                   /db_xref="GOA:G5EB69"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR025687"
FT                   /db_xref="InterPro:IPR030559"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB69"
FT                   /protein_id="CBF76778.1"
FT                   /translation="MEPFQVRLNCVDHYQANPSEFDPPLPYRDGNNEKGYMPKVPVIRI
FT                   FGTTETGQKICVHVHGAFPYLYVQYDGDLSPDSVRSAARSLHLSIDHALAVSYRRNAHD
FT                   KKTVFVAHITLVKGVPFYGYHVGYRFFFKIYLLNPIYITRLADLLLQGAVMKRPIQPYE
FT                   SHLQYVPQWMCDYNLFGCAFMKCGKAKFRSPIPEYLDLPDLSHRWHDRSIPPGWILDES
FT                   VLPKQSHCPLEADVCVQDILNRLEISERSIHHDFREFLNPLTSNEKLVPSMAGLWEDEK
FT                   RRRKKKLGLDDPDSSPFSTEDLVSFSSDPRKASQGDWIHKDELQLLVRQITAEERERDN
FT                   NRDMTLDAHLQENPYAKDVKTALQSIEDFFTDADGLTNLQLPYNSGIDYSEEQAVDYVD
FT                   EDAVRATESNSGLYSSDEDGMIDIFSDDDYDNSENEMAQVDLENDLQQDERSNAISKTH
FT                   GPRVSAPSVDGLAGNSSGLEGPRSDALEARNAISFKAPTQQNVQSGRSSVTRSKYEENL
FT                   DKSSQSQESSSLVQFWTANADSSNKKIRMPSRATEPSSSDGQSISSQKTIRLKALSQYG
FT                   TLNFPVVKDPNDPMTILRFSQEASGSKELMDVVAKEASSSGKSSSTLQPRSSDEKELSS
FT                   SSDNIATDFAGLISDAFNIPPSTRLCCFRRACPSPKEVSSTINAYGLSDIIYQNAHYSI
FT                   DADVPDRPRDYAGKEFQLGGIGIRYLPDFDPSGRLPAMLAEENIGQKEKRDWQELDHQL
FT                   RVGSTARFWEFTPVPPSRSEVITWYNGEQQKSLAATTKTEEQYEEKEYRGKVLSQIEGP
FT                   TQKNEHGFKYSQHKKSTSVEHQTQYMSTMSLEVHVNTRGVLLPNPEEDEIAAFFWCVNS
FT                   EDEPQEEDDSLSVVNMGVVFQGEEEYPESKISKALRFECEHESTELDLINRLVDIVRLH
FT                   DPDIITGYEVHNSSWGFIIERARKKYDFDLCDELSRVKSHAHGRFGKEADKWGFDHTSS
FT                   IRITGRHIINIWRAMRSEMNLLQYTMENVVFHLLHRRIPHYSFRDLTAWYQSDKPRDFM
FT                   KVINYYTSRVQMNIEILNANELIPRTSEQARLLGIDFYSVFSRGSQFKVESLMFRIAKP
FT                   ENFILVSPSRKQVGQQNALECLPLVMEPQSDFYTSPLIVLDFQSLYPSIMIAYNYCYST
FT                   FLGRVQSWRGRNKMGFLDYNRPPRLLELLKDHINIAPNGMIYARSEVRKSLLAKMLTEI
FT                   LETRVMVKTGMKVDKDDRALQRLLNNRQLALKLIANVTYGYTSASFSGRMPCSEIADSI
FT                   VQSGRETLEKAIAFIHSVERWGAEVVYGDTDSLFVYLKGRTRDQAFDIGEEIAQAVTNM
FT                   NPHPVKLKFEKVYHPCVLLAKKRYVGFKYEHRNQKEPEFDAKGIETVRRDGTPAEQKIE
FT                   EKALKLLFRTADLSQVKSYFQSQCTKIMQGRVSVQDFCFARAVKLGTYSENGTLPAGAL
FT                   ISTKKMLEDPRAEPQYGERVPYVVVTGAPGSRLIDRCVPPETLLQDAQLDLDAEYYITK
FT                   NIIPPLERIFNLVGANVRQWYDEMPKVHRIRRVEGTSSLAGGKSSIRTLESYMKASSCV
FT                   VCKAKLYDAEIPVCSDCVRQPHVSLLELVSRQRHAEQRVATLERICRSCMDVPFGDEVK
FT                   CDSLDCPVFYARTRGLAHWRHTNSVLGPVIKLLQDNCSDSLEW"
FT   gene            989885..991285
FT                   /locus_tag="ANIA_04788"
FT                   /old_locus_tag="AN4788.4"
FT                   /product="Pre-mRNA-splicing factor slu7 (Splicing factor
FT                   sluA) [Source:UniProtKB/Swiss-Prot;Acc:Q5B3U2]"
FT   mRNA            989885..991285
FT                   /locus_tag="ANIA_04788"
FT                   /old_locus_tag="AN4788.4"
FT                   /note="transcript_id=CADANIAT00005634"
FT   CDS_pept        989885..991285
FT                   /locus_tag="ANIA_04788"
FT                   /old_locus_tag="AN4788.4"
FT                   /product="Pre-mRNA-splicing factor slu7 (Splicing factor
FT                   sluA) [Source:UniProtKB/Swiss-Prot;Acc:Q5B3U2]"
FT                   /note="transcript_id=CADANIAT00005634"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005634"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005634"
FT                   /db_xref="GOA:Q5B3U2"
FT                   /db_xref="InterPro:IPR021715"
FT                   /db_xref="InterPro:IPR039974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3U2"
FT                   /protein_id="CBF76780.1"
FT                   /translation="MSRKPADVASKERNEYIPAFISKKPFYIDDDDTANDYLEHQRLHK
FT                   QTTDQSKWYERGKRAGPAATKYRKGACENCGAMTHKAKECLSRPRKHGAKWTGKDIQAD
FT                   EVIQNVDLGWDAKRDRWNGYDAAEYRQVVEEYEELERLKRQAKLTKGETQTTNDGLDDE
FT                   APEQEARYAEESDMGRQQSTATRNLRIREDTAKYLLNLDLDSAKYDPKTRRMVDMGAAE
FT                   DQAAALVAEENFVRSSGDAAEFERAQRYAWEAQERGTQKIHLQANPTSGEITRKKELAE
FT                   SEAKRDAHRKALLEKYGGEQHLKHTPLLETMVVENERFVEYDETGAIKGAPKKATKSKY
FT                   PEDILTNNHKSVWGSWWHNFQWGYACCFSTVKNSYCTGEEGKRAFEEARNMLLLPGDET
FT                   EQPSLAVESASRQEEPSAESHNQQRDSKKRTLMEVQSGITEEELESYKRSRLAADDPMA
FT                   AFIEKDDS"
FT   gene            991586..992486
FT                   /locus_tag="ANIA_04787"
FT                   /old_locus_tag="AN4787.4"
FT                   /product="60S ribosomal protein L37 (Eurofung)"
FT   mRNA            join(991586..991690,991907..991969,992101..992172,
FT                   992274..992486)
FT                   /locus_tag="ANIA_04787"
FT                   /old_locus_tag="AN4787.4"
FT                   /note="transcript_id=CADANIAT00005635"
FT   CDS_pept        join(991586..991690,991907..991969,992101..992172,
FT                   992274..992486)
FT                   /locus_tag="ANIA_04787"
FT                   /old_locus_tag="AN4787.4"
FT                   /product="60S ribosomal protein L37 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005635"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005635"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005635"
FT                   /db_xref="GOA:Q9C0T1"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C0T1"
FT                   /protein_id="CBF76782.1"
FT                   /translation="MSCDHCHSRLTRACALSWHTRLARHPDPAQLSIRLRRVPPASESA
FT                   TTKLTLCAGVVAAGPTTSRSRPAQTAVTPLLRLASTTGARRPSDARPPVPAVPLTCGTS
FT                   TAASRTASRLALPRAPVVLRTTKSIPMLRFRSPGLERAGMAKEPRI"
FT   gene            complement(992865..994157)
FT                   /locus_tag="ANIA_04786"
FT                   /old_locus_tag="AN4786.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(992865..993188,993273..993743,
FT                   993800..994157))
FT                   /locus_tag="ANIA_04786"
FT                   /old_locus_tag="AN4786.4"
FT                   /note="transcript_id=CADANIAT00005636"
FT   CDS_pept        complement(join(992865..993188,993273..993743,
FT                   993800..994048))
FT                   /locus_tag="ANIA_04786"
FT                   /old_locus_tag="AN4786.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005636"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005636"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005636"
FT                   /db_xref="GOA:C8VAN2"
FT                   /db_xref="InterPro:IPR018627"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAN2"
FT                   /protein_id="CBF76784.1"
FT                   /translation="MPSQPPLPHLLTPYVSSPPRSSLTTVSSVLGATGNWLILRFLGAA
FT                   LADAGSGFRGLEEDRKRKVVLVSFLRGWEFWRSEAKRLGVDLARLTEKRQFAFVDGLSE
FT                   LFSAPTASASSAQSQPFGAGATPRTTLPVRPHPGQASLRQPPPQAVGFNGPPQIAKETG
FT                   PVKRLHFSGNGIAALDALEKDVTTVIDQLRAPRPGEDGDESEVLLVVDQPDLLLAATGP
FT                   NKGIGATEMAEWIMGLQQVATATIVTISVDSPLIHNASAFAHQAATPLETEHAAFAVGL
FT                   AHRSEMVMQLRNLETGAARDVSGVLRVSKGGAWGQRENAGEESWEEREVLYFVQRDGGV
FT                   SVFGRGE"
FT   gene            997022..999789
FT                   /locus_tag="ANIA_04785"
FT                   /old_locus_tag="AN4785.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(997022..997133,997378..997478,997531..997560,
FT                   997615..997709,997781..998100,998155..999325,
FT                   999399..999789)
FT                   /locus_tag="ANIA_04785"
FT                   /old_locus_tag="AN4785.4"
FT                   /note="transcript_id=CADANIAT00005637"
FT   CDS_pept        join(997422..997478,997531..997560,997615..997709,
FT                   997781..998100,998155..999325,999399..999789)
FT                   /locus_tag="ANIA_04785"
FT                   /old_locus_tag="AN4785.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005637"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005637"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005637"
FT                   /db_xref="GOA:C8VAN3"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR005600"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAN3"
FT                   /protein_id="CBF76786.1"
FT                   /translation="MMSKNKITMGSTRDSHSYACDECRLRKSRCSKEKPTCAQCKQLDK
FT                   ECKYSPKITRSPLTRQHLTYVEDRLQAFESALGRLFPGGDLDATVRSLLQDQDPLSKER
FT                   SSSKSSSRHSTPAKTEADRHESAPEALPQQADGFDWAENRITLGDLTDGMAALSIKPEG
FT                   AGYFGASSSVVPLRALLKHGFDLNIPSGSSKRVDNSDRVPLKSQLLNIAPSGVIEQAFM
FT                   DAFFNNYHMSYPFVHEATFRAQFHEQLPRPHGPAWQILLNTILALGAWCIGDDNSDLDI
FT                   TFYQEARSRLQQMSVFEAGNLTLVQALLFLSNYAQKRNKPNTGWNFLGLAVRMSMSLGL
FT                   HKEFHGWKISLLQREVRRRLWWGVYIFDSGAAKTFGRPILLPEDSVMDVKHVLNIHDEA
FT                   LTSTTTVVPPEVNEPTLYTGMLAQAKFHILTNSVYQRLISGPNPTPEETLSLQKPMEEW
FT                   YNSLPDYIKNPAPGSMSDNFALVRSRLLWRDWNLRILIYRPILLRWASKRWTPNTPTEP
FT                   EDPYEAECRMLCFRNAKLTISSITDFVNNYPCTRVGAWYMLYFLFQAGLIPIILLMTDP
FT                   TSAEAPSWIQEIEATKALLMYPSLSNNNLAGRCLDVIYRLCAPVYPSNATSSASAPSQQ
FT                   PQPIYMPFADQLYNDPTFGSLFPDVNQDLNVSAGMDFSEWVNFAPTPHNDFT"
FT   gene            complement(1000337..1002943)
FT                   /locus_tag="ANIA_04784"
FT                   /old_locus_tag="AN4784.4"
FT                   /product="ubiquitin thiolesterase (OtuB1), putative
FT                   (AFU_orthologue; AFUA_3G06710)"
FT   mRNA            complement(join(1000337..1000855,1000902..1001423,
FT                   1001482..1001759,1001875..1002140,1002188..1002251,
FT                   1002309..1002371,1002438..1002885,1002920..1002943))
FT                   /locus_tag="ANIA_04784"
FT                   /old_locus_tag="AN4784.4"
FT                   /note="transcript_id=CADANIAT00005638"
FT   CDS_pept        complement(join(1000777..1000855,1000902..1001423,
FT                   1001482..1001759,1001875..1002140,1002188..1002251,
FT                   1002309..1002371,1002438..1002695))
FT                   /locus_tag="ANIA_04784"
FT                   /old_locus_tag="AN4784.4"
FT                   /product="ubiquitin thiolesterase (OtuB1), putative
FT                   (AFU_orthologue; AFUA_3G06710)"
FT                   /note="transcript_id=CADANIAT00005638"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005638"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005638"
FT                   /db_xref="GOA:C8VAN4"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR019400"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR042467"
FT                   /db_xref="InterPro:IPR042468"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAN4"
FT                   /protein_id="CBF76788.1"
FT                   /translation="MSLSDLPRSHFDPLNHYPLREEQYPGYFPPSDAPAAFLTHEITQL
FT                   SNALYGHRPAFFNMNPLSPEEMERFQELSNKYEPELPVSNPSTNAIAMDYANADPTFAT
FT                   KTSALAVTHPQSRIMKGDGNCGWRAVAFGYFENLFSLRDPVQLQRERARFKSLNTLLDQ
FT                   VGLDEITYGMFADATDEVFDSILNAIERGERDDSFLVALFNDEYNSNTILCHFRFLTSA
FT                   WIKLNAHRYSAFLPMDMPIDRYCSTQIDPVKTEIDGIGLQALVDGVIEGSGLVVEILYL
FT                   DRSEGDAVTPHVLTQTRPGVGAIRLLYRPGHYDLLYRAEPIVNMQPVVNLQYAISSNYG
FT                   PWDTSDLSFDVNSSLMAIPNLMMDTSFPLAPSMSQPPADPFRVSPPQPPPDHYRVPPPQ
FT                   PQPPSDSYRVSPPQEVYHAPVHTPPPPPPIASPQPQIQLSGPPPPMMSSLPRRTDDGPQ
FT                   IRLSSLAMRSNLNHSLPLPVTAPFKNSPFNHAHYQNPDFEPMHWAPNESRK"
FT   gene            complement(1006820..1008502)
FT                   /locus_tag="ANIA_04783"
FT                   /old_locus_tag="AN4783.4"
FT                   /product="COP9 signalosome complex subunit 2 (Signalosome
FT                   subunit 2) [Source:UniProtKB/Swiss-Prot;Acc:Q5B3U7]"
FT   mRNA            complement(join(1006820..1008076,1008126..1008186,
FT                   1008239..1008397,1008459..1008502))
FT                   /locus_tag="ANIA_04783"
FT                   /old_locus_tag="AN4783.4"
FT                   /note="transcript_id=CADANIAT00005639"
FT   CDS_pept        complement(join(1006820..1008076,1008126..1008186,
FT                   1008239..1008397,1008459..1008502))
FT                   /locus_tag="ANIA_04783"
FT                   /old_locus_tag="AN4783.4"
FT                   /product="COP9 signalosome complex subunit 2 (Signalosome
FT                   subunit 2) [Source:UniProtKB/Swiss-Prot;Acc:Q5B3U7]"
FT                   /note="transcript_id=CADANIAT00005639"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005639"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005639"
FT                   /db_xref="GOA:Q5B3U7"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3U7"
FT                   /protein_id="CBF76790.1"
FT                   /translation="MSDDDDFMHDSADEEYDFEYEDADDDETGDIGIENKYYNAKQIKV
FT                   DNPEEAIDEFLGVPALEQDKGDWGFKGLKQAIKLEFKLGRYSDAVEHYRELLTYVKSAV
FT                   TRNYSEKSINNMLDYIEKGSDDEKAYQCMEEFYSLTLNSFQNTNNERLWLKTNIKLARL
FT                   WLERREYGQLSKKVRELHRACQREDGSDDPSKGTYLLELYALEIQMYAETKNNKRLKAL
FT                   YQRALRVRSAVPHPKIMGIIRECGGKMHMSEENWEEAQSDFFESFRNYDEAGSMQRIQV
FT                   LKYLVLTTMLMKSDINPFHSQETKPYKTDPRISAMTDLVDAFQRDDIHAYEEVLSKNPD
FT                   VLADPFIAENIDEVSRNMRTKAILKLIAPYTRFTLSFISKHIKISVTEAQDILSFLILD
FT                   KKLNAKIDQESGTVVVESASDVERLRSVEEWNESLRTLWQVTLKDGDGFKNDDVSQPTG
FT                   IGMRGPLLYQSGLDDDTAGLLRSSGHRFRRGGKGSKAGGGLGMKTGLF"
FT   gene            1009392..1010500
FT                   /locus_tag="ANIA_04782"
FT                   /old_locus_tag="AN4782.4"
FT                   /product="hypothetical protein similar to Rho GTPases
FT                   (Eurofung)"
FT   mRNA            join(1009392..1009584,1009638..1009688,1009745..1009833,
FT                   1009886..1009900,1009950..1010071,1010122..1010323,
FT                   1010382..1010500)
FT                   /locus_tag="ANIA_04782"
FT                   /old_locus_tag="AN4782.4"
FT                   /note="transcript_id=CADANIAT00005640"
FT   CDS_pept        join(1009806..1009833,1009886..1009900,1009950..1010071,
FT                   1010122..1010323,1010382..1010500)
FT                   /locus_tag="ANIA_04782"
FT                   /old_locus_tag="AN4782.4"
FT                   /product="hypothetical protein similar to Rho GTPases
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005640"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005640"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005640"
FT                   /db_xref="GOA:C8VAN6"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAN6"
FT                   /protein_id="CBF76792.1"
FT                   /translation="MRHSEPTVFENYVHDIFVDNVHMELSLWDTAGQEEFDRLRALSYE
FT                   DTHVIMLCFSVDSPDSFENVASKWIEEISENVPGVKLVLTALKCDLRKDEYMNDNPNVI
FT                   TYEQGLAKAKEIGAVKYLECSAVQNRGIREAFYEAAKVALEVKAQNTGSSQSRCVIQ"
FT   gene            complement(1011010..1011931)
FT                   /locus_tag="ANIA_04781"
FT                   /old_locus_tag="AN4781.4"
FT                   /product="Lipoyltransferase, putative (AFU_orthologue;
FT                   AFUA_3G06680)"
FT   mRNA            complement(join(1011010..1011018,1011071..1011931))
FT                   /locus_tag="ANIA_04781"
FT                   /old_locus_tag="AN4781.4"
FT                   /note="transcript_id=CADANIAT00005641"
FT   CDS_pept        complement(join(1011010..1011018,1011071..1011931))
FT                   /locus_tag="ANIA_04781"
FT                   /old_locus_tag="AN4781.4"
FT                   /product="Lipoyltransferase, putative (AFU_orthologue;
FT                   AFUA_3G06680)"
FT                   /note="transcript_id=CADANIAT00005641"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005641"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005641"
FT                   /db_xref="GOA:Q5B3U9"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3U9"
FT                   /protein_id="CBF76794.1"
FT                   /translation="MRLAHLHFPDITSFTRVAALQQTLTTRLLAHKKLVADAATTTPPP
FT                   PDPTIITFTPNPVYTTGRRDLPPSNTSPSSSKTLSLPPALEPIRSLLTPPESGSKLHNK
FT                   NGPIAEYHPTLRGGQTTYHGPGQMVAYTILDLRRMGLSPRCHIRLLENSVVDVLRSYGL
FT                   DGLITEDPGVWVPRPSSTGSNGDELPRKITAVGVHLRRNISSYGIGFNVTEEPMWFFRQ
FT                   IVACGLEGREATSLEGQGIKGVSTDEVAGRFVDAFVRRVNNDYARGQIALGEKIEEVYK
FT                   VSEQDIIC"
FT   gene            complement(1012354..1013286)
FT                   /locus_tag="ANIA_04780"
FT                   /old_locus_tag="AN4780.4"
FT                   /product="pyridoxamine phosphate oxidase, putative
FT                   (AFU_orthologue; AFUA_3G06670)"
FT   mRNA            complement(join(1012354..1013050,1013113..1013286))
FT                   /locus_tag="ANIA_04780"
FT                   /old_locus_tag="AN4780.4"
FT                   /note="transcript_id=CADANIAT00005642"
FT   CDS_pept        complement(join(1012442..1013050,1013113..1013280))
FT                   /locus_tag="ANIA_04780"
FT                   /old_locus_tag="AN4780.4"
FT                   /product="pyridoxamine phosphate oxidase, putative
FT                   (AFU_orthologue; AFUA_3G06670)"
FT                   /note="transcript_id=CADANIAT00005642"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005642"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005642"
FT                   /db_xref="GOA:C8VAN8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAN8"
FT                   /protein_id="CBF76796.1"
FT                   /translation="MPFVHLPPSRNNARPETMSDSLNPPLSYEASATTTHRHVATTLPP
FT                   EVSSCLKNSRFLHLATCDGLTPHISLMSYTYLPSTPFDPYPTIIMTTNSSSRKTTHLQT
FT                   NPRVSLLVHDWVSHRPPTRASNPGNTRDGSPPPAATRSSLASLLLNLNTSALSSISTTI
FT                   TGEARFLQPNSEEETWCKERHLENNTFEEEMSTFGQAQQPGQRRPSLSIDDDVRVITIR
FT                   VREGRLADWKGGVRDWLVVQEGEEGPDETTPNGVVL"
FT   gene            1014440..1015677
FT                   /locus_tag="ANIA_04779"
FT                   /old_locus_tag="AN4779.4"
FT                   /product="NIPSNAP family protein (AFU_orthologue;
FT                   AFUA_3G06660)"
FT   mRNA            join(1014440..1015121,1015193..1015677)
FT                   /locus_tag="ANIA_04779"
FT                   /old_locus_tag="AN4779.4"
FT                   /note="transcript_id=CADANIAT00005643"
FT   CDS_pept        join(1014440..1015121,1015193..1015677)
FT                   /locus_tag="ANIA_04779"
FT                   /old_locus_tag="AN4779.4"
FT                   /product="NIPSNAP family protein (AFU_orthologue;
FT                   AFUA_3G06660)"
FT                   /note="transcript_id=CADANIAT00005643"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005643"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005643"
FT                   /db_xref="GOA:C8VAN9"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAN9"
FT                   /protein_id="CBF76798.1"
FT                   /translation="MLAPRAFRPASLLARPFHTSAPVFRAPSIRDITPDSAEEFNARQK
FT                   EFRENLEVARKKREQQESQSVGASASTSASAPAPVTRDRLREYTDAPAASSKSNASDEK
FT                   SPIFDAADVLDNQALGSLSTHRSLGDEHLLEVNRSPKRGPLSSLIYGTKEGQQLDRDIE
FT                   RSFSQVLARGKYVHSIVFHDVKPDRVDEYVDLVGEWYPRMAAAEENRVNLVGSWRTQVG
FT                   DNDTFVHIWEYQRYEGYHASLHNISRHPGFPAFDKKLKSLIKSKKTSLMQEFSFWPTTP
FT                   PRRLGGLFELRSYTLHPGNLLEWETHWRRGLKARREVMEGVGAWFVQIGDLNTVHHLWQ
FT                   FANLEERKIRREQSWGIEGWAETVHKTVPLIQTMQSRILIPMPWSPVG"
FT   gene            1016504..1018428
FT                   /locus_tag="ANIA_04778"
FT                   /old_locus_tag="AN4778.4"
FT                   /product="aminoalcoholphosphotransferase (AFU_orthologue;
FT                   AFUA_3G06650)"
FT   mRNA            join(1016504..1016918,1016984..1016993,1017133..1017290,
FT                   1017341..1017387,1017443..1017538,1017592..1018256,
FT                   1018306..1018428)
FT                   /locus_tag="ANIA_04778"
FT                   /old_locus_tag="AN4778.4"
FT                   /note="transcript_id=CADANIAT00005644"
FT   CDS_pept        join(1016779..1016918,1016984..1016993,1017133..1017290,
FT                   1017341..1017387,1017443..1017538,1017592..1018256,
FT                   1018306..1018428)
FT                   /locus_tag="ANIA_04778"
FT                   /old_locus_tag="AN4778.4"
FT                   /product="aminoalcoholphosphotransferase (AFU_orthologue;
FT                   AFUA_3G06650)"
FT                   /note="transcript_id=CADANIAT00005644"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005644"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005644"
FT                   /db_xref="GOA:Q5B3V2"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3V2"
FT                   /protein_id="CBF76800.1"
FT                   /translation="MVYIRQHELSNLKNYRYAGVDHSLISRYVLKPFYNNFVIKFFPMS
FT                   MAPNAITLTGLFFVLINLFTVLYYNPSLDQDCPPWVYASCAIGLFLYQTFDAVDGIQAR
FT                   RTKQSGPLGELFDHSVDACNTALGVLIFAGVMNLGQTWATVLTLFGSTMTFYVQTWDMY
FT                   YTQVLTLGIVSGPVEGVLTLCVVFGFTAYMGGGSFWHQPMFETIGVPKLEFIPKQLYDL
FT                   PFTQWYLIYGAVMLFFATGSSIAHVIQVRKERGKDSIGPLFGILPLALTWVVVPAYLYL
FT                   NPTILENYLVPFALYVGLVNAYAVGRIICAHLVHQDFPYFNILLGPLALAVVDSAGALF
FT                   GVWSSTLIGTIGQPAFVFLCLGLGLGVYGSFVHDIITTICDYIDIWCLTIKHPYVPEES
FT                   VNGNVVRAAKKNL"
FT   gene            1018830..1019693
FT                   /locus_tag="ANIA_04777"
FT                   /old_locus_tag="AN4777.4"
FT                   /product="40S ribosomal protein S27 (Broad)"
FT   mRNA            join(1018830..1018922,1019109..1019171,1019238..1019693)
FT                   /locus_tag="ANIA_04777"
FT                   /old_locus_tag="AN4777.4"
FT                   /note="transcript_id=CADANIAT00005645"
FT   CDS_pept        join(1018920..1018922,1019109..1019171,1019238..1019420)
FT                   /locus_tag="ANIA_04777"
FT                   /old_locus_tag="AN4777.4"
FT                   /product="40S ribosomal protein S27 (Broad)"
FT                   /note="transcript_id=CADANIAT00005645"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005645"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005645"
FT                   /db_xref="GOA:Q5B3V3"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3V3"
FT                   /protein_id="CBF76802.1"
FT                   /translation="MVLAVDLLNPTPQAEARKHKLKQLVPGPRSFFMDVKCPGCFNITT
FT                   VFSHAQTVVVCSGCSTVLCQPTGGKARLTEGCSFRRK"
FT   gene            1020631..1021393
FT                   /locus_tag="ANIA_04776"
FT                   /old_locus_tag="AN4776.4"
FT                   /product="dihydrofolate reductase (AFU_orthologue;
FT                   AFUA_3G06620)"
FT   mRNA            join(1020631..1021177,1021209..1021393)
FT                   /locus_tag="ANIA_04776"
FT                   /old_locus_tag="AN4776.4"
FT                   /note="transcript_id=CADANIAT00005646"
FT   CDS_pept        join(1020631..1021177,1021209..1021393)
FT                   /locus_tag="ANIA_04776"
FT                   /old_locus_tag="AN4776.4"
FT                   /product="dihydrofolate reductase (AFU_orthologue;
FT                   AFUA_3G06620)"
FT                   /note="transcript_id=CADANIAT00005646"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005646"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005646"
FT                   /db_xref="GOA:Q5B3V4"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3V4"
FT                   /protein_id="CBF76804.1"
FT                   /translation="MAGRPPLKLLMLHGYTQSGPLFHAKSRALIKHITKAFPLHEISAI
FT                   YPTGPLRLNPADIPGYTPAHDSNGNGDDKDTEIEAYGWYRRSNTAEPPLYVGLEDGLNA
FT                   IAKVLGEEGPFDGVIGFSQGAAMAAMVASLLEGEKRREAFARFASSSCSSSETTAEGIP
FT                   YPDSFAELDHPAMKFVLCYRLFMRLRRFRRLSCMCWALWMRLLMRGGVGRLWKLALGIR
FT                   RARARLFGILGVTFCRASGLI"
FT   gene            complement(1021606..1023532)
FT                   /locus_tag="ANIA_04775"
FT                   /old_locus_tag="AN4775.4"
FT                   /product="proteasome regulatory particle subunit (RpnE),
FT                   putative (AFU_orthologue; AFUA_3G06610)"
FT   mRNA            complement(join(1021606..1022312,1022371..1022859,
FT                   1022912..1023148,1023211..1023267,1023322..1023532))
FT                   /locus_tag="ANIA_04775"
FT                   /old_locus_tag="AN4775.4"
FT                   /note="transcript_id=CADANIAT00005647"
FT   CDS_pept        complement(join(1021713..1022312,1022371..1022859,
FT                   1022912..1023148,1023211..1023267,1023322..1023402))
FT                   /locus_tag="ANIA_04775"
FT                   /old_locus_tag="AN4775.4"
FT                   /product="proteasome regulatory particle subunit (RpnE),
FT                   putative (AFU_orthologue; AFUA_3G06610)"
FT                   /note="transcript_id=CADANIAT00005647"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005647"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005647"
FT                   /db_xref="GOA:Q5B3V5"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR035297"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040134"
FT                   /db_xref="InterPro:IPR040896"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3V5"
FT                   /protein_id="CBF76806.1"
FT                   /translation="MSGVLKPEKDFSKDADKLIPEAEQLAKTDVQGAIDKLLLLEKQAR
FT                   QSSDLPTTSRLLVTIVTISKNTGDWNLLNDQVLLLSKKHGQLKQAISRMVQTVMSFLDE
FT                   TPNMETKLSVIQTLRTVTEGKIFVEVERARVTRILSQIKKSQGDLNAAADILCELQVET
FT                   FGSMTRREKTEFILEQVALCIERGDWTQATVLSRKINKRYFARKPKKSAEEIEKLKKEA
FT                   EEREKTRAPDEAPMEVDDDVTDLKLRYYEQQIILANHDYKYLDVCKHYREVLDTDSVQE
FT                   NPEQLRAVLARIVYYIVLSPYDNEQSDLLHRIQQDTRLSAVPVESRLVKLFTVPELMRW
FT                   PIVAEQFGPHLCNTDVFSPKPSQSAEDRPYRRWQDLRKRVIEHNVRVVAKYYTRIEMGR
FT                   LTQLLDLTEEETEKYISELVTSKTIYAKIDRPARLVNFAKPRDADDVLNEWSSDMRSLL
FT                   GLLERIDHLITKEEMMARILPTREKAKAR"
FT   gene            1024422..1026157
FT                   /locus_tag="ANIA_04774"
FT                   /old_locus_tag="AN4774.4"
FT                   /product="siroheme synthase, putative (AFU_orthologue;
FT                   AFUA_3G06600)"
FT   mRNA            join(1024422..1024743,1024797..1026157)
FT                   /locus_tag="ANIA_04774"
FT                   /old_locus_tag="AN4774.4"
FT                   /note="transcript_id=CADANIAT00005648"
FT   CDS_pept        join(1024422..1024743,1024797..1026157)
FT                   /locus_tag="ANIA_04774"
FT                   /old_locus_tag="AN4774.4"
FT                   /product="siroheme synthase, putative (AFU_orthologue;
FT                   AFUA_3G06600)"
FT                   /note="transcript_id=CADANIAT00005648"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005648"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005648"
FT                   /db_xref="GOA:Q5B3V6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012066"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR028162"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3V6"
FT                   /protein_id="CBF76808.1"
FT                   /translation="MKDASESAAQIPLLASINAESQVHLIVGANPLAAARCTKSVQAGA
FT                   KPVVISPDPGSLQYTLAAHFENGNAKWVQREFEDADLTTLGREEVDHVVDMVFVTLGGN
FT                   HPLSSHISKLCRRLRIPVNVSDAPDLCTFSLLSTYSDGPLHVGITTSGRGCKLAARLKR
FT                   EIAATLPPNLGNAIDRLGTIRRRLWEEDFAAGLCDAVFDIDDDDATGQKHTFNNLVTES
FT                   DVNAAKTRRMRWLSQICEYWPLRKLAAIDDSDIDKILQEYSAGTVKSTDTNGTFIEKKG
FT                   KIVLAGSGPGHPDLLTRATYNAIQCADIILADKLVPAPVLELIPRRTEVHIARKFPGNA
FT                   DQAQEEFLRMGLDALKKGRKVLRLKQGDPYLYGRGGEELEFFRAEGFTPVVLPGITSAL
FT                   SAPLFAEIPATHRGVADQVLVCTGTGRKGAAPEPPTYVPTQTVVFLMALHRLSALINSL
FT                   TMPPAEDFDRPPQPRTLWPKETPCAIIERASCSDQRVIRSTLEHVCQAFEVEGSRPPGL
FT                   LVVGASCHVLHKPEDQKWIVEEGFRGLDELQSTVEVPMMNETA"
FT   gene            1027975..1030070
FT                   /locus_tag="ANIA_04773"
FT                   /old_locus_tag="AN4773.4"
FT                   /product="C6 transcription factor, putative
FT                   (AFU_orthologue; AFUA_3G12940)"
FT   mRNA            join(1027975..1028229,1028311..1028414,1028560..1028800,
FT                   1028857..1029077,1029208..1029397,1029467..1029522,
FT                   1029573..1029702,1029753..1030070)
FT                   /locus_tag="ANIA_04773"
FT                   /old_locus_tag="AN4773.4"
FT                   /note="transcript_id=CADANIAT00005649"
FT   CDS_pept        join(1027975..1028229,1028311..1028414,1028560..1028800,
FT                   1028857..1029077,1029208..1029397,1029467..1029522,
FT                   1029573..1029702,1029753..1030070)
FT                   /locus_tag="ANIA_04773"
FT                   /old_locus_tag="AN4773.4"
FT                   /product="C6 transcription factor, putative
FT                   (AFU_orthologue; AFUA_3G12940)"
FT                   /note="transcript_id=CADANIAT00005649"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005649"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005649"
FT                   /db_xref="GOA:Q5B3V7"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3V7"
FT                   /protein_id="CBF76810.1"
FT                   /translation="MSSTLTRINPRLQRLADILAQAQALPCEALEQCPASPESYPTARS
FT                   SPVPKDAATLQRRSQEDVLILKNGVPRFISGKHWAWMAEEIRDIQSLLAEPQKSSPNEP
FT                   QGNHLIWESDSSPSNLQDSNNIAFDPIQSDAFEPLTMSIFHAAINSMKETDVSTVFNTD
FT                   KSCLLRRYRAGIEIYLKQHEFMSSRIFEVLQAFVIFLTAQYREDDIGKVWPLTGLAIRM
FT                   ATIQHLHRGPLALPLGTIDIVQVELRRRLWAQICHLDFRAAEGHGFAPSIHDLSMLRAH
FT                   YPDHTCVAKENPCLFPGASGEARVLSELQTLLKTAEAMAAELEKALDDLVQYCDKSIQI
FT                   PRQDREKVISPTTRRSIFMDAAITVENWCTIASSKDCEPSQWHISSHAGIHPILYVLSE
FT                   GSAGSNRDLRNPRPAYVRGMASHYLLLDRVRFQNLCPADGTQTAGLSPGPQDNPMVTRS
FT                   GPDNMASGELELDTGDFLGFMNLGDFGFPDLADVDPMLFSNPSQWS"
FT   gene            1031336..1034165
FT                   /locus_tag="ANIA_04772"
FT                   /old_locus_tag="AN4772.4"
FT                   /product="deoxyribose-phosphate aldolase, putative
FT                   (AFU_orthologue; AFUA_3G06590)"
FT   mRNA            join(1031336..1031393,1031706..1032029,1032109..1032419,
FT                   1032462..1032598,1033361..1034165)
FT                   /locus_tag="ANIA_04772"
FT                   /old_locus_tag="AN4772.4"
FT                   /note="transcript_id=CADANIAT00005650"
FT   CDS_pept        join(1031336..1031393,1031706..1032029,1032109..1032419,
FT                   1032462..1032598,1033361..1034165)
FT                   /locus_tag="ANIA_04772"
FT                   /old_locus_tag="AN4772.4"
FT                   /product="deoxyribose-phosphate aldolase, putative
FT                   (AFU_orthologue; AFUA_3G06590)"
FT                   /note="transcript_id=CADANIAT00005650"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005650"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005650"
FT                   /db_xref="GOA:Q5B3V8"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3V8"
FT                   /protein_id="CBF76812.1"
FT                   /translation="MAIVAGGGLVVPLSSGVLFRRQCWTISDMFEAHEGGKAMGAFMLG
FT                   PKLGPMFAPITGAALVTRWSWRSTQWFMVIYGWTVFLIMVFFMPETATNLEENQQNERA
FT                   KSTSPAMKVVNFLLKPTQTLPCCNTFALPPYSWSSIIVGVPYSIIVGVPYIPGGLGLLF
FT                   GAIVGGRWQDYIMKRTARKEGRFDYDGNLILHSIDRLRENCLLAVILFPRALLWWGWTA
FT                   DKHVFWLVPLIGNFFYGFAGMILTNVTMTMLTEFTPKRSTMGVAVNNLLRNSCPITTMS
FT                   IPKTNQEWEALISSISASLPESLNQEQAPTPAKVNRTIDHTQLALTATPDQITELCTQA
FT                   SKYQFATVCVRLAHVEQAVAELRSAPEVGVACVVGFHEGMYETSEKEDEARKAISLGAT
FT                   ELDMVLKYPLLKTKQYVEVYEDILGVRNAAPAPVGLKVILETSQLTRDEIIAGSVISCL
FT                   AGADFIKTSTGFNGAGATVENVALMYEVAKAVGKGTKVKASGGVRSAADCIKMLRAGAE
FT                   RIGASSGVKIVQELEGEQVQDEGSSGY"
FT   gene            complement(1034765..1036536)
FT                   /locus_tag="ANIA_04771"
FT                   /old_locus_tag="AN4771.4"
FT                   /product="ribosomal assembly complex component Ipi3,
FT                   putative (AFU_orthologue; AFUA_3G06580)"
FT   mRNA            complement(join(1034765..1036138,1036189..1036536))
FT                   /locus_tag="ANIA_04771"
FT                   /old_locus_tag="AN4771.4"
FT                   /note="transcript_id=CADANIAT00005651"
FT   CDS_pept        complement(join(1034765..1036138,1036189..1036536))
FT                   /locus_tag="ANIA_04771"
FT                   /old_locus_tag="AN4771.4"
FT                   /product="ribosomal assembly complex component Ipi3,
FT                   putative (AFU_orthologue; AFUA_3G06580)"
FT                   /note="transcript_id=CADANIAT00005651"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005651"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005651"
FT                   /db_xref="GOA:Q5B3V9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3V9"
FT                   /protein_id="CBF76814.1"
FT                   /translation="MLSECFVASTAASAKTPASASLRDVGICLHELQPSPTLRSTFKKS
FT                   STSPNCLAVSASHVFAAQAEKATVHVYSREKGNQEATVPFPERIRSIAVAGSKNGDIVV
FT                   LGTEGGRLILWEVCTGRQVATTASHLRPVTSVVVDPSSNFILSGSSDASVHVWSLVDLL
FT                   SFTKPPSGRNQQPPNSPIRTFSNHRAAVSAIVVGHSTGRYNIAISAAQDNTAIVWDYRT
FT                   GHVLRNFLLPASAISLALDPVDRAFYAGYEDGSVQSLDFYKEQSIQHPLHNPSLQATPA
FT                   QASSEDRWLPPSADSGAAHALTLSYDGMTLLSGHENGKVYSWNVGRRKYASTVADFTHP
FT                   VTNIIMLPLEGLYQQATNLKRVAHTIIKPKYDHTLLENTQAAGTVPADYEFNTHLLRSS
FT                   SPSEAPAESDWFMDAFTHSSFPASLIEQGLSELTAMSLPGSDTVSAPSMNVAMDVDTPG
FT                   KDSQIASLENEIATLKQKVSVSDAARQSSTDEITKLRSNLANLHDHINELKAKQEQSQR
FT                   DRIRRQARREERATRRREAWFAAEKKGKNGDAVLRRMKAEDESETSGSDDQSSDEQ"
FT   misc_feature    1035824..1042768
FT                   /note="contig 1.201 1..6945(1)"
FT   gene            1037611..1039941
FT                   /locus_tag="ANIA_09485"
FT                   /old_locus_tag="AN9485.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1037611..1038364,1038446..1038693,1038745..1039941)
FT                   /locus_tag="ANIA_09485"
FT                   /old_locus_tag="AN9485.4"
FT                   /note="transcript_id=CADANIAT00005652"
FT   CDS_pept        join(1037611..1038364,1038446..1038693,1038745..1039671)
FT                   /locus_tag="ANIA_09485"
FT                   /old_locus_tag="AN9485.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005652"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005652"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005652"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQE5"
FT                   /protein_id="CBF76816.1"
FT                   /translation="MSSMDYEIANPHTRPYYGHQRHHTVNASPVPAYVNRSVPTYSLMN
FT                   QEQMPQPNSLASPRHSPNIQPWKRQQPQSSLSFIPSTSPRFEQSEYTMSQSRRPLDRGT
FT                   ACISPFRSVRKMKEPFQLRLPASPSVDNSSLAPGESRVTSRPTETRTLRPWRSEQNLVA
FT                   SGLDTFGLLPSPPLSDSQPSQASPASTYFSSKSASETEADRETDCSCLPQAVSCNHCTP
FT                   QTPATEVSVQSRKFEATNVHMAHSTFVRQYSLGKRNFSGSSAATQRSRSGTVSSEGSWV
FT                   PSSLSYCETWLQGAPMDSAEDEAGKSTISNRRKFQIVQKSPLVPDWKRAHNDAVLAVKS
FT                   KMKPKLVDISRQSSPAMSYSLPTPTHPIPATPDHSLPEVSAFSPDTPLELSDSGYATQN
FT                   PVFLPKNRKGGGESLNTDQCSVASGTMGKTIIGDPGAGNGDESETEPKPPPHKVAPPSE
FT                   QQASPRAASTKSDKEELEKLWDHEWTIDQLEHSVNDFPQNMLRLTSPVVVFLRHNQERA
FT                   LMRPFRQIFPNAPTSILDSLCAVLIAKNYLLSLPSLSRKTTNMQLSAQISRLDTVPEKA
FT                   NSILGMKFAQPQPSRIRDQVLGSRSSKLLEDLDSILDNLLFTLRGPHDEALKSAVLVLM
FT                   QVLETKA"
FT   gene            1040160..1041580
FT                   /locus_tag="ANIA_09486"
FT                   /old_locus_tag="AN9486.4"
FT                   /product="lipoic acid synthetase precursor (AFU_orthologue;
FT                   AFUA_3G06560)"
FT   mRNA            1040160..1041580
FT                   /locus_tag="ANIA_09486"
FT                   /old_locus_tag="AN9486.4"
FT                   /note="transcript_id=CADANIAT00005653"
FT   CDS_pept        1040176..1041417
FT                   /locus_tag="ANIA_09486"
FT                   /old_locus_tag="AN9486.4"
FT                   /product="lipoic acid synthetase precursor (AFU_orthologue;
FT                   AFUA_3G06560)"
FT                   /note="transcript_id=CADANIAT00005653"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005653"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005653"
FT                   /db_xref="GOA:Q5AQE4"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AQE4"
FT                   /protein_id="CBF76818.1"
FT                   /translation="MAAATNRFRALYSSSRVATPQAGSASYLSYRGYATTDPSSATGGA
FT                   STAGKRRTTFTDKLNAGPSFGDFVSGGRDNAPLDPSEAYALKTALVGPAGRKKEMTRLP
FT                   SWLKTPIPDSKNYQRLKKDLRGLNLHTVCEEARCPNISDCWGGGDKAAATATIMLMGDT
FT                   CTRGCRFCSVKTSRAPPPLDPHEPENTAEAISRWGLGYVVLTSVDRDDLADGGARHFAE
FT                   TVIKIKQKAPNILVECLTGDYAGDLEMVGVVARSGLDVYAHNVETVEALTPHVRDRRAT
FT                   FQQSLRVLEAAKKAKPSLITKTSLMLGLGETEEQLWDALRQLRAVNVDVVTFGQYMRPT
FT                   KRHMAVHEYVTPDRFELWRQRALDMGFLYCASGPLVRSSYKAGEAFIENVLKKRRSGAP
FT                   EVSHNTVPVDEATR"
FT   misc_feature    1042769..1376361
FT                   /note="contig 1.80 1848..335440(-1)"
FT   gene            complement(1042822..1043851)
FT                   /locus_tag="ANIA_10593"
FT                   /old_locus_tag="AN10593.4"
FT                   /product="Phosphoserine phosphatase, hypothetical
FT                   (Eurofung)"
FT   mRNA            complement(1042822..1043851)
FT                   /locus_tag="ANIA_10593"
FT                   /old_locus_tag="AN10593.4"
FT                   /note="transcript_id=CADANIAT00005654"
FT   CDS_pept        complement(1042855..1043721)
FT                   /locus_tag="ANIA_10593"
FT                   /old_locus_tag="AN10593.4"
FT                   /product="Phosphoserine phosphatase, hypothetical
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005654"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005654"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005654"
FT                   /db_xref="GOA:C8VAQ0"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAQ0"
FT                   /protein_id="CBF76820.1"
FT                   /translation="MSSTNPAVARPARPVMQQRFSSSSFIQDHQQYKAPASITPTIGNV
FT                   LENATESSPSPIPRVANPISPDPKKVTDSGIVHSIFQHRDAVLPQGTPKLVATIFYKSS
FT                   DPVHPHLHPDSSPHARLGDKLPHPMVPVGSAPTIDIEKLPREPPAPEPEPLDHLYGPYV
FT                   SQLCLTNFLQIIESLPIPHQRMNTSHRCLDTQEQPRVVEVTFAPPPNPDYLSFEDLRKH
FT                   ESIWRFEREWNVEVVLQRESAFRRHKRLVVFDMDSTLIQNEVIDEIAKFIGVEKEVSVS
FT                   ISQCAAC"
FT   gene            1044681..1045696
FT                   /locus_tag="ANIA_04770"
FT                   /old_locus_tag="AN4770.4"
FT                   /product="Phosphoadenosine phosphosulfate reductase (EC
FT                   1.8.4.8)(PAPS reductase, thioredoxin dependent)(PAdoPS
FT                   reductase)(3'-phosphoadenylylsulfate reductase)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P56859]"
FT   mRNA            1044681..1045696
FT                   /locus_tag="ANIA_04770"
FT                   /old_locus_tag="AN4770.4"
FT                   /note="transcript_id=CADANIAT00005655"
FT   CDS_pept        1044722..1045696
FT                   /locus_tag="ANIA_04770"
FT                   /old_locus_tag="AN4770.4"
FT                   /product="Phosphoadenosine phosphosulfate reductase (EC
FT                   1.8.4.8)(PAPS reductase, thioredoxin dependent)(PAdoPS
FT                   reductase)(3'-phosphoadenylylsulfate reductase)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P56859]"
FT                   /note="transcript_id=CADANIAT00005655"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005655"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005655"
FT                   /db_xref="GOA:P56859"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011800"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56859"
FT                   /protein_id="CBF76822.1"
FT                   /translation="MPAKMHSNYPSDSETAELRDSTESGYVSGGSSEEYLPEIVFTKPH
FT                   LQFLNRQLQFLEPQGQLFHIFSSRQRRLTPLADVLRWCVTSLPHLYQTTAFGLTGLVIM
FT                   DMLSKLSIPRPQMVNLIFLDTLHHFPETLKLVDNVRKRYPLQHIHVYKPQGVETEEEFA
FT                   KKHGERLWEKDDQLYDWIAKVEPAQRAYRELNVHAVLTGRRRSQGGKRGDLDIIEVDEA
FT                   GLIKINPLANWTFDQVKQYVKENDIPYNELLDKGYKSVGDYHSTSPVKENEDERSGRWK
FT                   GQAKTECGIHNPRSKYAQYLMDMERKRQEEALSQALQNKLTTA"
FT   gene            1048670..1051108
FT                   /locus_tag="ANIA_04769"
FT                   /old_locus_tag="AN4769.4"
FT                   /product="Sulfate adenylyltransferase (EC 2.7.7.4)(Sulfate
FT                   adenylate transferase)(SAT)(ATP-sulfurylase)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q12555]"
FT   mRNA            join(1048670..1048923,1049000..1049027,1049175..1049357,
FT                   1049519..1049664,1049729..1049798,1049853..1051108)
FT                   /locus_tag="ANIA_04769"
FT                   /old_locus_tag="AN4769.4"
FT                   /note="transcript_id=CADANIAT00005656"
FT   CDS_pept        join(1048755..1048923,1049000..1049027,1049175..1049357,
FT                   1049519..1049664,1049729..1049798,1049853..1050981)
FT                   /locus_tag="ANIA_04769"
FT                   /old_locus_tag="AN4769.4"
FT                   /product="Sulfate adenylyltransferase (EC 2.7.7.4)(Sulfate
FT                   adenylate transferase)(SAT)(ATP-sulfurylase)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q12555]"
FT                   /note="transcript_id=CADANIAT00005656"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005656"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005656"
FT                   /db_xref="GOA:Q12555"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q12555"
FT                   /protein_id="CBF76824.1"
FT                   /translation="MANTPHGGVLKDLIARDAPRHDQLEAEAATLPSIVLTERQLCDLE
FT                   LIMNGGFSPLEGFMNQKDYDGVVAESRLADGNLFSMPITLDASKAVIEQAGLKPGSRVT
FT                   LRDFRDDRNLAILTIDDIYRPDKEKEAKLVFGGDPEHPAIKYLNTKVEEYYIGGKLEAV
FT                   NKLNHYDYVGLRYTPAELRIHFDKLGWTRVVAFQTRNPMHRAHRELTVRAARARQANVL
FT                   IHPVVGLTKPGDIDHFTRVRAYQALLPRYPNGMAALALLPLAMRMGGPREAVWHAIIRK
FT                   NHGATHFIVGRDHAGPGKNSKGQEFYGPYDAQHAVEKYRAELGIEVVEFQQVTYLPDTD
FT                   EYMPKDEVPAGTKTLDISGTELRNRLRTGAHIPEWFSYPEVVKILRESSPPRALQGFTI
FT                   FLTGYMNSGKDAIARALQVTLNQQGGRSVTLLLGDTVRHELSSELGFSREDRHTNVQRI
FT                   AFVAGELTRAGAAVIAAPIAPYEHSRKAAREAVQSTGGSFFLVHVNTPLEYCEATDKRG
FT                   IYAKARRGEIKGFTGVDDPYEAPTNANLVVDVSKQSVRSIVHEIILMLESEGYFERL"
FT   gene            1052106..1054087
FT                   /locus_tag="ANIA_04768"
FT                   /old_locus_tag="AN4768.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            1052106..1054087
FT                   /locus_tag="ANIA_04768"
FT                   /old_locus_tag="AN4768.4"
FT                   /note="transcript_id=CADANIAT00005657"
FT   CDS_pept        1052115..1053881
FT                   /locus_tag="ANIA_04768"
FT                   /old_locus_tag="AN4768.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005657"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005657"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005657"
FT                   /db_xref="GOA:C8VAQ3"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAQ3"
FT                   /protein_id="CBF76826.1"
FT                   /translation="MLRQRTRVARISGAAGPSLRPQLPSLGACQPCRRPFTQKPPLLIL
FT                   SPQRSRPQLTFLSPSPISRALPPLSVHLQQHFARLVSTESRGHFKKRASRVLRLSLSLG
FT                   AILVLYEIIKIGVYQEELEHKWPTPPEWTWKSRWCLRSALAWQHPEEIGKLMSDWPMVA
FT                   GYCKELISRLEDLNGEGKGLVELDEGGIFIDGVGKAGFDITAKSEPWRRGYFQALLGAA
FT                   KAAENLEGWLTDRKQRVSASAEYFVGPSNPRPKPVPLGQTPPREEDSEPASPSPEVFYM
FT                   KILTTRGFNTGQKIDAALAYADWLDYKGLQSTAADMYKWAIDIAASGASMDATKVVDLK
FT                   TGVINSDSQTLPSENILRVSTALGVHHARHGNLPMALSIFTSVLKARRAISPPPPGTIV
FT                   PISSSIPKPTNDIFVSFFNTLKTVFIPVQYPPPPPTGNDTPFRTPSSPCDEAGLMTYIG
FT                   EILYATHSKETGLAWTRDAVDLAESTLPETDPSSRNNRCIDCLRVSLENWKTMVSQFLE
FT                   NAQKDEEETITKAKNGSSWFGPSKRQIEAKTLVRKRWEAEQFILQARIKKLLPVIEDDS
FT                   AIQGVVPGVGLF"
FT   gene            complement(1054161..1056923)
FT                   /locus_tag="ANIA_04767"
FT                   /old_locus_tag="AN4767.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1054161..1055558,1055621..1056923))
FT                   /locus_tag="ANIA_04767"
FT                   /old_locus_tag="AN4767.4"
FT                   /note="transcript_id=CADANIAT00005658"
FT   CDS_pept        complement(join(1054435..1055558,1055621..1056923))
FT                   /locus_tag="ANIA_04767"
FT                   /old_locus_tag="AN4767.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005658"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005658"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005658"
FT                   /db_xref="GOA:Q5B3W3"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3W3"
FT                   /protein_id="CBF76828.1"
FT                   /translation="MDSTSKHGWSEPRPAERKGSVRRAREMLEVGKRPRIRAPQENAAL
FT                   PPGPRMSQQTAWPLLGDDGPGVNVVDSRDRGPNLGDSPGRLMAPRAPPPPRPPRQDPPS
FT                   PSVYSERSVPDAVPSPLHLNNRNRAPSFSQPFVNQQHIHPALREPVPSTKEDPFRKSAA
FT                   SSLGSIPSIPDFPPPLPSQNNAASLAPTAPMRSGMNRRSSVSPIPEELPDSPTILNKPY
FT                   TRLTASSWNSEQQESEVLGAYMDNNSEGALESPEHAEVSLVRQASVGTRGKPSLRTISK
FT                   PSADGMVGGAGRTETPIGQTNDASLKEVAAGLSTRNSFSSGSFKESDIDPEKPPIVLEN
FT                   DTNAQHSYDNDMRSVEKETAALPQRTPTMSEMRPGARRPPRLNINAVREAEARGSLTSL
FT                   SDLIKRATKLATNLEHGRTASRNDLLNVGGSRHPFGDPNRRSGSIKDILASFPNPAATP
FT                   EGRSSWPVFWRRSTLQQLNSQEQGQDLSQEKGSTRTQRRRCCGMPLWAFITACVVLLLI
FT                   IAAAVLIPIFLVVVPRENKGNDSSNTMCEKTNPCSNGGVSVSSGNVCSCVCVNGYTGSR
FT                   CTTSGDASCVTTEITQNSTSRNATVGDDLPRLFRDSQSNFSIPLDAVTIMALFSQNNVS
FT                   CTTENALVSFKGLSSNDNKRRALNADLLVADPEKLEPSSSTDEPTATIPVRREVATKNG
FT                   ILFEDSGTNESPAAAETSSASTSEATPAPTSAVTAEALDFSRISVLYILEKTGTLDAAM
FT                   FSADVIKKHLEHSYSNSSDESFVINLVPSGIKGNITLDYGGFTITDFDGNTVGGS"
FT   gene            complement(1058968..1060052)
FT                   /locus_tag="ANIA_04766"
FT                   /old_locus_tag="AN4766.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1058968..1059484,1059569..1059666,
FT                   1059717..1060052))
FT                   /locus_tag="ANIA_04766"
FT                   /old_locus_tag="AN4766.4"
FT                   /note="transcript_id=CADANIAT00005659"
FT   CDS_pept        complement(join(1058968..1059484,1059569..1059666,
FT                   1059717..1060052))
FT                   /locus_tag="ANIA_04766"
FT                   /old_locus_tag="AN4766.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005659"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005659"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005659"
FT                   /db_xref="GOA:Q5B3W4"
FT                   /db_xref="InterPro:IPR040357"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3W4"
FT                   /protein_id="CBF76830.1"
FT                   /translation="MTEISSDCPAALHISAFVLQLTTSPSTSLPEELLTIDACIACVHI
FT                   LRPMKQLPTPPASRQSSEVPDTDLKQLHIDDPTPDLLESLDALLEKYLHLLDKHQRLQH
FT                   VLASKLSSGFLSLAHANYTCPPGRRYGADYYDERMKASRRVILRPPSSADREDSTAELE
FT                   SPPPNGASSKGIFSIEFTPSNDEEEQPDTDEPSGTGEKAPEKALEQEPLKKAGDNNAAD
FT                   TTASPQDSSEASETKTEADADADADARSGLVRRRPRTLDPIKWFGILVPPSLRSAQKSF
FT                   TEAVEGSLPELAGIVVEMQAAEKEITELRRRMGRE"
FT   gene            1060081..1061424
FT                   /locus_tag="ANIA_10584"
FT                   /old_locus_tag="AN10584.4"
FT                   /product="iron-sulfur cluster biosynthesis protein Isd11,
FT                   putative (AFU_orthologue; AFUA_3G06492)"
FT   mRNA            join(1060081..1060123,1060297..1060584,1060637..1060801,
FT                   1060904..1060966,1061024..1061073,1061128..1061424)
FT                   /locus_tag="ANIA_10584"
FT                   /old_locus_tag="AN10584.4"
FT                   /note="transcript_id=CADANIAT00005660"
FT   CDS_pept        join(1060531..1060584,1060637..1060801,1060904..1060966,
FT                   1061024..1061073,1061128..1061137)
FT                   /locus_tag="ANIA_10584"
FT                   /old_locus_tag="AN10584.4"
FT                   /product="iron-sulfur cluster biosynthesis protein Isd11,
FT                   putative (AFU_orthologue; AFUA_3G06492)"
FT                   /note="transcript_id=CADANIAT00005660"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005660"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005660"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAQ6"
FT                   /protein_id="CBF76832.1"
FT                   /translation="MMSVSTLARDTAFQARSLFRSLLRQSSQFSNYNFREYALRRTKDA
FT                   FREHQHESEERKIQELIQEGLQSLRMMKRQTVISQFYQLDKLVVEGQKTGKETGQEGGI
FT                   VRQKDTGWD"
FT   gene            1061952..1064222
FT                   /locus_tag="ANIA_10591"
FT                   /old_locus_tag="AN10591.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            1061952..1064222
FT                   /locus_tag="ANIA_10591"
FT                   /old_locus_tag="AN10591.4"
FT                   /note="transcript_id=CADANIAT00005661"
FT   CDS_pept        1061952..1064222
FT                   /locus_tag="ANIA_10591"
FT                   /old_locus_tag="AN10591.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005661"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005661"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005661"
FT                   /db_xref="GOA:C8VAQ7"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAQ7"
FT                   /protein_id="CBF76833.1"
FT                   /translation="MPKDSHLLSPMSRALLRAARAGCIYIRQVSKDIDDEEKETTDPEE
FT                   QQTQQNMERNFSLRKWTTVPKHLEAPEVEFLAKRRPGLPSLYGAAAGTVDGAGSVPMRK
FT                   TRFKKVDPDTGNILIYAAWVPEGHKIEGEITGDSQVTAESNQVTVTPQAPAPGTVIEGV
FT                   GVVDAQGVVVAAADSPAVITPQKRRPPPPKRKGKGLKGRRKKVMFAPGEGADAALVHGA
FT                   GAGDSAANYGKETDSSRMSVDQTTQDEEDEEGDEGEESDDGEGDESGFDAKTPETPGPQ
FT                   PSTEPELTPISASAKTGTTADSHAPQVSQASEPDTEPSQASAQQAASLQPSGHVPVAPI
FT                   SMTDSSRLDQDTQVTSTERLSEDVHMADATTAETTLRASPKPSLETQLQPAPGVAQPLS
FT                   PEKAPSAQQQTSQAPVLEASGIGVENAQPPATEQTDVTMEEARESVPEPSEAMPENTNL
FT                   QTVAPESSLPGQASANESTPPEADQQPSGSEFNLLDNLEASLNNPRQETLSDVQKGAIS
FT                   EQKTGVLPSQETITAPGEAASGPTETSTEAETTRSAETKELSREDPVAPPVEQLTPPGA
FT                   DQITPLETSEQKPQQAPPTIEQYQPEKLAGTPTHPEPGPATPAFNVAPEGQAERPPVLV
FT                   PVPAEATTSAEAIAKPQSPTVEGHSPQHSTEPAVEKKQEQQTSTTPSPTEPATTSAAEQ
FT                   PQPQATAQHTPKELSRPQTETSPASNVEPGEGSQGEATQAQMNGEHGTSGDGPSPNGER
FT                   QTE"
FT   gene            complement(1064810..1067440)
FT                   /locus_tag="ANIA_04764"
FT                   /old_locus_tag="AN4764.4"
FT                   /product="histone-lysine N-methyltransferase (Ash1),
FT                   putative (AFU_orthologue; AFUA_3G06480)"
FT   mRNA            complement(join(1064810..1065512,1065569..1065741,
FT                   1065828..1066201,1066252..1067440))
FT                   /locus_tag="ANIA_04764"
FT                   /old_locus_tag="AN4764.4"
FT                   /note="transcript_id=CADANIAT00005662"
FT   CDS_pept        complement(join(1064810..1065512,1065569..1065741,
FT                   1065828..1066201,1066252..1067440))
FT                   /locus_tag="ANIA_04764"
FT                   /old_locus_tag="AN4764.4"
FT                   /product="histone-lysine N-methyltransferase (Ash1),
FT                   putative (AFU_orthologue; AFUA_3G06480)"
FT                   /note="transcript_id=CADANIAT00005662"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005662"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005662"
FT                   /db_xref="GOA:C8VAQ8"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR006560"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAQ8"
FT                   /protein_id="CBF76835.1"
FT                   /translation="MDGPPGLSGASPATPATISDLVKHSHEPPDHVMAFDYTEQLLTPE
FT                   NSRSETSSNNDNASNEEKPTVRRQSTRVTRASLRGAADLDFGAEIEHNGHKHSAETTEH
FT                   VVLDKPPDNGAAPRGKNPRASHLRHSIAIMESALQAETSLTQDAMDVDNHPLAPNTPIS
FT                   ESSHGSHTDDVPAALPPRTLRKRVEQALARDKGYGSEKDSKPASADNETPVRRSSRLSL
FT                   LGKVSDLAGRATGVLGKRSTSMRENAKEPDRRSSLRPRRSTTAREEPPAEPPTKKQRVS
FT                   VSAPVDKAKSESDASQEEPTPPEVITRFKEKRWLTHGLYSGQEYTNLRPSQKRTEKRRK
FT                   SHNTSQPNHQRKYLPLPMFAGERLLQTGRDFQLPFDIYSPLPPGQPKPNEWRKTNKNVF
FT                   VGEAGSIWRANKEEELSKCTCMPETGCDQFCQNRYMFYECDDRICGVGPECGNRNFEEL
FT                   KQRAKAGGKYNVGVEVIKTPDRGYGVRSNRTFEPNQIIVEYTGEIITQAECEKRMRTIY
FT                   KKNENMIIDATRGSIARFVNHGCEPNCRMEKWTVAGKPRMALFAGDRGIMTGEELTYDY
FT                   NFDPYSQKNVQQCRCGSSKCRGILGPRKREKEQRAELRAAKLKEIADAKKAKAAKRRKE
FT                   NALKRSRPRNNRKGRALAPSSIKSGVKKAASKARGAVSRKMPAAATSSKKSASKKSTNA
FT                   SKQTSTKSKRNIRLPTIKAPKVKAKITSRVRAPAQTTRTKVKKASTSPPKSRSRVSATK
FT                   TTKAATAAESSPARKRPLKAKKDILNGVRETINKGTTKHSQRAKSSSSRTTGRSPRARK
FT                   "
FT   gene            complement(1069636..1071896)
FT                   /locus_tag="ANIA_04763"
FT                   /old_locus_tag="AN4763.4"
FT                   /product="DHHC zinc finger membrane protein, putative
FT                   (AFU_orthologue; AFUA_3G06470)"
FT   mRNA            complement(join(1069636..1070379,1070435..1070551,
FT                   1070710..1071708,1071835..1071896))
FT                   /locus_tag="ANIA_04763"
FT                   /old_locus_tag="AN4763.4"
FT                   /note="transcript_id=CADANIAT00005663"
FT   CDS_pept        complement(join(1069636..1070379,1070435..1070551,
FT                   1070710..1071546))
FT                   /locus_tag="ANIA_04763"
FT                   /old_locus_tag="AN4763.4"
FT                   /product="DHHC zinc finger membrane protein, putative
FT                   (AFU_orthologue; AFUA_3G06470)"
FT                   /note="transcript_id=CADANIAT00005663"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005663"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005663"
FT                   /db_xref="GOA:Q5B3W7"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3W7"
FT                   /protein_id="CBF76837.1"
FT                   /translation="MAFQFSNNPESNETTNNPAPHVLGLPRPPSVGGISSRVTDMSEDG
FT                   DQSQTNTMSSHVPHRHSVSRRGPPPARSSIASTSQITNRPGSSASRLSRTHIPSLAASG
FT                   FFRPMSSQRLQAHRGRPATNHTVSTEDWGDQMNQNRRSLISNSTFPNSLSAADQEVPPS
FT                   RGTEFTDPIIPDRIHSNASPTANTTTVRSESANLIRDRERPPHLNLKVDYKGTNENETP
FT                   ERSPLSFLSLQNRNAPADNRDSRAHARLSSADSSPQSIEKKPELAKSRNKGRNYEYFPS
FT                   RGPWLWHNISPAIPVLFAYVFYLCFSSFIHASVVDPGVIPRNLHQMPPVDPSQDPLAIG
FT                   PPTNDWVMVKLATSDVAAMDVPVKYCKTCSIWRPPRCYHCRVCDNCIETLDHHCVWLNN
FT                   CVGRRNYRYFFAFVSTSTLLALFLLGASLAHILVYRSREGISFSDAIDKWRVPFAMVIY
FT                   GALAAPYPASLWAYHLFLVGRGETTREYLNSHKFAKADRHRPFTQGNVIRNWIAVFGRP
FT                   RPPTYMQFKEYYQEGDQRLSTVKRRFLPRNTEPQNDIEMQHVPPPNSA"
FT   gene            1072142..1073088
FT                   /locus_tag="ANIA_04762"
FT                   /old_locus_tag="AN4762.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1072142..1072344,1072416..1072459,1072581..1072779,
FT                   1072855..1073088)
FT                   /locus_tag="ANIA_04762"
FT                   /old_locus_tag="AN4762.4"
FT                   /note="transcript_id=CADANIAT00005664"
FT   CDS_pept        join(1072204..1072344,1072416..1072459,1072581..1072779,
FT                   1072855..1072905)
FT                   /locus_tag="ANIA_04762"
FT                   /old_locus_tag="AN4762.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005664"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005664"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005664"
FT                   /db_xref="GOA:Q5B3W8"
FT                   /db_xref="InterPro:IPR039965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3W8"
FT                   /protein_id="CBF76839.1"
FT                   /translation="MSSIAAMASRRAFARQALFRAPVRRAYSSKMEESTLDKAPKRDPE
FT                   LYVLLGVMSGAFLIAGWYFGKKPTSVTSESNVRIPDSSMPWERDDDGKIYKYQYHPGGD
FT                   KSQPLRNAPSALNTVIVPNVTLPVDLHERFNKYGKEEYDF"
FT   gene            complement(1073265..1076308)
FT                   /locus_tag="ANIA_04761"
FT                   /old_locus_tag="AN4761.4"
FT                   /product="protein mannosyltransferase 1 (AFU_orthologue;
FT                   AFUA_3G06450)"
FT   mRNA            complement(join(1073265..1073780,1073845..1073972,
FT                   1074024..1075308,1075367..1075650,1075703..1075992,
FT                   1076055..1076308))
FT                   /locus_tag="ANIA_04761"
FT                   /old_locus_tag="AN4761.4"
FT                   /note="transcript_id=CADANIAT00005665"
FT   CDS_pept        complement(join(1073265..1073780,1073845..1073972,
FT                   1074024..1075308,1075367..1075650,1075703..1075992,
FT                   1076055..1076308))
FT                   /locus_tag="ANIA_04761"
FT                   /old_locus_tag="AN4761.4"
FT                   /product="protein mannosyltransferase 1 (AFU_orthologue;
FT                   AFUA_3G06450)"
FT                   /note="transcript_id=CADANIAT00005665"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005665"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005665"
FT                   /db_xref="GOA:Q5B3W9"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3W9"
FT                   /protein_id="CBF76842.1"
FT                   /translation="MAKDTLDVRPPRTSSRSPSRSPRPKNRKKATAVASSYQSDGVTDN
FT                   NIFDLPMSDYKVMVLVTIVAAVVRLFRIYQPTSVVFDEVHFGGFATKYIKGRFFMDVHP
FT                   PLAKLLITLAGWLAGFKGDFDFKEIGKDYLEPGVPYVAMRMLPAILGVLTVPIMFLTLK
FT                   ATGCRTNTAVLGAGAILFENGLVTQSRFILLDSPLVFFTALTALSFTCFTNQQELGPSH
FT                   AFRGPWWFWLVATGFSLGATLSVKWVGLFTVAWVGSLTILQLWVVLGDTNNVTPRLWFK
FT                   HFFARVFCLIVIPLAFYCSMFAIHFRCLVNPGEGDGFMSSEFQATLNSKGMAAVPADVV
FT                   FGSRLSIRHHNTQGGYLHSHSHMYPTGSKQQQITLYPHKDDNNLFIAENQTQPLDANGA
FT                   EIPGPFAWDNLTTNYIEDGAVIRLHHLMTHRRVHSHNERPPVTDVDWQFEVSAYGYEGF
FT                   PGDANDYWRVEIVKSLSDGEEAKKRLRTIQSKFRLVHVMTGCVLFSHKVKLPDWGFDQQ
FT                   EVTCAKGASLPNSIWYIESNKHPMLPPDAEKVTYRNPGFFGKFFELQKVMWTTNAGLTD
FT                   SHAWDSRPPSWPTLLRGINFWGRDHRQVYLFGNPFVWYSSTLAVLVYVIFKGISLLRWQ
FT                   RNCGDYRNPAFKRFDYEIGTSVLGWGFHYFPFYLMARQLFLHHYFPALYFAILALAQEF
FT                   DFITNRIRSLGLTIFAFTVYSPLIYGNPWTRDACKQVKLLKSWDFDCNTFYTDLNQYVT
FT                   HFSSVNSAVPTTAASIPQSPAPVKAEPKQEQKEQKEAKVESQEPSITSSSIPKIRGTQA
FT                   RVEYRDQQGNILDEAVVDSLRKEGKISIETRHETRTRLEHGHLVDVVDGKVAPPHPDVE
FT                   GQNPETQDKPEEIVDDSPASAADAGSSVGEPNSPEPKPASEGNEATR"
FT   gene            1077125..1078838
FT                   /locus_tag="ANIA_04760"
FT                   /old_locus_tag="AN4760.4"
FT                   /product="pre-mRNA splicing factor, putative
FT                   (AFU_orthologue; AFUA_3G06440)"
FT   mRNA            join(1077125..1077218,1077292..1077327,1077394..1078838)
FT                   /locus_tag="ANIA_04760"
FT                   /old_locus_tag="AN4760.4"
FT                   /note="transcript_id=CADANIAT00005666"
FT   CDS_pept        join(1077125..1077218,1077292..1077327,1077394..1078838)
FT                   /locus_tag="ANIA_04760"
FT                   /old_locus_tag="AN4760.4"
FT                   /product="pre-mRNA splicing factor, putative
FT                   (AFU_orthologue; AFUA_3G06440)"
FT                   /note="transcript_id=CADANIAT00005666"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005666"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005666"
FT                   /db_xref="GOA:Q5B3X0"
FT                   /db_xref="InterPro:IPR000061"
FT                   /db_xref="InterPro:IPR022030"
FT                   /db_xref="InterPro:IPR035967"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3X0"
FT                   /protein_id="CBF76844.1"
FT                   /translation="MASMSNGNTPTVLDDATKPPAGVVLPPKDIRAGYVARNGAVFEDR
FT                   VREKERSNPKFSFLNSNDPYAPFYQWRLNEIKQGRGTDVSAGRPGEPTPTPAPEAPKGP
FT                   APPPDFHFSARMPIINAQDLEVVRLTALFVAKRGKSFMTALSQREARNFQFDFLRPQHS
FT                   LYQFFTRLVDQYTILLRPEGIDEATSQKKRIAELEQNVKNRFHVLERAKARAEWVKYQE
FT                   QQKQKKEEEEEKERIEYAQIDWHDFVVVETVLFTEADDQVDLPPPTSLNDLQSASLEQK
FT                   AMMSLNPLRIEEAMPTDMETPTYYNAYPAQPEPQPFAQPVGPVYSPQPPPQGIPTPPVA
FT                   ATAAAQEEEQRIRERMEAREQAAAVKAAPSQQPMRIRSDYVPRAQARRQNAAGAMALCP
FT                   NCKQQIPEAELQQHMRIEMLDPRWREQQAKAQARTATTNLSTADVVNNLKRLASQRSDV
FT                   FDSTAVQSAPNPEEEARKKRMAFEGPPGAGPMQQQPGPVGPMGGPPNPQNMNIEEQIRN
FT                   LHERYKQ"
FT   gene            complement(1079757..1081773)
FT                   /locus_tag="ANIA_04759"
FT                   /old_locus_tag="AN4759.4"
FT                   /product="GDP/GTP exchange factor Sec2p, putative
FT                   (AFU_orthologue; AFUA_3G06430)"
FT   mRNA            complement(join(1079757..1080950,1081007..1081622,
FT                   1081684..1081773))
FT                   /locus_tag="ANIA_04759"
FT                   /old_locus_tag="AN4759.4"
FT                   /note="transcript_id=CADANIAT00005667"
FT   CDS_pept        complement(join(1079757..1080950,1081007..1081622,
FT                   1081684..1081691))
FT                   /locus_tag="ANIA_04759"
FT                   /old_locus_tag="AN4759.4"
FT                   /product="GDP/GTP exchange factor Sec2p, putative
FT                   (AFU_orthologue; AFUA_3G06430)"
FT                   /note="transcript_id=CADANIAT00005667"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005667"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005667"
FT                   /db_xref="GOA:Q5B3X1"
FT                   /db_xref="InterPro:IPR009449"
FT                   /db_xref="InterPro:IPR040351"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3X1"
FT                   /protein_id="CBF76846.1"
FT                   /translation="MADLIAFHSYYSHQGFLSPSNMLPRPSSHKRSLSSGNRSASPDRH
FT                   VTKAKSTNDLLRVAADPPATVRSSSEGGDGFSTLRDPRLLPSSESTESTLSSSHHPDLN
FT                   DEVATLSLKLVQAINNQTKLDDTLAVTRQELEQVQEKARALESENEQYWRDIEDGALVK
FT                   KAEVDQLKASLAEEKAQRLLAEKEKKGIEQELETLTAALFEEANKMVAAAKLEREAVEK
FT                   KNEQLRSQIKDTESLLASHQEQLAELKSVLQVMNISKDDLDGRTAISTAPPSPAGPSQP
FT                   PAFTRKSMEATDIPGDVVCAEIAPGPATSFPDLIKTVCRTDILAYEDFRELFTISKSSK
FT                   PPSRATSGSYSGLNVMSLAGFGGAGFGSGSPSPSKSQPHSPSGSVSSPQPPNSSVPLKD
FT                   ARFYKRALVEDIEPTLRLDAAPGISWLTRRNVLSSICEGSLVVEPVPPNVRKYEFPCSL
FT                   CGERRSGTDNERTHRFRTSDSETAQRYPLCVLCLEKVRSCCEFAGYLRLILDGHIHAEE
FT                   PDELQEAWEETVRLRERMFWSRIGGGIVPTFAQTSAPEERSEGHQASIDSLIEKPVVQI
FT                   QPSDDIQDTAIGQEKLTATPRPLAADAMT"
FT   gene            1083180..1083795
FT                   /locus_tag="ANIA_04758"
FT                   /old_locus_tag="AN4758.4"
FT                   /product="dsDNA-binding protein PDCD5, putative
FT                   (AFU_orthologue; AFUA_3G06420)"
FT   mRNA            join(1083180..1083203,1083287..1083372,1083440..1083450,
FT                   1083485..1083795)
FT                   /locus_tag="ANIA_04758"
FT                   /old_locus_tag="AN4758.4"
FT                   /note="transcript_id=CADANIAT00005668"
FT   CDS_pept        join(1083180..1083203,1083287..1083372,1083440..1083450,
FT                   1083485..1083795)
FT                   /locus_tag="ANIA_04758"
FT                   /old_locus_tag="AN4758.4"
FT                   /product="dsDNA-binding protein PDCD5, putative
FT                   (AFU_orthologue; AFUA_3G06420)"
FT                   /note="transcript_id=CADANIAT00005668"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005668"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005668"
FT                   /db_xref="GOA:Q5B3X2"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="InterPro:IPR036883"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3X2"
FT                   /protein_id="CBF76848.1"
FT                   /translation="MADAELEEIRRARLAQLQQSGGPPRAPSEGNQDEQRKQVEAPTHT
FT                   TPTAERRATILNQILEPEAADRLGRIRLVKESRATDIENRLIMLAQTGQLRQKVTEEQL
FT                   KQLLNAVAENQRKDEEEQQKIVFSRRKGGWDDDDDLLDL"
FT   gene            complement(1083965..1085055)
FT                   /locus_tag="ANIA_04757"
FT                   /old_locus_tag="AN4757.4"
FT                   /product="Coenzyme Q (ubiquinone) biosynthesis protein
FT                   Coq4, putative (AFU_orthologue; AFUA_3G06410)"
FT   mRNA            complement(join(1083965..1084691,1084755..1085055))
FT                   /locus_tag="ANIA_04757"
FT                   /old_locus_tag="AN4757.4"
FT                   /note="transcript_id=CADANIAT00005669"
FT   CDS_pept        complement(join(1084042..1084691,1084755..1085055))
FT                   /locus_tag="ANIA_04757"
FT                   /old_locus_tag="AN4757.4"
FT                   /product="Coenzyme Q (ubiquinone) biosynthesis protein
FT                   Coq4, putative (AFU_orthologue; AFUA_3G06410)"
FT                   /note="transcript_id=CADANIAT00005669"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005669"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005669"
FT                   /db_xref="GOA:Q5B3X3"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="InterPro:IPR027540"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3X3"
FT                   /protein_id="CBF76850.1"
FT                   /translation="MTTCAPLFLRITPPPNAVNIEQCLFRRLNCNMSHLRKLRAAAPSV
FT                   REVALWSRQSPYSRSFSSHNRPSPKYPHHVPLGFFEKGFLAVGSAVGALLNPRRADLIA
FT                   TLGEVTATPYFIYRLRDAMLQDPTGRQILRDRPRITSQTLPLPYLRSLPENSVGRTYAT
FT                   WLDREGVSPDTRDNVQYIDDPECAYVMQRYRECHDFYHAVTGLPTFVEGELALKAFEFL
FT                   NTLIPMTGLSMAASVRLKPAERERLFSLYLPWAVRSGLNSKELINVYWEKILEKDVDEL
FT                   RAELGIEKPPDMRDIRRMIRLQQKREREQQQGKSS"
FT   gene            1085402..1086783
FT                   /locus_tag="ANIA_10583"
FT                   /old_locus_tag="AN10583.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1085402..1085425,1085479..1086015,1086064..1086118,
FT                   1086347..1086404,1086468..1086783)
FT                   /locus_tag="ANIA_10583"
FT                   /old_locus_tag="AN10583.4"
FT                   /note="transcript_id=CADANIAT00005670"
FT   CDS_pept        join(1085402..1085425,1085479..1086015,1086064..1086118,
FT                   1086347..1086404,1086468..1086783)
FT                   /locus_tag="ANIA_10583"
FT                   /old_locus_tag="AN10583.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005670"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005670"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005670"
FT                   /db_xref="GOA:C8VAR6"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAR6"
FT                   /protein_id="CBF76852.1"
FT                   /translation="MMAMRSIQENEVIVRVPRHLMLTVDTIPSSFVTKFEEGVPVHAIL
FT                   AAFLCHGEPEDLEPYELWTKTWPTRKDFEHCMPILWPDFLRASLPPSVSGSWKSVRKAK
FT                   LEFEYESSHQNILAQQEQRLRNAWESVVAVFPETDWETLSYYWLIVNTRSFFYLMPGQE
FT                   PPEDRNDAMALLPFADYFNHSDVACNVKFDGQEYVFRASKTFILRELSSSQQEELYLQQ
FT                   YLGNYQVMDTGVCYRTEVAACIMYMRPEDWQNYVLGYSTRGVDAKKSEDVIKGWIRAYM
FT                   EEADLTIRELENIRSSMERRHQGKAQMLLKRWRQIKELCSIALKTVLC"
FT   gene            complement(1086755..1088175)
FT                   /locus_tag="ANIA_10586"
FT                   /old_locus_tag="AN10586.4"
FT                   /product="2-dehydropantoate 2-reductase, putative
FT                   (AFU_orthologue; AFUA_3G06390)"
FT   mRNA            complement(join(1086755..1087689,1087771..1088175))
FT                   /locus_tag="ANIA_10586"
FT                   /old_locus_tag="AN10586.4"
FT                   /note="transcript_id=CADANIAT00005671"
FT   CDS_pept        complement(join(1086820..1087689,1087771..1088175))
FT                   /locus_tag="ANIA_10586"
FT                   /old_locus_tag="AN10586.4"
FT                   /product="2-dehydropantoate 2-reductase, putative
FT                   (AFU_orthologue; AFUA_3G06390)"
FT                   /note="transcript_id=CADANIAT00005671"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005671"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005671"
FT                   /db_xref="GOA:C8VAR7"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAR7"
FT                   /protein_id="CBF76854.1"
FT                   /translation="MFGARPLLRAAASELCGFRGPVSTQVLIKRPASTWTQDVDEIARE
FT                   SGQSRLSGRIHILGVGNIGTFVAHSLASRPSPPPITLLMHNPEVYQTFQKRKQTLAINS
FT                   LGLDDNKTGFDVNVFSDGTWRSVPYVNTKEEQIECLVVSVKAPATVSALESVRHRLTPK
FT                   STVLFIQNGMGIIDAVNERVFPDPGQRPHYMLGIISHGLAQRSGRFHVTHTGVGTTILG
FT                   PVPSQNSGRSSSLDKASDWAPSTKYLLRTLTLTPPLVAVAEPPSSIMLYQLEKLAMNSV
FT                   INPLTALMDCRNGELLYNYSFTRVMRLLLLEISNVICSLPELQGIPGVESRFSPERLRW
FT                   MVTQLASKTAKNHSSMLQDIRANRTTEIEFLNGYIVRKGEELGIKCVVNYTMKHLVLAK
FT                   QRESRRQESSMIPIDIPDEPRDSKL"
FT   gene            1088481..1089312
FT                   /locus_tag="ANIA_10590"
FT                   /old_locus_tag="AN10590.4"
FT                   /product="exosome-associated family protein
FT                   (AFU_orthologue; AFUA_3G06380)"
FT   mRNA            join(1088481..1088661,1088709..1088875,1088929..1089312)
FT                   /locus_tag="ANIA_10590"
FT                   /old_locus_tag="AN10590.4"
FT                   /note="transcript_id=CADANIAT00005672"
FT   CDS_pept        join(1088481..1088661,1088709..1088875,1088929..1089312)
FT                   /locus_tag="ANIA_10590"
FT                   /old_locus_tag="AN10590.4"
FT                   /product="exosome-associated family protein
FT                   (AFU_orthologue; AFUA_3G06380)"
FT                   /note="transcript_id=CADANIAT00005672"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005672"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005672"
FT                   /db_xref="GOA:C8VAR8"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="InterPro:IPR011082"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAR8"
FT                   /protein_id="CBF76856.1"
FT                   /translation="MESADLIPLLERLDDDVDDLEEAIAPILQSTVVETSKKLPVLDKA
FT                   KFHVMTAYALESLVFSYLRLHGVKATEHPVYRELKRVKQYFDKIKALETEPEQRTMVLD
FT                   KQAAGRFIKHGLAGNEKLDLQREEQLAKEKARAQLKASLLAKKAGDTTEEPPKDVSSES
FT                   EIDTDPTSDIASDAKGADLLQEVQSSEAPGASSKKTKKNKAKSSAKDERRKKRRGKEEF
FT                   KDHNKQRRKKKDDTRKARKAT"
FT   gene            1090003..1090939
FT                   /locus_tag="ANIA_04755"
FT                   /old_locus_tag="AN4755.4"
FT                   /product="CHCH domain protein (AFU_orthologue;
FT                   AFUA_3G06370)"
FT   mRNA            join(1090003..1090250,1090378..1090633,1090706..1090939)
FT                   /locus_tag="ANIA_04755"
FT                   /old_locus_tag="AN4755.4"
FT                   /note="transcript_id=CADANIAT00005673"
FT   CDS_pept        join(1090027..1090250,1090378..1090633,1090706..1090738)
FT                   /locus_tag="ANIA_04755"
FT                   /old_locus_tag="AN4755.4"
FT                   /product="CHCH domain protein (AFU_orthologue;
FT                   AFUA_3G06370)"
FT                   /note="transcript_id=CADANIAT00005673"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005673"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005673"
FT                   /db_xref="GOA:Q5B3X5"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="InterPro:IPR018648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3X5"
FT                   /protein_id="CBF76858.1"
FT                   /translation="MPRQRRGAAPTPARSAPTRPTAAPAQPAHSPYGQQHQPHSTAAHP
FT                   PTATQAPAAPAPVQQSSGPGLFGQMASTAAGVAVGSSIGHAIGGLFSGGGSSAPAEAQQ
FT                   APPAQAQPMDNGLWQGSATNSSWENPACATDVQNFRKCMDENQGNMSICGWYLDQLKAC
FT                   QAAAKPY"
FT   gene            complement(1090847..1092605)
FT                   /locus_tag="ANIA_04754"
FT                   /old_locus_tag="AN4754.4"
FT                   /product="UBX domain protein (AFU_orthologue;
FT                   AFUA_3G06360)"
FT   mRNA            complement(join(1090847..1091032,1091108..1092161,
FT                   1092229..1092350,1092414..1092466,1092527..1092605))
FT                   /locus_tag="ANIA_04754"
FT                   /old_locus_tag="AN4754.4"
FT                   /note="transcript_id=CADANIAT00005674"
FT   CDS_pept        complement(join(1090997..1091032,1091108..1092161,
FT                   1092229..1092350,1092414..1092466,1092527..1092605))
FT                   /locus_tag="ANIA_04754"
FT                   /old_locus_tag="AN4754.4"
FT                   /product="UBX domain protein (AFU_orthologue;
FT                   AFUA_3G06360)"
FT                   /note="transcript_id=CADANIAT00005674"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005674"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005674"
FT                   /db_xref="GOA:C8VAS0"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAS0"
FT                   /protein_id="CBF76860.1"
FT                   /translation="MFFTGTLQEGITLAVQESKAVVCFVPDNGETSSTWQEEYFQGDEE
FT                   FTRLLGSQSVLLRIAKDSQEAGFLASVCPISKYPTVVIIRNGMLREYIVPDISKEGFRN
FT                   RVMAAIADSKPQSQTISSSVPQQSAQQAQELSSPAARAPQTVTTAPTPAVDTTRASITQ
FT                   GQSSQNVSTRSSGGRANDITYSSGSRMYSATVPRKQEREYDTPQSSNKAKETTEQKNDD
FT                   MKGKAPIRTNKDEKSKNQKSAAASPAPHSTSVPVPPSQYRLQVRLFDGSSVRSTFSPLH
FT                   TIRSDVRPWLDNQLEEKRPYNLKLIMTPLPNKTLTIAEEDQTLSELISGSTATFVMVPI
FT                   KAYTEAYSDSGSLPVRAVSSAYGLVTSVVGGAVGYIGSFIGYSPNRASSSESAPPQSRE
FT                   FQASADATRRPRQWGANIRTLGDQRDGQNSQFYNGNQLNFEPRQGDDR"
FT   gene            1092773..1094198
FT                   /locus_tag="ANIA_04753"
FT                   /old_locus_tag="AN4753.4"
FT                   /product="COX1 assembly protein Shy1, putative
FT                   (AFU_orthologue; AFUA_3G06340)"
FT   mRNA            join(1092773..1093099,1093164..1093679,1093732..1093837,
FT                   1093903..1094198)
FT                   /locus_tag="ANIA_04753"
FT                   /old_locus_tag="AN4753.4"
FT                   /note="transcript_id=CADANIAT00005675"
FT   CDS_pept        join(1092850..1093099,1093164..1093679,1093732..1093837,
FT                   1093903..1094005)
FT                   /locus_tag="ANIA_04753"
FT                   /old_locus_tag="AN4753.4"
FT                   /product="COX1 assembly protein Shy1, putative
FT                   (AFU_orthologue; AFUA_3G06340)"
FT                   /note="transcript_id=CADANIAT00005675"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005675"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005675"
FT                   /db_xref="GOA:C8VAS1"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAS1"
FT                   /protein_id="CBF76862.1"
FT                   /translation="MRPIFSVAERAVPRVWQHPISSTRIPRTLFKFDSICARCRRQQFQ
FT                   VRFFNGQMGDDPRWLSVVDHPAQIVRTGRKHGPGLIILALIPIISFALGTWQVQRLDWK
FT                   TKLIAKVEDQLVKDPLPLPPRIDPSVVSEFDYRRVYATGRLRHDQEMLIGPRMREGQDG
FT                   FIVVTPLERGKGESTVLINRGWISKKMMDQKDRDREALPTGEVTIEGMIREPWKKNMFT
FT                   PENQPEKGKFYFPDVEQMAGLTGSQPVWIEQTMVQDLLESMNREAKGIPIGRAAEVNLR
FT                   NNHSQYIFTWYGLSLATSIMLWMIVRKRPTSEAHRRVRQNINW"
FT   gene            complement(1094230..1095726)
FT                   /locus_tag="ANIA_04752"
FT                   /old_locus_tag="AN4752.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1094230..1094788,1094842..1095304,
FT                   1095359..1095599,1095652..1095726))
FT                   /locus_tag="ANIA_04752"
FT                   /old_locus_tag="AN4752.4"
FT                   /note="transcript_id=CADANIAT00005676"
FT   CDS_pept        complement(join(1094230..1094788,1094842..1095304,
FT                   1095359..1095599,1095652..1095726))
FT                   /locus_tag="ANIA_04752"
FT                   /old_locus_tag="AN4752.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005676"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005676"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005676"
FT                   /db_xref="GOA:Q5B3X8"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR035425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3X8"
FT                   /protein_id="CBF76864.1"
FT                   /translation="MPDSSNTRGAYEAAPPAAGDAAFTRISRIPVPARYPSTPGRKKVG
FT                   PTTPRSASQWGTPGNRGAPSTPYGVRAMQRRAANTPGRERRKSGRVQRETVFDVLRNLS
FT                   RALAPESQPIRSSPQPPPEPEPEPEIDEIDALDKEPDPERPRLSLPLEDVEEEDDDGSP
FT                   EIRPPRMSLALGDDDMLHDDITHDDMTHTSIEYPRRATLDRDRNRLSMVSAGGPRLSEN
FT                   FGDATGLESDSDVGGNTSVMPDGEQDETIISHGAFDRGGETEDLGRFNFDLNFPSPAAQ
FT                   PDDLDADEPINDDEGFELPAIDLESEHGPDADPGSDDDEVGGTTGGFGLELYSPERVSM
FT                   SESPGLVGGGLREEDTVVHGSKQKKLSRHGIPVPTLPAGVVKKLATRFARARAGPKAKI
FT                   SKSTLAAIEQASSWYLEQASEDLEAYSKHAGRKTIDEADVTALMRR"
FT   gene            1096057..1097121
FT                   /locus_tag="ANIA_04751"
FT                   /old_locus_tag="AN4751.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1096057..1096619,1096681..1096779,1096833..1096885,
FT                   1096940..1097121)
FT                   /locus_tag="ANIA_04751"
FT                   /old_locus_tag="AN4751.4"
FT                   /note="transcript_id=CADANIAT00005677"
FT   CDS_pept        join(1096057..1096619,1096681..1096779,1096833..1096885,
FT                   1096940..1097121)
FT                   /locus_tag="ANIA_04751"
FT                   /old_locus_tag="AN4751.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005677"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005677"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005677"
FT                   /db_xref="GOA:Q5B3X9"
FT                   /db_xref="InterPro:IPR032704"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3X9"
FT                   /protein_id="CBF76866.1"
FT                   /translation="MSGEANASTGLAAKIDKKRKREAEESSSSKQSKPNAQNQATGDGS
FT                   SEGPKNKKRKSGKGRKDKKDKNDKNDKPKAVRGEPLEKERKGISVNEAIGKMDGRLLAD
FT                   HFVQKAKRHNKELTAVELSDLSVPESAFLDTSSFTSSRNLEKLPDFLKAFSPKGVNLSD
FT                   SSEQKGTPHTIVVSPAGLRAADVVRALRMFQTKESPIGKLFAKHIKLEEAKQFLERARM
FT                   GIGAGTPARISDLINSGSLKLDELKRIVIDGSYVDQKQRGIFDMKETHLPLLQLLTRSE
FT                   LRERYGAKEKKIEILVF"
FT   gene            complement(1098485..1100041)
FT                   /locus_tag="ANIA_04750"
FT                   /old_locus_tag="AN4750.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1098485..1098579,1098711..1098746,
FT                   1098833..1099171,1099226..1099593,1099668..1099792,
FT                   1099844..1100041))
FT                   /locus_tag="ANIA_04750"
FT                   /old_locus_tag="AN4750.4"
FT                   /note="transcript_id=CADANIAT00005678"
FT   CDS_pept        complement(join(1098485..1098579,1098711..1098746,
FT                   1098833..1099171,1099226..1099593,1099668..1099792,
FT                   1099844..1099978))
FT                   /locus_tag="ANIA_04750"
FT                   /old_locus_tag="AN4750.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005678"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005678"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005678"
FT                   /db_xref="GOA:C8VAS4"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAS4"
FT                   /protein_id="CBF76868.1"
FT                   /translation="MATRTSNSDARPRSQSGQGPSSLVRGVIDSEAQKMRCSRSQQRKQ
FT                   KSNPRRSEVLQNTSSHEVEHPNRRLKGANDPKLSRRQRNMKNLMMLNRLETNIGRLETR
FT                   LLELGLDLDREGSVQSPRQLAVSDKPRSPSSLSIPGSENIVEEGLWRCGPCPEATLEDS
FT                   GVPRTFPSMDREDDVPQNPEVNKSPFLDDFNGLLIPRCIMGGPADRKIPVLSREGLQWM
FT                   NQKAGMTPRISSGIHSNATSFGILGDDFPKAFCPLPSKEEAESLLYQYLQNFNCLCPLF
FT                   EQAKLTSLFNEDNLNTALRVPSCWASVNVVFALGIAFRVKDTRSVVYPGAPRDDRSWEV
FT                   ERGHYTILRRYATSEKNILDCVLAR"
FT   gene            1101024..1105961
FT                   /locus_tag="ANIA_04749"
FT                   /old_locus_tag="AN4749.4"
FT                   /product="ABC transporter protein
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9P884]"
FT   mRNA            join(1101024..1101868,1101936..1105961)
FT                   /locus_tag="ANIA_04749"
FT                   /old_locus_tag="AN4749.4"
FT                   /note="transcript_id=CADANIAT00005679"
FT   CDS_pept        join(1101181..1101868,1101936..1105744)
FT                   /locus_tag="ANIA_04749"
FT                   /old_locus_tag="AN4749.4"
FT                   /product="ABC transporter protein
FT                   [Source:UniProtKB/TrEMBL;Acc:Q9P884]"
FT                   /note="transcript_id=CADANIAT00005679"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005679"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005679"
FT                   /db_xref="GOA:C8VAS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029481"
FT                   /db_xref="InterPro:IPR034001"
FT                   /db_xref="InterPro:IPR034003"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAS5"
FT                   /protein_id="CBF76870.1"
FT                   /translation="MSFLGSISPNLPRSQSVVSHNLPQAHGLDENDDIYHNHSTTAQPG
FT                   ASEKDKSEDGETLHENEPDGEARVTLLARQLTRHSTRLTAKSTLENPFFLDDSDSTLNP
FT                   NSPNFRVRDWMKMLLEIRSRDPERYPDRTAGIAFKNLSVHGFGSPTDYQKDVMNVLLEI
FT                   GTIARRLAGMKMPKIQILRDFEGLVRSGEMLVVLGRPGSGCSTFLKTIAGEMNGIQVSD
FT                   DAVLNYQGISSKNMQNSFRGEAIYTAENDIHFPQLSVGDTLMFSALARAPRNRLEGVSR
FT                   KQYAEHMRDVVMAMLGLSHTINTRVGNDFIRGVSGGERKRVSIAEATLSQAPLQCWDNS
FT                   TRGLDSANALEFCKNLALMSKYTGSTACVAIYQASQSAYDVFDKVTVLYEGRQIYFGNT
FT                   KDAKKFFVDMGFECPERQTTADFLTSLTSPAERLVRPGYEGRVPCTPDEFAAAWKRSEE
FT                   RAKLMAEIEEYERQYPIGGPSYDAFVDARKAMQSKRQRVNSPYTISIWQQVSLCVVRGF
FT                   QRLRGDFSLTTTSLIGNFMMALIIGSVFFDLPDDTSSFYYRGALLFFAVLLNAFSSALE
FT                   ILTLYSQRPIVEKQSRYAFYHPFAEAVASMICDTPYKLINSFTFNVPLYLMTNLRRDAA
FT                   AFFTFWIFSVVTTFTMSMIFRTIASTSRSLSQALVPAAMLILGMVIYTGFTIPTQNMLG
FT                   WSRWMNYINPIAYSFESFMVNEFDGRQFECVSIIPSGDEYNNVSMQYRICSTVGAESGS
FT                   RIVDGGQYLELSYQYTKSHLWRNMGILIGFMVFFAFTYLLGTEYISEQKAKGEVLLFRR
FT                   GRQPDLSTTEADPENPIQPSNAPKTEESAPQNTARIQRQTAIFHWEDVCYDIKIKGQPR
FT                   RILDNVDGWVKPGTCTALMGVSGAGKTTLLDVLATRVTMGVVSGSMLVDGRLRDQSFQR
FT                   KTGYVQQQDLHLATSTVREALRFSAILRQPAHLSRQEKLDYVEEVIKLLGMEAYADAIV
FT                   GVPGQGLNVEQRKRLTIGVELAAKPQLLLFLDEPTSGLDSQTSWSILDLIDTLTQHGQA
FT                   ILCTIHQPSAMLFQRFDRLLLLASGGKTIYFGEIGPNSSTLSNYFVRNGSHGLPPGDNP
FT                   AEWMLEVIGAAPGSNTEIDWVKTWRESPEYAKVREHLAELRATLSAKPADSSDPSALSE
FT                   FAAPFSVQLWECLVRVFAQYYRTPTYIWSKAALCALTALYIGFSFFNAPTSIQGLQNQM
FT                   FSVFMLMTIFGNLVQQIMPNFVTQRSLYEARERPSKAYSWKAFMAANIIVELPWNSLMA
FT                   ALIFFCWYYPIGLYNNAKPTDAVTERGGLMFLLIWTFLLFTSTFAHMIIAGIELAETGG
FT                   NVAQLLFSLCLIFCGVLSTPDAMPGFWIFMYRVSPFTYLVSAMLSTGLSGTDVECEPVE
FT                   YLTFAPPNNQTCGDYMRAYIDEVQSGYLLDPSATDQCSFCSMDKTDTFLLSVGSTFDEA
FT                   WRNFGLMWAYILFNIVGAVFIYWLARVPKGKKMAGTA"
FT   gene            1106630..1107910
FT                   /locus_tag="ANIA_04748"
FT                   /old_locus_tag="AN4748.4"
FT                   /product="RNA binding protein (AFU_orthologue;
FT                   AFUA_3G06310)"
FT   mRNA            join(1106630..1107230,1107301..1107529,1107598..1107910)
FT                   /locus_tag="ANIA_04748"
FT                   /old_locus_tag="AN4748.4"
FT                   /note="transcript_id=CADANIAT00005680"
FT   CDS_pept        join(1106630..1107230,1107301..1107529,1107598..1107787)
FT                   /locus_tag="ANIA_04748"
FT                   /old_locus_tag="AN4748.4"
FT                   /product="RNA binding protein (AFU_orthologue;
FT                   AFUA_3G06310)"
FT                   /note="transcript_id=CADANIAT00005680"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005680"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005680"
FT                   /db_xref="GOA:Q5B3Y2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Y2"
FT                   /protein_id="CBF76872.1"
FT                   /translation="MAEKKRKLENPPEDVAATEPEGKKAKRESKKEGKKDKKDKKDKKD
FT                   KKRKVQDVDVVSIEDKETELKEKKDKKEKRDKKDKGDKKEKKEKQEPKEKKSKDGLADD
FT                   EEQPTAKANGAEPEPEISKDAPDAMDIDGEEEVKETSGKEKKKKKGKKAKKAKSQEEQE
FT                   QTGEQGNPQSEEKEKAEQGSKQTVAPKQKAARFIVFVGNLPYSANTESLSAHFEKIQPI
FT                   SVRVATQPDKPTKCRGFGFVEFDNYDRMKTCLKLYHHSSFDDGKYPPRRINVELTAGGG
FT                   GKSEHRKAKIEYKNQKLAEERKRQAKETKTEKVNKAKAEEKPNDDYANIHPSRRPRMA"
FT   gene            complement(1108101..1108947)
FT                   /locus_tag="ANIA_04747"
FT                   /old_locus_tag="AN4747.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1108101..1108346,1108399..1108546,
FT                   1108616..1108671,1108762..1108947))
FT                   /locus_tag="ANIA_04747"
FT                   /old_locus_tag="AN4747.4"
FT                   /note="transcript_id=CADANIAT00005681"
FT   CDS_pept        complement(join(1108101..1108346,1108399..1108546,
FT                   1108616..1108671,1108762..1108947))
FT                   /locus_tag="ANIA_04747"
FT                   /old_locus_tag="AN4747.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005681"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005681"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005681"
FT                   /db_xref="GOA:Q5B3Y3"
FT                   /db_xref="InterPro:IPR021100"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Y3"
FT                   /protein_id="CBF76874.1"
FT                   /translation="MSTAPAAWWGLRCAFTFLAELLRIRPGMGHEGWAAAIVGSVSQNW
FT                   DVERRFRVTEVALAIMWCCASAYLSYFFADCMMSRWLLNYTPPAVVIRLLTTNGLIAYM
FT                   TSWVLYLSGASSDPRLLLPAWISITTTLTFLYHATQNHATIKRETAASLLVVSVASFVS
FT                   MSSLLLQLHLTRENEPEVPLFVLTRKIWDFAVAVVQRMRVANDHVGEL"
FT   gene            1109430..1111129
FT                   /locus_tag="ANIA_04746"
FT                   /old_locus_tag="AN4746.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1109430..1110043,1110123..1110215,1110277..1111129)
FT                   /locus_tag="ANIA_04746"
FT                   /old_locus_tag="AN4746.4"
FT                   /note="transcript_id=CADANIAT00005682"
FT   CDS_pept        join(1109430..1110043,1110123..1110215,1110277..1110766)
FT                   /locus_tag="ANIA_04746"
FT                   /old_locus_tag="AN4746.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005682"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005682"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005682"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Y4"
FT                   /protein_id="CBF76876.1"
FT                   /translation="MLIVDYPAAIKTAEKNRHKNSEFDGVNADRQRLRKACEIKRESNL
FT                   ADNIRSLTLDSHVSLLSLRQKIAATFHKFEHPVVSEPSLAMASSISNAPLLSAARTRSA
FT                   ILSSYPSVASSQCRQFSLSSQRNREMRGMPQTLSVKQPAQPSMRVRGQGMSRADLPQDI
FT                   GLLPGTFIKPLWRDMPSIFQQPKERLHYEWLWLKSWFQNFLGKTDGRGLPLRLKERRQV
FT                   AREMHQRMYSAFAKGDSATLRNICCTGLANNLIGRIEARRKGEKVTWSLDKYIRSPSTW
FT                   FTGMRVVSDRATQIPELPDSGVRQVVLRITSRQSTGKVKPQIPGVAVSAENAVKQQDCT
FT                   EYIVLQKLRWMGEEESWRIWGHATPTSVDDLSSPFFATGMSFADRYEAMKDAAMGLRK"
FT   gene            complement(1111208..1113810)
FT                   /locus_tag="ANIA_04745"
FT                   /old_locus_tag="AN4745.4"
FT                   /product="hypothetical protein similar to Rho GTPase
FT                   activating protein (Eurofung)"
FT   mRNA            complement(join(1111208..1111475,1111525..1111595,
FT                   1111650..1111744,1111800..1111943,1111996..1112521,
FT                   1112571..1112776,1112828..1113434,1113508..1113561,
FT                   1113628..1113810))
FT                   /locus_tag="ANIA_04745"
FT                   /old_locus_tag="AN4745.4"
FT                   /note="transcript_id=CADANIAT00005683"
FT   CDS_pept        complement(join(1111364..1111475,1111525..1111595,
FT                   1111650..1111744,1111800..1111943,1111996..1112521,
FT                   1112571..1112776,1112828..1113434,1113508..1113561,
FT                   1113628..1113810))
FT                   /locus_tag="ANIA_04745"
FT                   /old_locus_tag="AN4745.4"
FT                   /product="hypothetical protein similar to Rho GTPase
FT                   activating protein (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005683"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005683"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005683"
FT                   /db_xref="GOA:Q5B3Y5"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR031160"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Y5"
FT                   /protein_id="CBF76878.1"
FT                   /translation="MADPTLHDGPAPNTPSSGDQGVPPLSAGSGAPSASGLEARAGAPV
FT                   VSEELKARLDKVIYSDIGVATLLTRLKQSIASARDFASFLKKRSILEEEHAQGLRKVSR
FT                   ALYDAAHKSENRQGTYSYGCVEINGFHDRMADHGLQFAASLQQMADNLNELAGNIERGR
FT                   KQWKHEGLSAEKRVLEAEALAEKAKSKYDTLAEQYDRVKTGEKAGGKFGFKGTKSVAQQ
FT                   EEDLLRKVQSADSDYKAKVQAAQTARQELISTHRPQAVHNIQQLISECDSGLALQMQKF
FT                   GTFNEKLLLGQGLSISPLKEPGEGAAAPKSLREVIQQIDNQKDYHDYILSHEFNPGAVT
FT                   SEQIQYHRHPTLGGPTAPPVSSPQSTQTKRQSVVVPQPVYQPPTSTQAPQIPIQIPSSG
FT                   PLESPQSAPYPQNPDVFAPPPFQPPYPTASGPPPEPQPLNQPQPPAPKEPYPAPGSGYL
FT                   PNLNLPPLKPVFGVSLNELYARDGTAVPMIVYQCFQAVELFGLDVEGIYRLSGSATHIS
FT                   QMKALFDNDSSQVDFTNPESFNHDVNSVAGLLKQFFRDLPDPLFTSQAYSSFIDAARID
FT                   DDIQRRDSLHAIINGLPDAHYATLRALILHLNKVQEHYTQNRMNAGNIAICFGPTLMGA
FT                   SSGGNIADAGWQVRVIETILENTFQIFDDD"
FT   gene            1114181..1116867
FT                   /locus_tag="ANIA_04744"
FT                   /old_locus_tag="AN4744.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(1114181..1114649,1114812..1114918,1114978..1115125,
FT                   1115168..1115286,1115538..1115783,1115832..1116097,
FT                   1116215..1116867)
FT                   /locus_tag="ANIA_04744"
FT                   /old_locus_tag="AN4744.4"
FT                   /note="transcript_id=CADANIAT00005684"
FT   CDS_pept        join(1114410..1114649,1114812..1114918,1114978..1115125,
FT                   1115168..1115286,1115538..1115783,1115832..1116097,
FT                   1116215..1116867)
FT                   /locus_tag="ANIA_04744"
FT                   /old_locus_tag="AN4744.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005684"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005684"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005684"
FT                   /db_xref="GOA:Q5B3Y6"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Y6"
FT                   /protein_id="CBF76880.1"
FT                   /translation="MDLEYRGILAQNGYPPHASLTAPPGSPSDLRNNPRLPRPLTGFDF
FT                   SVRSSEPGDMEKTPPVTGKRRGGCRKACNECKQQKLRCDIVQTPADACSRCRRLNIECK
FT                   VEPSFKRISKRKRNAEMEREIAALRQRLSSEGSHAHVPENRASTKVSQSPEGICYGPDT
FT                   ANTLATPLTMHSEGSMLSQDDGVWRLEDVSLSRQRVARLFDHVPQDYRVVKALCLLCTW
FT                   PLPTTSQRTDATFMLCGLMMQISMQLGLHRPVQAEEFTTFRMEGHGEAVKDRLQTWVIC
FT                   NIVAQNVATGYGQPPGTIYDWALEPASLRDADYHPSEDLRTRLLIEKFCDRVTKSLYSS
FT                   RPDPAEFISSEKLLIAQLLENELREMELGFGRDISCSNARSDDLTKLFIATTSFLGRVL
FT                   DLETSPGELIGHATNYILQMIVSAAFALMKLLKSDFRRHIDFEHGKLLFNGAISALRRI
FT                   SVMDHDRPVRLADILAQMWNAGTPEDAGEDTLLLKVRCRMSMSHVYDTVWRWRHRFRPL
FT                   KSTEDTQAAASNPNVSTATIPRPSDGSLEDPDLMYSPNFDQDGAFFNEAGFSEVFDSLN
FT                   WVFDGFPDTFPAPPAI"
FT   gene            1117722..1119331
FT                   /locus_tag="ANIA_04743"
FT                   /old_locus_tag="AN4743.4"
FT                   /product="RacA (Eurofung)"
FT   mRNA            join(1117722..1118085,1118153..1118185,1118248..1118306,
FT                   1118370..1118550,1118625..1118857,1118917..1119331)
FT                   /locus_tag="ANIA_04743"
FT                   /old_locus_tag="AN4743.4"
FT                   /note="transcript_id=CADANIAT00005685"
FT   CDS_pept        join(1118053..1118085,1118153..1118185,1118248..1118306,
FT                   1118370..1118550,1118625..1118857,1118917..1118977)
FT                   /locus_tag="ANIA_04743"
FT                   /old_locus_tag="AN4743.4"
FT                   /product="RacA (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005685"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005685"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005685"
FT                   /db_xref="GOA:Q5B3Y7"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Y7"
FT                   /protein_id="CBF76882.1"
FT                   /translation="MATGPATQSLKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDN
FT                   YTASVMVDGRPISLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSIVSPPSFDNVKSKWF
FT                   PEIEHHAPNVPIILVGTKLDLRDDPAQLESLRMRKQEPVTYEQALAVAKEIRAHKYLEC
FT                   SALTQRNLKSVFDEAIRAVLNPRPATKQRNKKCTIL"
FT   gene            complement(1119588..1120747)
FT                   /locus_tag="ANIA_04742"
FT                   /old_locus_tag="AN4742.4"
FT                   /product="translation initiation factor SUI1, putative
FT                   (AFU_orthologue; AFUA_3G06260)"
FT   mRNA            complement(join(1119588..1120070,1120126..1120218,
FT                   1120298..1120372,1120603..1120747))
FT                   /locus_tag="ANIA_04742"
FT                   /old_locus_tag="AN4742.4"
FT                   /note="transcript_id=CADANIAT00005686"
FT   CDS_pept        complement(join(1119922..1120070,1120126..1120218,
FT                   1120298..1120372,1120603..1120630))
FT                   /locus_tag="ANIA_04742"
FT                   /old_locus_tag="AN4742.4"
FT                   /product="translation initiation factor SUI1, putative
FT                   (AFU_orthologue; AFUA_3G06260)"
FT                   /note="transcript_id=CADANIAT00005686"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005686"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005686"
FT                   /db_xref="GOA:C8VAT2"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005874"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAT2"
FT                   /protein_id="CBF76884.1"
FT                   /translation="MSIENLKTFDPFAEADEDTGETKQSQNYIHIRIQQRNGRKTLTTV
FT                   QGLPKKFDQKKILKVIKKKFACNGTIVNDTEMGEVIQLQGDQRKDVQEFLTDKKEGLEL
FT                   DAKTIKVHGF"
FT   gene            1124357..1129564
FT                   /locus_tag="ANIA_04741"
FT                   /old_locus_tag="AN4741.4"
FT                   /product="RNA polymerase II mediator complex component
FT                   Srb8, putative (AFU_orthologue; AFUA_3G06250)"
FT   mRNA            join(1124357..1124972,1125037..1125634,1125679..1125818,
FT                   1126237..1126344,1126444..1126577,1126632..1126930,
FT                   1127013..1127847,1127902..1128196,1128251..1128477,
FT                   1128530..1129564)
FT                   /locus_tag="ANIA_04741"
FT                   /old_locus_tag="AN4741.4"
FT                   /note="transcript_id=CADANIAT00005687"
FT   CDS_pept        join(1124357..1124972,1125037..1125634,1125679..1125818,
FT                   1126237..1126344,1126444..1126577,1126632..1126930,
FT                   1127013..1127847,1127902..1128196,1128251..1128477,
FT                   1128530..1129564)
FT                   /locus_tag="ANIA_04741"
FT                   /old_locus_tag="AN4741.4"
FT                   /product="RNA polymerase II mediator complex component
FT                   Srb8, putative (AFU_orthologue; AFUA_3G06250)"
FT                   /note="transcript_id=CADANIAT00005687"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005687"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005687"
FT                   /db_xref="GOA:Q5B3Y9"
FT                   /db_xref="InterPro:IPR019035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B3Y9"
FT                   /protein_id="CBF76885.1"
FT                   /translation="MIPNSSAGGQSWGHPLRNVDNDTARGDTSQAFNRPDIRSEGQQYT
FT                   PALPRHPGQPAVIDLTSSANDAQEGQPPAKRLKLDITAESSANPASPTPATTGDSRVTP
FT                   GIANSKPSALSWRGRPVWSFQAMISEVMSGAEATEEDAILAPQGKRPASPPPFPQPSWK
FT                   GAPPEQFGSNATKASESDSSKKVQTTPFRVEVPSIAPALKGDKVADFAPWIGNHPEDIL
FT                   SEQTVKQGHYDRTQVSQNESNTARPSLYAQLKHRSGLQMLSSVFMAALEKRQNHNTINV
FT                   PSNFKPPPRVTLTDNKREAWLRDLANPSVPLRRLSRTIPHGIRGKNLLDQCLSKWIPVN
FT                   RAVWLVKCVGANEIRACKRKGTGGTLVVGSEVKWVRDWTSGVQQFLEGVIGACGSADWK
FT                   SKMTYATSLTARLFFERLLDHDQYFAWFLTSLEGASLNMVPVWLLMLGIYWDNIASTSV
FT                   ACLNALEDRQTLVIKLLEWSATSFRSGLHPQLDMDNVYHIISELVRSQTFSVSRYLQWL
FT                   MAKGVARKSSGTSGEVLAADARLLTQLPMSRSPEHVRNLRLTLLARAGVSVDEESSTIK
FT                   CLKSSISQRLPNIFEVEASNSKHINFSKHDLTWAVKSEVSMWIRQGVVKHLKDTTRISA
FT                   LTPGEFYCVREILERFGDCSILADVLKQAIECDDNIILASVSDTVNYHFDALSMIGATS
FT                   DLFRGLVGSYARLKRSGNLSLDFVFSLIELGLRLPDESGTVYLLRQDLARIESKSALAA
FT                   PSPLSDHIPTTFNEVDASFQERLEQLLSCGNGLDESTMGAIISSLTKILTDGGGAAKVS
FT                   AKDACRYLAYLRPFNPKYLDGMLVRYVYGLLKSSSRPTMSQVLSPLIGVGCVTIHSFVL
FT                   LVNKLSASAQTTGAIANPDSLRLDILELLLPQEESSADMVTYRFRLAQQEFLVKYPEET
FT                   LNIISDAIPLFDADFHDANLGSRRPDLPACTVVLLRTLLAQNSSLVLKYCMQKLDGHSS
FT                   FTTVLGKAVDILLGLDPEDEMEPSSQAERVILMNNDFSLPYCQLKLKLLFNAKAGNEVK
FT                   NHIVDVMFKAAVTDSRSKRSHWVGLVSLMDQEAARQIRERAEGCFFSVAMFDESMDDTS
FT                   LPSGASSLSSIESAKLYLNIIEKLAYSIPQAGVQSIPPLLVERLDLLLQKLIIMQINSN
FT                   SVAASSSGSTIVSKINFERALAFWFSALLRLIVLHRAAFNVPPASGSKVDSLREQTRLL
FT                   VSILCISLARLPENILRLFPAADYFPHTIQSHNFRPCPGILLQTHALDVAASLIDSFPD
FT                   EARHQCVRFLRERCPPFLKFQNDRRFLYLLGPMTDTTIPSSQLSASISSPAAGGSTPTP
FT                   IPSGTLSGGHSSQATQQMAALTGPFSGLSENTKLVADRLRIQNGGRINGPYPVRPWELL
FT                   EDAAPILGVNDTAVSLKLFDARRVRA"
FT   gene            1130864..1132685
FT                   /locus_tag="ANIA_04740"
FT                   /old_locus_tag="AN4740.4"
FT                   /product="hypothetical protein similar to
FT                   N-succinyl-5-aminoimidazole-4-carboxamide ribotide
FT                   synthetase (Eurofung)"
FT   mRNA            join(1130864..1130997,1131048..1131281,1131335..1131453,
FT                   1131499..1131962,1132243..1132453,1132620..1132685)
FT                   /locus_tag="ANIA_04740"
FT                   /old_locus_tag="AN4740.4"
FT                   /note="transcript_id=CADANIAT00005688"
FT   CDS_pept        join(1130910..1130997,1131048..1131281,1131335..1131453,
FT                   1131499..1131962,1132243..1132453,1132620..1132685)
FT                   /locus_tag="ANIA_04740"
FT                   /old_locus_tag="AN4740.4"
FT                   /product="hypothetical protein similar to
FT                   N-succinyl-5-aminoimidazole-4-carboxamide ribotide
FT                   synthetase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005688"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005688"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005688"
FT                   /db_xref="GOA:C8VAT4"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013857"
FT                   /db_xref="InterPro:IPR039131"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAT4"
FT                   /protein_id="CBF76887.1"
FT                   /translation="MFPTASRLAVKPSGFFKRSAEELSRLSRIAWNTEALSTPTKPYTL
FT                   LDFEDEASVASCKTMADRAVGGFSTASLDYIPADSSTNTPAHARFHGTISTKLPNNWRV
FT                   ERTGYAAFRNQDRGFWLFGRLYWDLDPYTYLALRVKSDGRRYTHRLYTRHHHVRNSESS
FT                   SYDPLSPYASPEAAESPELAEAKYPTGIPPALSDVPPPSTIMSSMSATTSGSTGWETIL
FT                   LPFNSFVRTNHGLVVEPQTSIIRQRVKSVGIGLTDRVEGPYDLRIHRIWATNGMSEAEI
FT                   EEERRICGTAALPVDEGVRTGLALKPFLHQPVSQELLIEALLSTADLVRIFWPEPRRVW
FT                   REHLVRQNDLVRLLVNAKLELRICDDHAPSKRRIPHLYPDGYSHHAPPAPPLY"
FT   gene            complement(1131770..1133224)
FT                   /locus_tag="ANIA_04739"
FT                   /old_locus_tag="AN4739.4"
FT                   /product="hypothetical protein similar to
FT                   N-succinyl-5-aminoimidazole-4-carboxamide ribotide
FT                   synthetase (Eurofung)"
FT   mRNA            complement(join(1131770..1132533,1132632..1133007,
FT                   1133075..1133224))
FT                   /locus_tag="ANIA_04739"
FT                   /old_locus_tag="AN4739.4"
FT                   /note="transcript_id=CADANIAT00005689"
FT   CDS_pept        complement(join(1132157..1132533,1132632..1133007,
FT                   1133075..1133224))
FT                   /locus_tag="ANIA_04739"
FT                   /old_locus_tag="AN4739.4"
FT                   /product="hypothetical protein similar to
FT                   N-succinyl-5-aminoimidazole-4-carboxamide ribotide
FT                   synthetase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005689"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005689"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005689"
FT                   /db_xref="GOA:Q5B3Z1"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Z1"
FT                   /protein_id="CBF76889.1"
FT                   /translation="METTLTTTDLQGSLPLIARGKVRDLYQVDDKTLLFVATDRISAYD
FT                   VIMENGIPQKGVLLTLCTRKWFEILTAALPSLRTHFITLDLPPQIPESLHPVLQNRAMQ
FT                   VRKLRILPIEAIVRGYITGSAWNEYKKTGTVHGIPIKEGLRESEAFPDGPIYTPSTKAE
FT                   QGEHDENIHPDKAVEIVGEPYASKIAELAVTLYKTAHAYALTRGVIIADTKFEFGVDEE
FT                   TNEVVLADEVLTPDSSRFWPKDSYEVGRGQQSFDKQFLRDWLVKEGLKGKSGVRMTDEI
FT                   AQKTSEKYREAWERITGGN"
FT   gene            complement(1133833..1135168)
FT                   /locus_tag="ANIA_04738"
FT                   /old_locus_tag="AN4738.4"
FT                   /product="polysaccharide export protein (CAP59), putative
FT                   (AFU_orthologue; AFUA_7G05020)"
FT   mRNA            complement(join(1133833..1134230,1134287..1134512,
FT                   1134569..1135168))
FT                   /locus_tag="ANIA_04738"
FT                   /old_locus_tag="AN4738.4"
FT                   /note="transcript_id=CADANIAT00005690"
FT   CDS_pept        complement(join(1133833..1134230,1134287..1134512,
FT                   1134569..1135168))
FT                   /locus_tag="ANIA_04738"
FT                   /old_locus_tag="AN4738.4"
FT                   /product="polysaccharide export protein (CAP59), putative
FT                   (AFU_orthologue; AFUA_7G05020)"
FT                   /note="transcript_id=CADANIAT00005690"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005690"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005690"
FT                   /db_xref="GOA:C8VAT6"
FT                   /db_xref="InterPro:IPR021047"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAT6"
FT                   /protein_id="CBF76891.1"
FT                   /translation="MRVLDACESLINGLSFLAVSAFRHTSRNHKLLRRRLLQLLLLTFV
FT                   LWSSADIFLVHRNFHKEQIHLDYRPPERQRIFIASALWDNERTISSQWNDAVIELANVF
FT                   GADNIFVSVYASGSNDGTGYALRKLDKALDEVGVQRTITIAEPSPDNEALKNPPADRRH
FT                   IATRARLRNLSLKPLYDLRDAGTFFDRILFLSDVDFTKEDVLSLLNTNYGTYTAACSFD
FT                   ILNLPTGPDALALRDADGHETVMQKWPVFRSARSREAIKFMLPVPVRSCWGDMVFMGTE
FT                   EIYSTRVYQFRGVPDGLADKHVVASESCLIHADSYISKRRGVYLNPFVRVGLNTPAYTA
FT                   IHQESHWLSTWEIFESLWENRLRRWFSSPFLKGWSLRRKFAKWKAENENNKERGDFCLT
FT                   HEVQATET"
FT   gene            complement(1135918..1137692)
FT                   /locus_tag="ANIA_10582"
FT                   /old_locus_tag="AN10582.4"
FT                   /product="FAD binding monooxygenase, putative (JCVI)"
FT   mRNA            complement(join(1135918..1137496,1137571..1137692))
FT                   /locus_tag="ANIA_10582"
FT                   /old_locus_tag="AN10582.4"
FT                   /note="transcript_id=CADANIAT00005691"
FT   CDS_pept        complement(join(1135918..1137496,1137571..1137692))
FT                   /locus_tag="ANIA_10582"
FT                   /old_locus_tag="AN10582.4"
FT                   /product="FAD binding monooxygenase, putative (JCVI)"
FT                   /note="transcript_id=CADANIAT00005691"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005691"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005691"
FT                   /db_xref="GOA:C8VAT7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAT7"
FT                   /protein_id="CBF76893.1"
FT                   /translation="MSDSRSPDTQPSASNCEVIEGLNLLNRGSINRMDWTKVQKISNIS
FT                   HPRYIYFLRPMTSNPDVLIIGAGPSGLVTALWLATHGISIRIIDKAKADVSTSRALAIQ
FT                   ARTLELYRQLDIAEEVVANGHKVRATNIWSEGTYRGHIPIGDIGTGLTPYPFIHIFSQD
FT                   QHERLLENRLASFGVHVERGLEFIGFTENDSSITARLKSTDHENDIETCEAAFIVGCDG
FT                   PHSTVRHAAGIDYDGATYSHTFFVADIEGAGPTFNGEAHVSFNESEFMLLFPYDDDHRA
FT                   RISGAIDDETAERKGTDISFEDIAPQIKRSFKMQIDKMNWFSTYRSHHRVAASFAKGRV
FT                   FLVGDAAHIHSPVGGQGMNTGIGDAINLAWKLSAVVKKQAGLSLLQSYETERRAFALQL
FT                   VSTTDKGFNAAISQSFLARTVRTHVVPYIAPLLAKIEYVRHYVFRRVSQIMLGYPHSSL
FT                   STGSAGYVHGGSRMPWAVAGDIDNFETLKSITWQVHVYGIAKSELTEWCQSRKIPLHVF
FT                   PWHGQYEAVGLMADAAYLIRPDTYVAVAEPSGDSQIFDQYCEDIGLRWV"
FT   gene            complement(1138006..1138942)
FT                   /locus_tag="ANIA_10585"
FT                   /old_locus_tag="AN10585.4"
FT                   /product="cytochrome c oxidase subunit VIa, putative
FT                   (AFU_orthologue; AFUA_3G06190)"
FT   mRNA            complement(join(1138006..1138288,1138447..1138610,
FT                   1138664..1138688,1138777..1138942))
FT                   /locus_tag="ANIA_10585"
FT                   /old_locus_tag="AN10585.4"
FT                   /note="transcript_id=CADANIAT00005692"
FT   CDS_pept        complement(join(1138239..1138288,1138447..1138610,
FT                   1138664..1138688,1138777..1138942))
FT                   /locus_tag="ANIA_10585"
FT                   /old_locus_tag="AN10585.4"
FT                   /product="cytochrome c oxidase subunit VIa, putative
FT                   (AFU_orthologue; AFUA_3G06190)"
FT                   /note="transcript_id=CADANIAT00005692"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005692"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005692"
FT                   /db_xref="GOA:C8VAT8"
FT                   /db_xref="InterPro:IPR001349"
FT                   /db_xref="InterPro:IPR036418"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAT8"
FT                   /protein_id="CBF76895.1"
FT                   /translation="MIAQRSVLRLAQRSTPVRSAIQRRFNSTDKLPSWAVDNEFNRERA
FT                   AVKHHAASTSSLWLKLSIFAVIPCLIGGGYNAYVQWNEHWEHWEHMPPLEERTEYPYQN
FT                   IRTKNFPWGDGDKVTGTPMSTTTTRTRPPK"
FT   gene            1139240..1141359
FT                   /locus_tag="ANIA_04736"
FT                   /old_locus_tag="AN4736.4"
FT                   /product="DNA lyase Apn2 (AFU_orthologue; AFUA_3G06180)"
FT   mRNA            join(1139240..1139283,1139353..1139356,1139405..1139450,
FT                   1139501..1139633,1139682..1140391,1140442..1141359)
FT                   /locus_tag="ANIA_04736"
FT                   /old_locus_tag="AN4736.4"
FT                   /note="transcript_id=CADANIAT00005693"
FT   CDS_pept        join(1139256..1139283,1139353..1139356,1139405..1139450,
FT                   1139501..1139633,1139682..1140391,1140442..1141359)
FT                   /locus_tag="ANIA_04736"
FT                   /old_locus_tag="AN4736.4"
FT                   /product="DNA lyase Apn2 (AFU_orthologue; AFUA_3G06180)"
FT                   /note="transcript_id=CADANIAT00005693"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005693"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005693"
FT                   /db_xref="GOA:C8VAT9"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAT9"
FT                   /protein_id="CBF76897.1"
FT                   /translation="MGFRITTWNGLNPFSYEPWRSTRTFESMFDILEADIVVVQETKIQ
FT                   RKDLRDDMVLVPGWDCYFSLPKVKKGYSGVAIYTRNATCAPIRAEEGLTGTLCPPNSLV
FT                   SFRDLPEDQQIGGYPTIEQLSKLKLDAETLDSEGRCVILEFPAFVLIGLYCPANRDESR
FT                   DAFRQNFLDLMDARVRNLVALGKRVFVTGDINISRGEIDAAHAAENIKKGVTTEDDFVS
FT                   APARRLFNQLLIDGKVVGDRDEGREQPVLFDICRSFHPKRKGMYTCWEQRINARPGNYG
FT                   SRIDYVLCSLDMKDWFFDSNIQEGLMGSDHCPVYAVFKDLIPLNDGQSHILDIMNPPGV
FT                   FKNGERQQNYTAKFLLPLSGRLIPEFDRRRSIKDMFMRKPSQPSPKTSSPQNLTACLSN
FT                   EESSMTARTATNTPKPSDADAPASVSNDTLQKGTVRKRPVGTEVPPVKRSKSASTQTGA
FT                   PTIGQSTLKGFFKPKCTLEPKDNMLSKDEGQGPAEFPFISSQQDVTEQTSKAALEPEKA
FT                   PTPMTPVLSKEDAGFIDPVASKQDWSKLFTKKPPPKCGEHGEECISLKTKKPGPNFGRT
FT                   FWICPRPLGPSGNKEKGTEWRCSTFIWANDWDSSTM"
FT   gene            complement(1142412..1145187)
FT                   /locus_tag="ANIA_04735"
FT                   /old_locus_tag="AN4735.4"
FT                   /product="anaphase-promoting complex subunit Apc5, putative
FT                   (AFU_orthologue; AFUA_3G06200)"
FT   mRNA            complement(join(1142412..1143154,1143262..1143361,
FT                   1143392..1143553,1143726..1144056,1144189..1144282,
FT                   1144330..1145187))
FT                   /locus_tag="ANIA_04735"
FT                   /old_locus_tag="AN4735.4"
FT                   /note="transcript_id=CADANIAT00005694"
FT   CDS_pept        complement(join(1142412..1143154,1143262..1143361,
FT                   1143392..1143553,1143726..1144056,1144189..1144282,
FT                   1144330..1145047))
FT                   /locus_tag="ANIA_04735"
FT                   /old_locus_tag="AN4735.4"
FT                   /product="anaphase-promoting complex subunit Apc5, putative
FT                   (AFU_orthologue; AFUA_3G06200)"
FT                   /note="transcript_id=CADANIAT00005694"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005694"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005694"
FT                   /db_xref="GOA:Q5B3Z5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR026000"
FT                   /db_xref="InterPro:IPR037679"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Z5"
FT                   /protein_id="CBF76899.1"
FT                   /translation="MSRYLTPSKVALLSLISIYTEGVVPNSSAIHVLSFVVSYLSPLGA
FT                   GDAPSSSDGWPAQYSVSIEDLEKALKVHPSSIPGRSIWDLFLRKIWSIDSCDALELFFT
FT                   EISTTLAKTREERIRERDAGLAPESGCMRLARCSPLGAFVRRAQLEFTRLQFHDSVKLW
FT                   KGFVKYRLPTYRAWARRNPSDEQVPVDINLLELGLDTSSHLAQVAYGNIEDNEEDDCYV
FT                   STKEVERLLEFQIGELQRFGGRVPEELKAQLKRIIASGVTLPDLIHYLSRDKGTYQYAL
FT                   LNLAILQADFGCYEEAVSAMQEAVSIARESHDMNCLNFCMSWLYHFGKAFPELITEVEN
FT                   TGMLGNEKEGLSFLKAKAKETEMWGLLSTTLLSEAKLELQNVLQPSTGYMFRANLAFTS
FT                   GITHLAWLSSETFRHCYRSSAPFEDHLKSTFRSCQLAAHIIKLAQQGRYNEASAQMADM
FT                   SLERFQSLKTVELPILSDDRESASQLLSQLRAIDLPDSDLSFLLSFITVEHLIRQADYA
FT                   QALELIEKTAQSIHQDNFDIQPQVKLLCLKARIFEKMGQPQRGFSLAMRAASIAYRSRL
FT                   LPGLWEAIVALGGVLLSLKEFEAVAKMVESIMPQVLETSDCDLAASAYSLLVDANMGIA
FT                   GRLWSEGKDNGPAKKEYMNRALGYLDSAYEQYEEIEDLRGQCEMMAKKATVMHLTGDSV
FT                   LANDYAAKYLDLRKQKTSSWI"
FT   gene            complement(1145577..1147427)
FT                   /gene="MAT2"
FT                   /locus_tag="ANIA_04734"
FT                   /old_locus_tag="AN4734.4"
FT                   /product="MAT2 proteinMating type HMG-box protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q7Z8M2]"
FT   mRNA            complement(join(1145577..1145827,1145884..1146743,
FT                   1146794..1147068,1147118..1147427))
FT                   /gene="MAT2"
FT                   /locus_tag="ANIA_04734"
FT                   /old_locus_tag="AN4734.4"
FT                   /note="transcript_id=CADANIAT00005695"
FT   CDS_pept        complement(join(1146241..1146743,1146794..1147068,
FT                   1147118..1147296))
FT                   /gene="MAT2"
FT                   /locus_tag="ANIA_04734"
FT                   /old_locus_tag="AN4734.4"
FT                   /product="MAT2 proteinMating type HMG-box protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q7Z8M2]"
FT                   /note="transcript_id=CADANIAT00005695"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005695"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005695"
FT                   /db_xref="GOA:C8VAU1"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAU1"
FT                   /protein_id="CBF76901.1"
FT                   /translation="MAAVSIAMKSPTQSPDSITELLWKDALRHLGSTNDEVLLPTNVVD
FT                   IIGQDNVEKIKSRLSALLGAPVVSFVDESINALRVLRTPTFSGSSISVASPSRALDSWP
FT                   SEPPNKPRPASMKPAKIPRPPNAFILYRQHHYPKVKEARPDLSNNEISVIIGKKWRAEP
FT                   EEGKLHFKNLAEEFKKKHAEEYPDYQYTPRKPSEKKRRAASRISPKNSKRTVALENPGS
FT                   MTAPSSNVFTPQMYPGIQNGQLAGAGYIGYLDGLNSMVNTGGLTDEPTNFGTNAFNSLF
FT                   QQPQSDYGRTALFPQLEFAGPSLGDSLEFPEFAADYF"
FT   gene            complement(1148442..1151748)
FT                   /locus_tag="ANIA_04733"
FT                   /old_locus_tag="AN4733.4"
FT                   /product="signal transduction protein Syg1, putative
FT                   (AFU_orthologue; AFUA_5G09320)"
FT   mRNA            complement(join(1148442..1149407,1149492..1149581,
FT                   1149629..1149994,1150049..1151545,1151613..1151667,
FT                   1151735..1151748))
FT                   /locus_tag="ANIA_04733"
FT                   /old_locus_tag="AN4733.4"
FT                   /note="transcript_id=CADANIAT00005696"
FT   CDS_pept        complement(join(1148442..1149407,1149492..1149581,
FT                   1149629..1149994,1150049..1151545,1151613..1151667,
FT                   1151735..1151748))
FT                   /locus_tag="ANIA_04733"
FT                   /old_locus_tag="AN4733.4"
FT                   /product="signal transduction protein Syg1, putative
FT                   (AFU_orthologue; AFUA_5G09320)"
FT                   /note="transcript_id=CADANIAT00005696"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005696"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005696"
FT                   /db_xref="GOA:C8VAU2"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="InterPro:IPR033507"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAU2"
FT                   /protein_id="CBF76903.1"
FT                   /translation="MKFAKELEHELVPEWRAKYLNYKLGKKKVKAIARAIQKANRTPTH
FT                   ASLRRPTVGAEFSDTPAGSNRSASFWRAEKRAEGGEAQNSIASPSPASRSTPGQRHERQ
FT                   PLRVPGSRFSAVHGSYGSIIASPPQHPGVSDAASLELPGPALDVDEDSRYSDRYMDRAV
FT                   SPTNSFAVMPRHGMNRTVSRDSTHLSPSAAKQPAPVNVEPEKNVTSGSSIRRNSRLLSR
FT                   VLSATEATENPVEDHRSEVEKKQDEFFAFLDGELAKIESFYHMREREATERLKVLREQL
FT                   HTMRDQRIQEVFHVKRHRTEGFEQQQSEALSGLNGRRIKAAITGRRIGKNSKALAALAT
FT                   PGGEQPQDSDVITRRRDFTRHPVEDQQLPKSEVPYRSAKRKLKYALQEFYRGVELLKSY
FT                   AYLNRTAFRKINKKYDKVVGTRPSMRYMAEKVNKAWFVQSEVTESLLATAEDLYARYFE
FT                   GGKRKIAASKLRHTVRKAGDYSPNTFRCGLLGMAGILFAIQSLIYASHHLDDDELSRQT
FT                   SLLLQIYGGYFLIVFHFLLFCVDCMIWNRTKINYVFVFEYDTRSALDWRQLAEVCLLND
FT                   FLFPDINWGQLPCFFLFILGLFMWLNFLTVNAMYIYWPVVLVGVTVAVLFLPLRVLYHR
FT                   SRKWWAYSNWRLLLAGLYPVEFRDFFLGDMYCSQTYAMGHWGASSTQCTSSHSRLLGFF
FT                   TTLPSIWRAFQCIRRYVDTKNVFPHLLNFGKYMCGVLYYTTLSMYRINRTTRFQAPFIT
FT                   FALLNAIYVSVWDLAMDWSLGNPYAKHPLLRETLAFRRAWVYYVAIVIDVVIRFNWIFY
FT                   AIFAHDIQHSAVLSFVISFTEIFRRGIWTVFRVENEHCTNVLLFRASRDVPLPYAVPCA
FT                   DGQIEQQQQQQQQQQQQPPEPEIHEAQAFSTALPTHDLEEAAPSPGTASARPRTLTRVG
FT                   TIMATAHAQDFQRKKRPDEMGGATVAHGAPESPDDSSDEDDSGETQPYKDTDDAIEEEA
FT                   PSDDTQ"
FT   gene            1153951..1155350
FT                   /locus_tag="ANIA_04732"
FT                   /old_locus_tag="AN4732.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1153951..1154934,1154989..1155072,1155130..1155350)
FT                   /locus_tag="ANIA_04732"
FT                   /old_locus_tag="AN4732.4"
FT                   /note="transcript_id=CADANIAT00005697"
FT   CDS_pept        join(1154415..1154934,1154989..1155072,1155130..1155287)
FT                   /locus_tag="ANIA_04732"
FT                   /old_locus_tag="AN4732.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005697"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005697"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005697"
FT                   /db_xref="GOA:Q5B3Z8"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR039540"
FT                   /db_xref="InterPro:IPR040015"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Z8"
FT                   /protein_id="CBF76904.1"
FT                   /translation="MASNDRTQLDGPDHAINTGDSISAAPDSSQPVSSSTIDVSESANK
FT                   TSLPAEAPKDNMAADLSNTGTADNGNAALAPSDQTNSEAIVPTSASPETEEQKVATPAP
FT                   ELSSDASVKEPEQSGPSLTIVLLLITGTRYPFKIDANYLRKRDISVDNYDPFSMSVYTL
FT                   KELIWRAWQDDWEPRPSSPSSIRLISFGKLLDDKSPLSDSKFSRDAPNVVHMTVKPQEI
FT                   VDEEDAKGGKAQYSRDREASERSPRCRCVIQ"
FT   gene            complement(1156294..1156941)
FT                   /locus_tag="ANIA_04731"
FT                   /old_locus_tag="AN4731.4"
FT                   /product="20S proteasome maturation protein Ump1, putative
FT                   (AFU_orthologue; AFUA_5G10740)"
FT   mRNA            complement(join(1156294..1156358,1156436..1156868,
FT                   1156939..1156941))
FT                   /locus_tag="ANIA_04731"
FT                   /old_locus_tag="AN4731.4"
FT                   /note="transcript_id=CADANIAT00005698"
FT   CDS_pept        complement(join(1156294..1156358,1156436..1156868,
FT                   1156939..1156941))
FT                   /locus_tag="ANIA_04731"
FT                   /old_locus_tag="AN4731.4"
FT                   /product="20S proteasome maturation protein Ump1, putative
FT                   (AFU_orthologue; AFUA_5G10740)"
FT                   /note="transcript_id=CADANIAT00005698"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005698"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005698"
FT                   /db_xref="GOA:Q5B3Z9"
FT                   /db_xref="InterPro:IPR008012"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B3Z9"
FT                   /protein_id="CBF76906.1"
FT                   /translation="MSLRIAPPSSHPTQTSNTSTRHLPNTHTSRGAPSAPGVPDTLRSN
FT                   ITLQAPRGAPSTQPATPTSTHPLEARLLAWRQTQDALKMEGLRRTYGIAEPVRRGMELK
FT                   IVRDGTFRPAVLGGNKLGNVHEDILVLGGRDTEIGWEDVFHGDDFREPPSFHDEMEKRL
FT                   RMD"
FT   gene            1157293..1158036
FT                   /locus_tag="ANIA_04730"
FT                   /old_locus_tag="AN4730.4"
FT                   /product="37S ribosomal protein S12 (AFU_orthologue;
FT                   AFUA_5G10750)"
FT   mRNA            join(1157293..1157690,1157796..1157896,1157971..1158036)
FT                   /locus_tag="ANIA_04730"
FT                   /old_locus_tag="AN4730.4"
FT                   /note="transcript_id=CADANIAT00005699"
FT   CDS_pept        join(1157567..1157690,1157796..1157896,1157971..1158036)
FT                   /locus_tag="ANIA_04730"
FT                   /old_locus_tag="AN4730.4"
FT                   /product="37S ribosomal protein S12 (AFU_orthologue;
FT                   AFUA_5G10750)"
FT                   /note="transcript_id=CADANIAT00005699"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005699"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005699"
FT                   /db_xref="GOA:C8VAU5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAU5"
FT                   /protein_id="CBF76908.1"
FT                   /translation="MKGVCMKTGITKPKKPNSGERKTARVRLSSGKVVTAYIPGEGHNV
FT                   QQHSVVLVRGGRAPDCPGVKYHLVRGAMDLGGVASRVTSRSKYGTKKPKKD"
FT   gene            1159630..1161106
FT                   /locus_tag="ANIA_04729"
FT                   /old_locus_tag="AN4729.4"
FT                   /product="DUF1479 domain protein (AFU_orthologue;
FT                   AFUA_5G09280)"
FT   mRNA            join(1159630..1159896,1159943..1161106)
FT                   /locus_tag="ANIA_04729"
FT                   /old_locus_tag="AN4729.4"
FT                   /note="transcript_id=CADANIAT00005700"
FT   CDS_pept        join(1159630..1159896,1159943..1161106)
FT                   /locus_tag="ANIA_04729"
FT                   /old_locus_tag="AN4729.4"
FT                   /product="DUF1479 domain protein (AFU_orthologue;
FT                   AFUA_5G09280)"
FT                   /note="transcript_id=CADANIAT00005700"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005700"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005700"
FT                   /db_xref="GOA:Q5B401"
FT                   /db_xref="InterPro:IPR010856"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B401"
FT                   /protein_id="CBF76910.1"
FT                   /translation="MSVPKLITRSTARAASTSTSAQLTKAAGDISSVFPSLRPDYKPEP
FT                   LPPRFKDLKERIFRRNGDALKKSWERLLPSLEEEVDKIKAKKSGIIPIVDYSDVVSGDV
FT                   SPALLAEIRHRGSVVIRNVVPRKEARAWKERIEDYVAANQDKVKAFPPDSPAVFELYWT
FT                   PSQAEARAHSNVLDTQRFLQRLWHSTDPNTRISTRYPLSYADRLRIRQPGDSKFTLGPH
FT                   IDGGSLERWEDPEYSRVYAKILEGKWEEYDPWDAKHRIAANMDLYNGAGACSMLRFFQG
FT                   WLSMSKTAPGEGSLHVCPMLVHSTAYTMLRPFFDSQTLQPAMDATFPGSVPGACQEYNP
FT                   ITHPHLELETTMVSVPEVEPGDYVAWHCDSLHSVDKEHRGKGDSSVLYIPATPMCDMNV
FT                   DYLLKQRKAALAYSPPWDFPGAGGPGELGFKGALDWNSISAEGQRAMGLGQQRWDITDD
FT                   MTEGERQAVERANKACFA"
FT   gene            1161332..1164215
FT                   /locus_tag="ANIA_04728"
FT                   /old_locus_tag="AN4728.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1161332..1161882,1161937..1163337,1163436..1164111,
FT                   1164174..1164215)
FT                   /locus_tag="ANIA_04728"
FT                   /old_locus_tag="AN4728.4"
FT                   /note="transcript_id=CADANIAT00005701"
FT   CDS_pept        join(1161332..1161882,1161937..1163337,1163436..1164111,
FT                   1164174..1164215)
FT                   /locus_tag="ANIA_04728"
FT                   /old_locus_tag="AN4728.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005701"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005701"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005701"
FT                   /db_xref="GOA:Q5B402"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011678"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR026895"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B402"
FT                   /protein_id="CBF76912.1"
FT                   /translation="MRLQATLFLVASCVPSAFAIYADEVGHIDYHHALLGVPSSQSTFF
FT                   HRPSSSSNAALLYTLSENSLLGAVNPKDGSLLWRQNLSRPAVTPDRDAQGLLRASGGKN
FT                   AVVSALGDYVSAWSALDGKLIWKSSSPGMPVVDLELLELEDASSAPLVTDAIALSGGHS
FT                   GSVRRLDGSTGEVKWEYHDESGDVPFQVSASSTAVFYVSLQPALLKGYKIRVTSLDPLT
FT                   GRQASQQILNSDSDVSGPDSVLFVGANTAFPVIAWADKSHRTLKVNVIGTKQVTQVNIE
FT                   NTSGEDIRSIYIHAPKALNALPHFLVQYETASGSWAEVYHVDLASSTVSKAYSLPFLQG
FT                   WSVFSTGTKDANVYFIRVTDSETTVVSSVSHGIIGRWTQHPSLDGAVHAVSEVAMKGDS
FT                   VAVRSAIVLESGDWQLIQNGAVGWTRPEALSGALAASWADVDSQQDLAHQLEVEGHESL
FT                   LKAYTHRVKRHLKDLENLPNWLKDLPKRVITSILADEVSNLDSFGVSKPVIVATKNGWV
FT                   YALDSGNHGKVAWSVKAAEADTWNVKSIQTQPGLATVQAADGSSVTLNVTTGHITHTSA
FT                   ATDKPSSEANTSPDVYTVTQEDGKILGWSSKDSRIPVWTFQPAPGEKIIRATARPPHDP
FT                   VASIGKVLGNRSVLYNTHKGVDTAQPIASAMSENWFAYSFYAEGTDPSEPKGYQLVISE
FT                   MYESPIPNDRGPLGSASNYSSIADLPQPHVISQSFIIAEPISYMAVTQTRQGITTRQLL
FT                   ATLPASNAIIGIPRPVLDPRRPVGRDPTPTEAEEGLMKYAPFLDFDGRWYLSHARQVAG
FT                   INTVLSAPTLLESTSLIFGFGNDIFATRATPSQAFDILGKGFSKLQLLLTIVALAIGVS
FT                   MLAPMARKKKNDTLWKAR"
FT   gene            1165064..1166524
FT                   /locus_tag="ANIA_04727"
FT                   /old_locus_tag="AN4727.4"
FT                   /product="UDP-glucose 4-epimerase (Eurofung)"
FT   mRNA            join(1165064..1165132,1165183..1165417,1165480..1165936,
FT                   1165992..1166524)
FT                   /locus_tag="ANIA_04727"
FT                   /old_locus_tag="AN4727.4"
FT                   /note="transcript_id=CADANIAT00005702"
FT   CDS_pept        join(1165104..1165132,1165183..1165417,1165480..1165936,
FT                   1165992..1166386)
FT                   /locus_tag="ANIA_04727"
FT                   /old_locus_tag="AN4727.4"
FT                   /product="UDP-glucose 4-epimerase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005702"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005702"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005702"
FT                   /db_xref="GOA:C8VAU8"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:4LIS"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAU8"
FT                   /protein_id="CBF76914.1"
FT                   /translation="MPSGSVLVTGGTGYIGSFTTLALLEAGYKVVVADNLYNSSAEALN
FT                   RIELISGKKAEFAQLDVTDEAAFDKVFEAHPDIDSVIHFAALKAVGESGEKPLDYYHVN
FT                   VYGTICLLRSMVRHNVTNIVFSSSATVYGDATRFPDMIPIPEHCPLGPTNPYGNTKFAI
FT                   ELAITDVINAQRNNAKKAGNETEAAKWNGALLRYFNPAGAHPSGIMGEDPQGVPYNLLP
FT                   LLAQVATGKREKLLVFGDDYASHDGTAIRDYIHILDLADGHLKALNYLRANNPGVRAWN
FT                   LGTGRGSTVYEMIRAFSKAVGRDLPYEVAPRRAGDVLNLTSNPTRANTELGWKAQRTLE
FT                   QACEDLWLWTKNNPQGYRQQPPAELLEQLKK"
FT   gene            complement(1166638..1168060)
FT                   /locus_tag="ANIA_04726"
FT                   /old_locus_tag="AN4726.4"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family (AFU_orthologue;
FT                   AFUA_5G10790)"
FT   mRNA            complement(join(1166638..1167822,1167884..1168060))
FT                   /locus_tag="ANIA_04726"
FT                   /old_locus_tag="AN4726.4"
FT                   /note="transcript_id=CADANIAT00005703"
FT   CDS_pept        complement(join(1166638..1167822,1167884..1168060))
FT                   /locus_tag="ANIA_04726"
FT                   /old_locus_tag="AN4726.4"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family (AFU_orthologue;
FT                   AFUA_5G10790)"
FT                   /note="transcript_id=CADANIAT00005703"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005703"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005703"
FT                   /db_xref="GOA:Q5B404"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B404"
FT                   /protein_id="CBF76916.1"
FT                   /translation="MPIPIITTGIAEGLSAIPYSYTVLKVTPWILLIAALKYYFGGARN
FT                   GSERLMHSKVVMVTGGTSGIGATVVYELASRGAQVILLTQHAQSDIFLIDYIEDLRKAT
FT                   GNQLIYAEQVDLSSLHSIRTFATKWIDNVPPRRLDMLILCANTANPTEKITVDGIDEEW
FT                   QVNYLANFHLLSILSPALRVQPPHRDVRVIMTTCSSYIGAPKLDFSQLDVNTIPIHKKT
FT                   AGTKPLRTQASRKAEPKQKRQSQIQRKHIYGLSKLSLMIFATSFQKHLNAFKRPDGQPP
FT                   STRVILVDPGLTRTPGTRRWLTGGSLWGLLLYLITWPIWWLVLKSPQQGAQSILYAAME
FT                   ARFGRGTGGWMLKECREVDFARKEVTDEAVGKQLWEASERQIEEREREGAVLRALEKKE
FT                   NEQKENVKVRSQGSVRVKKSASSASSASSVSASSGAKEQKPGSRRSRKGNGNSK"
FT   gene            1168211..1168957
FT                   /locus_tag="ANIA_04725"
FT                   /old_locus_tag="AN4725.4"
FT                   /product="G-patch domain protein, putative (AFU_orthologue;
FT                   AFUA_5G10800)"
FT   mRNA            1168211..1168957
FT                   /locus_tag="ANIA_04725"
FT                   /old_locus_tag="AN4725.4"
FT                   /note="transcript_id=CADANIAT00005704"
FT   CDS_pept        1168211..1168957
FT                   /locus_tag="ANIA_04725"
FT                   /old_locus_tag="AN4725.4"
FT                   /product="G-patch domain protein, putative (AFU_orthologue;
FT                   AFUA_5G10800)"
FT                   /note="transcript_id=CADANIAT00005704"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005704"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005704"
FT                   /db_xref="GOA:Q5B405"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR039146"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B405"
FT                   /protein_id="CBF76918.1"
FT                   /translation="MPYEDEDYFLPLEDQRVFGAGITRKRVPFVRSSELSTLNSAPATP
FT                   AATGASIANTYLSIVMPKQAATSSSTSTTTTAPTSDSLSTATQPAADTADGRSHSAPPP
FT                   NPSQTCEVCHLPLSSSIAADKPHESSLAHQVCLTHSHPPSHLDRTRRGLRYLESYGWDP
FT                   DSRLGLGATGEGIREPLKGKLKADTVGLGAVLPSSVSGQRKSKDKVQKLNAKQVRKEHL
FT                   DVKKKGERLRELFYQDDDVLRYLGTG"
FT   gene            complement(1169179..1171738)
FT                   /locus_tag="ANIA_04724"
FT                   /old_locus_tag="AN4724.4"
FT                   /product="Sec1 family superfamily (AFU_orthologue;
FT                   AFUA_5G10810)"
FT   mRNA            complement(join(1169179..1170268,1170316..1170782,
FT                   1170834..1171036,1171089..1171235,1171295..1171382,
FT                   1171453..1171490,1171563..1171738))
FT                   /locus_tag="ANIA_04724"
FT                   /old_locus_tag="AN4724.4"
FT                   /note="transcript_id=CADANIAT00005705"
FT   CDS_pept        complement(join(1169179..1170268,1170316..1170782,
FT                   1170834..1171036,1171089..1171235,1171295..1171382,
FT                   1171453..1171490,1171563..1171593))
FT                   /locus_tag="ANIA_04724"
FT                   /old_locus_tag="AN4724.4"
FT                   /product="Sec1 family superfamily (AFU_orthologue;
FT                   AFUA_5G10810)"
FT                   /note="transcript_id=CADANIAT00005705"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005705"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005705"
FT                   /db_xref="GOA:C8VAV1"
FT                   /db_xref="InterPro:IPR001619"
FT                   /db_xref="InterPro:IPR027482"
FT                   /db_xref="InterPro:IPR036045"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAV1"
FT                   /protein_id="CBF76920.1"
FT                   /translation="MSSLLNIQREIILNTIRSAGGDNWKVLVLDEGSRSLIDNVVKEDD
FT                   ILNLNVTHIEQIEHRRNTNQSMDALYILSALPHIVDCVLADLERKRYRKSYLVWTSFLN
FT                   PGLRARFDRSQMVQEQVAAFQTISIDYYPRESRLVTFRDPWSFPVLFHPGCNHLIREHL
FT                   TTLAHKAVSLCATLGEYPVVRYYRPRTPTHEASVLCSHLARFIQEELDQFAQFNRDFPP
FT                   PSPRPRGVLLVVDRSMDLFAPLIHEFTYQSMVHDLLPIKEGDKITYKMVVNKGTTNEEV
FT                   KEMELNDHDRIWVEYRHMHMKDVLGKLGEDFARFRAANPQFAEDNQKADVGIIKDMLAG
FT                   LREFQEGRDAYTLHLNMAEECMKFFQDHKLIEVSSVEQCLATGLDENYKKAKGLASQLV
FT                   QLLDDDTIIHTDRLRLLLFYIIYRNGLLPGDIRKLMAHAQLPPQDGNVISNLGLLGARV
FT                   DKPLKDDKPPEQPLFNRKPPVVADSDEGILSRYELNVKMMLEDVIRGTLDPSIFPHTRP
FT                   QTDADAMATQQDTLSQASLRSAKPTWARTRTTGEQPRQRIIVFMAGGATYGESRACYEI
FT                   SETFKKDVFLATSHMLTPGLFLRQVSDLSADKRRLDIPAERPKPTAPAHLFERDPPPPQ
FT                   PAPQKKPAPAPAPAPPTAAMGAMSLGPNPAKQSSMGKPVKEQKEKKKHRFFR"
FT   gene            1172141..1174737
FT                   /locus_tag="ANIA_04723"
FT                   /old_locus_tag="AN4723.4"
FT                   /product="mitochondrial ATP-dependent RNA helicase Suv3,
FT                   putative (AFU_orthologue; AFUA_5G10820)"
FT   mRNA            join(1172141..1172322,1172371..1173441,1173492..1174737)
FT                   /locus_tag="ANIA_04723"
FT                   /old_locus_tag="AN4723.4"
FT                   /note="transcript_id=CADANIAT00005706"
FT   CDS_pept        join(1172141..1172322,1172371..1173441,1173492..1174737)
FT                   /locus_tag="ANIA_04723"
FT                   /old_locus_tag="AN4723.4"
FT                   /product="mitochondrial ATP-dependent RNA helicase Suv3,
FT                   putative (AFU_orthologue; AFUA_5G10820)"
FT                   /note="transcript_id=CADANIAT00005706"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005706"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005706"
FT                   /db_xref="GOA:C8VAV2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAV2"
FT                   /protein_id="CBF76922.1"
FT                   /translation="MHCLGPFELCALCGAPSPQLLRLREPTYTRNKRRSLPNKQKKQEY
FT                   ECMIISIRPYADAAHVHHRLVNNFPQLVTSILREMKESDLLNSETSDELWKRFERYVLN
FT                   ACQVSEKRENTKHGSLLNAKRAMTKAYLKDGLGGLRRELENLLYAHDLDARYSEPYLEQ
FT                   QQKIADLRYPAEWYPQARAIQRTIHLHVGPTNSGKTYHALKRLESSKSGFYAGPLRLLA
FT                   QEVYHRFKSSGIPVSLVTGDEVRLSEGEKAVVVSNTVEMVNLGQTYEVGVIDEIQMIAD
FT                   PRRGWAWTRALLGAKATELHLCGETRVVPLIRQLAALAGDKLVIHRYERLNPLKAMNKS
FT                   LKGDLTSLQKGDCIVSFSRVGIHALKADIERKTGRRAAIIYGGLPAEIRTQQASLFNDP
FT                   NNDYDFLVASDAIGMGLNLSCRRIIFETVVKTLPSGLKRLTVPEIKQIGGRAGRYRSAA
FT                   QHGKDHQQDNDNDNVGYVTSLEEVDLPYIQEALNTEPPPISAAGINPPDSVYEKFAAYF
FT                   PSNASLAYMVKRLTEIARINNLFFMCDPSPNLENAEIIDAVPGLHFVDQLTFMAAPMNP
FT                   REELGRRVAMAFERCVLEHTNGRLLDIEEVNLEILEEPVSGNKEYMHKLEGLHRSVILY
FT                   TWLSYRFGGIFTDRTLAVHVKELVEERMVRALTEFSANKKLRKNASLHRQIAMQKQLRL
FT                   QQEFLKANGDADLDLSESEEQYSPDTMNASDNEDAAETDITTDENDFEAESTLNGGTRE
FT                   SKDAAETDNPANNDYQDQQQETSDTTLNSEGSAEHDPPARDALEEEPTSGDATPERKES
FT                   AEYDPTVRNEDEPARKAANN"
FT   gene            1179164..1180579
FT                   /locus_tag="ANIA_04722"
FT                   /old_locus_tag="AN4722.4"
FT                   /product="hypothetical protein"
FT   mRNA            1179164..1180579
FT                   /locus_tag="ANIA_04722"
FT                   /old_locus_tag="AN4722.4"
FT                   /note="transcript_id=CADANIAT00005707"
FT   CDS_pept        1179414..1180433
FT                   /locus_tag="ANIA_04722"
FT                   /old_locus_tag="AN4722.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005707"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005707"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005707"
FT                   /db_xref="GOA:Q5B408"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B408"
FT                   /protein_id="CBF76924.1"
FT                   /translation="MTGTGATVEVVTVVTAVTAVMAVMTMMTMMITTGSLPQPLPVRQR
FT                   RKLLRQRPLHARRKLKTPPPETTPCETETETPSTESPPPETTPCETETPPPSTETPPPE
FT                   TTPCETETPPPSTETPPPETTPCETETETPPSTETPPPETTPCETETPPPSTETPPPET
FT                   TPCETETPPPSTETPPPETTPCETETETPPPETETPPPETTPCETETPPPSTETPPPET
FT                   TPCETETETPPPSTETPPPETTPCETETETPPPETETPPEETPAPAPPSTSSWTTSTSV
FT                   TIPPDETTTSIPTGTSPEQPTSTGTTPAAPVFTGAASVDRFGSPLAGVMAIAAIVLAF"
FT   gene            1180930..1185055
FT                   /locus_tag="ANIA_04721"
FT                   /old_locus_tag="AN4721.4"
FT                   /product="hypothetical protein similar to ATP dependent
FT                   helicase (Broad)"
FT   mRNA            1180930..1185055
FT                   /locus_tag="ANIA_04721"
FT                   /old_locus_tag="AN4721.4"
FT                   /note="transcript_id=CADANIAT00005708"
FT   CDS_pept        1180930..1184655
FT                   /locus_tag="ANIA_04721"
FT                   /old_locus_tag="AN4721.4"
FT                   /product="hypothetical protein similar to ATP dependent
FT                   helicase (Broad)"
FT                   /note="transcript_id=CADANIAT00005708"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005708"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005708"
FT                   /db_xref="GOA:Q5B409"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B409"
FT                   /protein_id="CBF76926.1"
FT                   /translation="MDDLQSLEHLSLISRITNELQNHLGVSDKVLAEYIIEQHLKCSSF
FT                   AEFKSALEAMGGDLFPMSLMESVDRLVLTMHPRYKNKNKKDRGDEHVENGASDDMDALN
FT                   ALEKKARVFKGLAVPDQEPGWAEEEYMEVGNKNGLGVDEHDAKDSAMDDTFAMLEGLAG
FT                   KARAKTTTITESRPVSKRKRSRSRSPEYDDYSRRRRRDRYRSRSRSRSRSPAYNKRDED
FT                   PVDEFGRSTGGRSSNDDEYRDGRSERRRRRRADEDYFRKPPPVELDDSPVLYKIYDGRV
FT                   TGVKDFGAFVNLVGVRGKVDGLVHVSAMQEGTRVNHPSDLVSRGQPVKVKVISIQGSRI
FT                   GLSMKEVDQETGQDLVPQKRLASGANMERLDGMPSDDRYGNLSADVPVIEESDGRSMKN
FT                   RKRLTSPERWEIKQLIASGAVSAADYPDIDEEYHATLTGEGTFEEEEDIDIEVRDEEPA
FT                   FLAGQTKMSLELSPIRVVKAPDGSMNRSAMAGTNLAKERRELRQQEAQDKAAEQAAGVD
FT                   LNAQWQDPMASERKFAADLRSTQQTGTDEAVPEWKRVTMGKTPSFGKRTNMSIKQQRES
FT                   LPVYKFRQQLLEAVAENQLLIVVGDTGSGKTTQVTQYLAEAGWANKGIIGCTQPRRVAA
FT                   MSVAKRVAEEVGCKLGAEVGYTIRFEDCTSPETKIKYMTDGMLQREVLLDPDLKKYSVI
FT                   MLDEAHERTIATDVLFGLLKTTLKRRPDLRLIVTSATLDADKFSEYFYGCPIFSIPGRT
FT                   FPVEIMYSKEPESDYLDAALITVMQIHLTEPPGDMLLFLTGQEEIDTACEILYERMKAL
FT                   GPSVPELVILPVYSALPSEMQSRIFDPAPPGGRKVVIATNIAETSITIDNIYYVIDPGF
FT                   VKQKAYDPKLGMDSLVVTPISQAQAKQRAGRAGRTGPGKCFRLYTEAAYQSEMLPTTIP
FT                   DIQRQNLSHTILMLKAMGINDLLHFDFMDPPPTNTMLTALEELYALSALDDEGLLTRLG
FT                   RKMADFPMEPALAKVLIASVDMGCSEEMLSIVAMLSIQSVFYRPKEKQQQADQKKAKFH
FT                   DPHGDHLTLLNVYNAWKRSGFSNAWCYENFIQARQIRRAQDVRQQLLGIMQRYHHKIVS
FT                   CGRNTTKVRQALCTGFFRNSARKDPQEGYKTLVEGTPVYMHPSSAMFGKPAEHVIYHTL
FT                   VLTTKEYMHCTTGIEPKWLVEAAPTFFKVAPTDRLSKRKKAERIQPLHNRFAGEDDWRL
FT                   SAQRRQGRGGGGGTWG"
FT   gene            1187153..1188215
FT                   /locus_tag="ANIA_04720"
FT                   /old_locus_tag="AN4720.4"
FT                   /product="Putative C2H2 finger domain transcription factor
FT                   (Eurofung)"
FT   mRNA            join(1187153..1187309,1187366..1187791,1187857..1188215)
FT                   /locus_tag="ANIA_04720"
FT                   /old_locus_tag="AN4720.4"
FT                   /note="transcript_id=CADANIAT00005709"
FT   CDS_pept        join(1187153..1187309,1187366..1187791,1187857..1188215)
FT                   /locus_tag="ANIA_04720"
FT                   /old_locus_tag="AN4720.4"
FT                   /product="Putative C2H2 finger domain transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005709"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005709"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005709"
FT                   /db_xref="GOA:Q5B410"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B410"
FT                   /protein_id="CBF76928.1"
FT                   /translation="MSLMLSQSPVTHASPAQHSRRLSVGAAAKTRTCVHCGRSFRRTEH
FT                   LERHVRTHTKEKPYTCLCGAAFSRRDLLKRHMGITGHEDVNPPNKSTSPKSQHRTDHDT
FT                   KQRIRRASTATVRSRRESVPNAASQDPSSMPPSPVDAEPVHWTMHQNTSYMKDENGYPD
FT                   PASDGTHDPEILEAAQLLLPGGATHGIPNYTPTTTSSYLPEEPHHYEDFTNFLDSLNLP
FT                   LEWGPGHHEAHSNQNNSSLTTEVAEPGLHPLFRERERDRSDRTRADSPFGRSWLNSDHY
FT                   QSSYAGMISEYGNYYHHYHPPEDVARVVVPNF"
FT   gene            complement(1188983..1193326)
FT                   /locus_tag="ANIA_04719"
FT                   /old_locus_tag="AN4719.4"
FT                   /product="conserved hypothetical protein similar to Rho
FT                   guanine nucleotide exchange factor (Eurofung)"
FT   mRNA            complement(join(1188983..1189664,1189713..1190144,
FT                   1190196..1190626,1190677..1193326))
FT                   /locus_tag="ANIA_04719"
FT                   /old_locus_tag="AN4719.4"
FT                   /note="transcript_id=CADANIAT00005710"
FT   CDS_pept        complement(join(1189578..1189664,1189713..1190144,
FT                   1190196..1190626,1190677..1193326))
FT                   /locus_tag="ANIA_04719"
FT                   /old_locus_tag="AN4719.4"
FT                   /product="conserved hypothetical protein similar to Rho
FT                   guanine nucleotide exchange factor (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005710"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005710"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005710"
FT                   /db_xref="GOA:Q5B411"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B411"
FT                   /protein_id="CBF76930.1"
FT                   /translation="MADIGGQQGRNYRPHGHPSSVQRDAAFSEIFGGARQPGRSQTMTS
FT                   QTPQFSQERAHTMSSQVPRPQMQRGPLPPQRPMQNGYPPSQSNGYYQAYPGSATMTSQS
FT                   PQGPPRPYPGRYAYPQPQRLDSRPVPGPPYQDAKGYNRAIPHPALNSDPYRSRSMARLG
FT                   GPPIQPPQPNSFNHTSAIASRNQPYNPATPMTPQGRVVPERHGNERAMSLTSYSMDREP
FT                   MHTTRTGSGRVIPNRRQPSGPVQPPIAQHDDYSDYMNGRVRPPSDGPMPNPRTFSMAST
FT                   VAPDRTMSMQSNLTHRPSAQTTTTLVSNNSRRSKLLAVNPALLSRVADAFREQIPLGEK
FT                   QKNGLSYQNAFSGADAVDVICSIIKTTDRNLALLLGRALDAQKLFHDVTYDHRLRDAPG
FT                   ELYQFKETLGEEAPSSEVNGVFTLLTECYSPTCNRDSLCYSIACPRRLEQQARLNMNPL
FT                   PVLRTSASKSSLHGDDDGGDNQKLWINMVPKEVSDSVDDKEKKRQEIIFEIMYTERDFV
FT                   KDLEYLRDFWMRPLRSASNSPIPEHRREKFIRTVFGNCLDVLKVNGALSEALNARQKES
FT                   HIVKTVGDIFLQHVPRFDPFIKYGANQLYGRYEFEKEKSSNPAFAKFVEETERLKESRK
FT                   LELNGYLTKPTTRLARYPLLLEQVGKNTAEGSADKEDIPHAIRIIKDFLSRVNAESGRA
FT                   ENHFNLVSLNSSLKFGPGDYVDLKLTEENRQMLTKMAFKKTPTDNSEVTVYLFDHAVLL
FT                   VRIKVVNKREEYRVYRKPIPLELLVIPQMDEVIPKPGIAKRPSSGLLANKTAANPPAAK
FT                   DTLPITFRHLGKGGYEQTLYASSSQQRKKFLELVDEQQTKLRERNSNFYNKNIICEKFF
FT                   NSVNRVNCLVPIDGGRKLVYGTDSGIYVSDRNPRDQSAKPRKVLDVSQVTQIDTLEEYQ
FT                   LLLVLANKTLYSYPMDALEVTEGQNPAAKRPKKIQGHANFFKSGIGLGRHLVCSVKTSA
FT                   LSTTIKVYEPMDNLAKGKKKSTVSKMFQSGQDTLKPFKEFYIPAESSSIHYLRSTLCVG
FT                   CARGFEVVSLETTETQSLLDQADTSLDFVARKENVKPIHIERLNGEFLLNYSDFSFFVN
FT                   RNGWRARADWKISWEGNPNSFALSLPYILAFEPNFIEFRHIDTSELIHIMTGKNIRMLH
FT                   SSTREILYAYEDDSGEDVVASLDFWKHKPLAQH"
FT   gene            1193803..1195118
FT                   /locus_tag="ANIA_04718"
FT                   /old_locus_tag="AN4718.4"
FT                   /product="vacuolar ATPase proteolipid subunit c, putative
FT                   (AFU_orthologue; AFUA_5G08560)"
FT   mRNA            join(1193803..1193917,1194140..1194270,1194338..1194355,
FT                   1194447..1194563,1194631..1194749,1194799..1194883,
FT                   1194937..1195022,1195076..1195118)
FT                   /locus_tag="ANIA_04718"
FT                   /old_locus_tag="AN4718.4"
FT                   /note="transcript_id=CADANIAT00005711"
FT   CDS_pept        join(1193803..1193917,1194140..1194270,1194338..1194355,
FT                   1194447..1194563,1194631..1194749,1194799..1194883,
FT                   1194937..1195022,1195076..1195118)
FT                   /locus_tag="ANIA_04718"
FT                   /old_locus_tag="AN4718.4"
FT                   /product="vacuolar ATPase proteolipid subunit c, putative
FT                   (AFU_orthologue; AFUA_5G08560)"
FT                   /note="transcript_id=CADANIAT00005711"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005711"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005711"
FT                   /db_xref="GOA:Q5B412"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B412"
FT                   /protein_id="CBF76932.1"
FT                   /translation="MDWPVERSSLDNEHQTKTSSKGNEVAVEGITGSRGWECLSLIETR
FT                   AILQLVSSISNLPSLIKESITMTESELTPKFAPFLSFAGIAAALAAESPRLTDTAAGAA
FT                   YGTAKAGIGIAGVGTFRPDLIMKSLIPVVMSGIIAVYGLVIAVLIQGDVTAPTGSEPSL
FT                   SLYAGCMHLASGLSVGLAGIAAGYTIGIVGDAGVRAYMQQSRVYVGMILILIFGEVLGL
FT                   YGLIVGLILNSKSSN"
FT   gene            1195768..1197138
FT                   /locus_tag="ANIA_04717"
FT                   /old_locus_tag="AN4717.4"
FT                   /product="cAMP-dependent protein kinase catalytic subunit
FT                   (Eurofung)"
FT   mRNA            join(1195768..1196020,1196083..1196175,1196240..1196364,
FT                   1196419..1197138)
FT                   /locus_tag="ANIA_04717"
FT                   /old_locus_tag="AN4717.4"
FT                   /note="transcript_id=CADANIAT00005712"
FT   CDS_pept        join(1195768..1196020,1196083..1196175,1196240..1196364,
FT                   1196419..1197138)
FT                   /locus_tag="ANIA_04717"
FT                   /old_locus_tag="AN4717.4"
FT                   /product="cAMP-dependent protein kinase catalytic subunit
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005712"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005712"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005712"
FT                   /db_xref="GOA:Q5B413"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B413"
FT                   /protein_id="CBF76934.1"
FT                   /translation="MASGTVGPSPPSGVQGSSASDNSGNPTPGEIHDREKRTVASVRPQ
FT                   TQRHPNPFVITERPEEKQLGISTRQLSVRDFVLLKTLGTGTFARVWLARLRDDKTRPEK
FT                   VYALKILRKADVIKLKQVEHVRNERKTLADVSGHPFITTLIASFSDSQSLYMLLDYCPG
FT                   GEIFSYLRRARRFNENTSKFYAAEITMTIEFLHDAEGVVYRDLKPENILLDADGHIKLV
FT                   DFGFAKQIGDRETYTLCGTPEYLAPEVIHNSGHGLAVDWWALGILIYEFLVGQPPFWDQ
FT                   NPMRIYEQIVEGHIRYPSNMSPAAQNIISLLCKTNPAERLGHISGGSARVRTHPFFENI
FT                   NWDDLFYRRIKGPIIPRVDHPADTGNFEEYPDPDPKSQTIYTEDMRSKYETLFSDF"
FT   gene            complement(1198761..1200189)
FT                   /locus_tag="ANIA_04716"
FT                   /old_locus_tag="AN4716.4"
FT                   /product="alpha-1,6-mannosyltransferase subunit (Och1),
FT                   putative (AFU_orthologue; AFUA_5G08580)"
FT   mRNA            complement(join(1198761..1199076,1199130..1200189))
FT                   /locus_tag="ANIA_04716"
FT                   /old_locus_tag="AN4716.4"
FT                   /note="transcript_id=CADANIAT00005713"
FT   CDS_pept        complement(join(1199048..1199076,1199130..1200189))
FT                   /locus_tag="ANIA_04716"
FT                   /old_locus_tag="AN4716.4"
FT                   /product="alpha-1,6-mannosyltransferase subunit (Och1),
FT                   putative (AFU_orthologue; AFUA_5G08580)"
FT                   /note="transcript_id=CADANIAT00005713"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005713"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005713"
FT                   /db_xref="GOA:Q5B414"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039367"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B414"
FT                   /protein_id="CBF76936.1"
FT                   /translation="MLTFRKALIVAAIFITLILFLRSSHSGPESAAAASPEDIAYEISQ
FT                   ETKGKTSSESSDSTQQQPLKQPPPPATAPLRERLRYHFPYNLEAKFPAYIWQTWKYTPA
FT                   SVWFSQDLRRPEASWTEMNPSFVHQVIPDDTLHHLVKYLYGSIPEVLEAFNSMPIPVMK
FT                   ADFFRYLILLARGGVYSDIDTTALKPVVDWLPDSLDLSTIGFVVGIEADPDRPDWHDWY
FT                   SRRIQFCQWTIQSKPGHPILLDIVTYITQEALRMKKAGILKKGKMDKTIVEFTGPAAWT
FT                   DAVFRYFNDPEYFYVEPGTTRNITYEDFTNQVEYQKVGDVVVLPITSFSPGVQQMGAQG
FT                   IDDPMAFVKHNFGGTWKTDPSL"
FT   gene            complement(1202091..1202592)
FT                   /locus_tag="ANIA_04715"
FT                   /old_locus_tag="AN4715.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1202091..1202291,1202407..1202592))
FT                   /locus_tag="ANIA_04715"
FT                   /old_locus_tag="AN4715.4"
FT                   /note="transcript_id=CADANIAT00005714"
FT   CDS_pept        complement(join(1202091..1202291,1202407..1202592))
FT                   /locus_tag="ANIA_04715"
FT                   /old_locus_tag="AN4715.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005714"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005714"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005714"
FT                   /db_xref="GOA:Q5B415"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B415"
FT                   /protein_id="CBF76938.1"
FT                   /translation="MKKEAYHHTALFIKPRGARKMWKLLPFRSSTTCNDIVGHVGLGMI
FT                   FMPRRGSSIPSLSTCRQLLMTPCFGQNRQIDIILRALFAAEWKMKFAQAWVIEFEQRSK
FT                   GSATGSVGLDRIAAAIRVVYCPYP"
FT   gene            1202544..1204355
FT                   /locus_tag="ANIA_04714"
FT                   /old_locus_tag="AN4714.4"
FT                   /product="ThiF domain protein, putative (AFU_orthologue;
FT                   AFUA_5G08610)"
FT   mRNA            join(1202544..1202574,1202668..1203027,1203094..1204355)
FT                   /locus_tag="ANIA_04714"
FT                   /old_locus_tag="AN4714.4"
FT                   /note="transcript_id=CADANIAT00005715"
FT   CDS_pept        join(1202742..1203027,1203094..1204355)
FT                   /locus_tag="ANIA_04714"
FT                   /old_locus_tag="AN4714.4"
FT                   /product="ThiF domain protein, putative (AFU_orthologue;
FT                   AFUA_5G08610)"
FT                   /note="transcript_id=CADANIAT00005715"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005715"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005715"
FT                   /db_xref="GOA:Q5B416"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B416"
FT                   /protein_id="CBF76940.1"
FT                   /translation="MASWIQRQNNSHQVQLAATAVLSGAAVAGAILGFQKYRRREAVKR
FT                   LKASIPTIDEKHRAESLNEFGAAVPGPYWSKEDERGAALARRAQEGDYDEELILEQLAR
FT                   NRVFLKDEGLAKLRDAFIIVVGCGGVGSHAVASLARSGVSKIRLIDFDQVTLSSLNRHA
FT                   LATLADVGTPKVHCIRRRLQQIVPWVKFDCRNELFGASAADDLLAPWTLDDADKGQKPV
FT                   YVLDCIDNIQSKVELLHYCHSHSIPVISSMGAGCKSDPTRVMITDMSVSSDDRLSRSTR
FT                   RRLKLLGVTTGIPVVFSTEKPGPGKATLLPLAEEEFAKGEVGELSVLPDFRSRILPVLG
FT                   TMPAVFGYTLANHVICEISEYPTDYSMGGKGKDKLYDTVHAQLLVTLERLARAESESGT
FT                   QPIGLRLPMSRDDVIYLVDEIWRGKSVVTGLPSRLALTLWNRPSNGFKPDPQWEKEGQI
FT                   LIPFKPEDLVLMTKEEATRHEKEVLMGGKKVEDLYSEEIIQKVNQRQKEMAYYEQFR"
FT   gene            1204703..1206504
FT                   /locus_tag="ANIA_04713"
FT                   /old_locus_tag="AN4713.4"
FT                   /product="Ser/Thr protein phosphatase family
FT                   (AFU_orthologue; AFUA_5G08620)"
FT   mRNA            join(1204703..1205386,1205447..1205923,1205981..1206504)
FT                   /locus_tag="ANIA_04713"
FT                   /old_locus_tag="AN4713.4"
FT                   /note="transcript_id=CADANIAT00005716"
FT   CDS_pept        join(1204807..1205386,1205447..1205646)
FT                   /locus_tag="ANIA_04713"
FT                   /old_locus_tag="AN4713.4"
FT                   /product="Ser/Thr protein phosphatase family
FT                   (AFU_orthologue; AFUA_5G08620)"
FT                   /note="transcript_id=CADANIAT00005716"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005716"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005716"
FT                   /db_xref="GOA:C8VAW2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAW2"
FT                   /protein_id="CBF76942.1"
FT                   /translation="MADRDRSRDREALDISDDISEDGLYPPHPSSSSPPTRLSRFARPL
FT                   IDYVRNEWQSNSGAKYSHLGSASSNSVSDRTDAPRWVQIVLSIVAAPRFRRYVLVYLAL
FT                   LGACILGWQFFLFPRLKENSAILTALDPKEKSKVGGWFGANAVPQLEDMIQLKTLDPAL
FT                   LPAREAKEDDSKHSSRRLVIVGDVHGCKEELEKLLDKVSFQEERDHLIFTGDLIEKGPD
FT                   SLGVVDLARHYNASCVRGNHDRPPPCPPSRHARVQYH"
FT   gene            complement(1206696..1208726)
FT                   /locus_tag="ANIA_10589"
FT                   /old_locus_tag="AN10589.4"
FT                   /product="LCCL domain protein (AFU_orthologue;
FT                   AFUA_5G08630)"
FT   mRNA            complement(join(1206696..1208190,1208239..1208726))
FT                   /locus_tag="ANIA_10589"
FT                   /old_locus_tag="AN10589.4"
FT                   /note="transcript_id=CADANIAT00005717"
FT   CDS_pept        complement(join(1206696..1208190,1208239..1208726))
FT                   /locus_tag="ANIA_10589"
FT                   /old_locus_tag="AN10589.4"
FT                   /product="LCCL domain protein (AFU_orthologue;
FT                   AFUA_5G08630)"
FT                   /note="transcript_id=CADANIAT00005717"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005717"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005717"
FT                   /db_xref="GOA:C8VAW3"
FT                   /db_xref="InterPro:IPR004043"
FT                   /db_xref="InterPro:IPR036609"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAW3"
FT                   /protein_id="CBF76944.1"
FT                   /translation="MPSRSSSSSFERLSQHPDEYSLKSQDDSGSSQAVARNGRDSFDPA
FT                   PAIREQSTSEPLLPTSNPHSVQQQKRFSCSVGGIWEWMRGPSPPHKYRINPWLGRWQTA
FT                   PGRLIERYFHSTKTRFCLLSACLLLWGAAFISILHVSVAGQEIPGLGSPVKLSCSSRLW
FT                   SNATNCGLDGDYCRPFDGETFAFRCPAGCSGFMVLEPYFVGPKEINYQHLVIGGAAAES
FT                   QPDSVYRGDSSICQAAMHAGLLEDSKGGCGILRRTGEQKNFPAVDRNEISSVDFPSHFP
FT                   LSFTFDTGASSEHSGLDCQDIRWPLFTFSVVVSTILSLVVASPAAFYASIFFIVYFQVA
FT                   LSSDPPYSPDYYEIVSTALGRFLPCAFVGFAIYHFCIRHTLSDLTAHWDKTILWLGPCW
FT                   VGALNTDTFDKIPISRLTPHDIQQQPGAIPALIIIIVILVAIVITQALAFRNEGRMPKM
FT                   LALYATLIAGIVILLLVPSMNLRIHHYILALLFLPGTTLQTRPSLLYQGLLVGLFINGI
FT                   ARWGFDSILQTSASLLDGAQLGSMLPYIPPDIITIPSGNPDIISFAFSSLRSLPSDIDG
FT                   LSVIVNDVERYHAFRSDGAVDVRLPDLNWTRVVPGEPEYFRFGFIVENALGGFWYEDFT
FT                   RPIVWDSDGRWNVSVSSSEGGRNSM"
FT   gene            complement(1208831..1209991)
FT                   /locus_tag="ANIA_10581"
FT                   /old_locus_tag="AN10581.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_5G08640)"
FT   mRNA            complement(join(1208831..1209187,1209244..1209290,
FT                   1209343..1209530,1209592..1209751,1209810..1209991))
FT                   /locus_tag="ANIA_10581"
FT                   /old_locus_tag="AN10581.4"
FT                   /note="transcript_id=CADANIAT00005718"
FT   CDS_pept        complement(join(1209166..1209187,1209244..1209290,
FT                   1209343..1209530,1209592..1209751,1209810..1209872))
FT                   /locus_tag="ANIA_10581"
FT                   /old_locus_tag="AN10581.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_5G08640)"
FT                   /note="transcript_id=CADANIAT00005718"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005718"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005718"
FT                   /db_xref="GOA:C8VAW4"
FT                   /db_xref="InterPro:IPR008253"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAW4"
FT                   /protein_id="CBF76945.1"
FT                   /translation="MPVFSRVLSVILRIAEIGFGAVVAGIIGWFLHRFGDLDIWPEARW
FT                   IYTEVVAGISILFGIIWLIPFSSGFFTWPLDLLLSMAWFAAFGVQVDANDRLNCGSIWR
FT                   WGSITDDTYCGRWKAAQAFSFLSAIVWIVSALVGMWFTFRVRRHATDRYGHRSRV"
FT   gene            complement(1210821..1211836)
FT                   /locus_tag="ANIA_04711"
FT                   /old_locus_tag="AN4711.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1210821..1211497,1211549..1211836))
FT                   /locus_tag="ANIA_04711"
FT                   /old_locus_tag="AN4711.4"
FT                   /note="transcript_id=CADANIAT00005719"
FT   CDS_pept        complement(join(1210821..1211497,1211549..1211681))
FT                   /locus_tag="ANIA_04711"
FT                   /old_locus_tag="AN4711.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005719"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005719"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005719"
FT                   /db_xref="GOA:Q5B419"
FT                   /db_xref="InterPro:IPR025638"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B419"
FT                   /protein_id="CBF76947.1"
FT                   /translation="MAPQLFPSNPDEVMVIRNVTSDVITMSLPFARFGRFKFGGRGTLV
FT                   RMTSGSIAVFSPVNLTPAVRETISGLGGRVKYIAALDLEHHIHLTAWKKAFPDADIIAP
FT                   EGLWEKRQSVPEHKDTPIKYILRQSNSNKEHTWPISDEFNKEFDIEYVYGHGSKEIVFL
FT                   HKPSCTLIEADLLFNLPAREQYSKTGESATSGLWTKIVRPLLSTAQPATWQKRFAWYVL
FT                   SKGDRNAFSESMKRIDQWEFNRLIPCHGDVIESGAKGVFRTVFEWFL"
FT   gene            complement(1212268..1213814)
FT                   /locus_tag="ANIA_04710"
FT                   /old_locus_tag="AN4710.4"
FT                   /product="nuclear protein Qri2/Nse4, putative
FT                   (AFU_orthologue; AFUA_5G08660)"
FT   mRNA            complement(join(1212268..1212449,1212516..1213349,
FT                   1213405..1213814))
FT                   /locus_tag="ANIA_04710"
FT                   /old_locus_tag="AN4710.4"
FT                   /note="transcript_id=CADANIAT00005720"
FT   CDS_pept        complement(join(1212268..1212449,1212516..1213349,
FT                   1213405..1213708))
FT                   /locus_tag="ANIA_04710"
FT                   /old_locus_tag="AN4710.4"
FT                   /product="nuclear protein Qri2/Nse4, putative
FT                   (AFU_orthologue; AFUA_5G08660)"
FT                   /note="transcript_id=CADANIAT00005720"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005720"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005720"
FT                   /db_xref="GOA:C8VAW6"
FT                   /db_xref="InterPro:IPR014854"
FT                   /db_xref="InterPro:IPR027786"
FT                   /db_xref="InterPro:IPR029225"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAW6"
FT                   /protein_id="CBF76949.1"
FT                   /translation="MARTPRVRPTSPSPPPGSPSDKENLENPSSKKRGIQGQNMSSSRK
FT                   STKRQRLGDTASNIETGTQISQAQRKASTKYYDPDQDAAERRRVRKGLRDLTRDLNDSR
FT                   NEYLQPGNTGIKDTFLKANEIFRDVKQTSDATIDSRLLVNAADLSYKKAATLALGESGV
FT                   GIDVDEFVSKCISFMRAGPEDPNVSITSTQRRRAPRRTQADMDSDDEDGDAMNWDWLGR
FT                   AACFRHSSRPAVSGFLLGPLSVQKRTRQIAQRRARERIDPSQAVRPQELREEDLDRRET
FT                   TNLTAMCTSINKLLGKTRDQAERLANEALEKIGDPTEDEVQSIMAKYNIADDAGVPLAN
FT                   FCINPKSFGQSVENLFYLSFLVRDGTVGISTDSRGLPTLHPTKPLAPSEAQRRGVQKHQ
FT                   SVFSLDFDTWKDMIDAYNIKECIIPHREEEENDTAQGWYS"
FT   gene            1214059..1216811
FT                   /locus_tag="ANIA_04709"
FT                   /old_locus_tag="AN4709.4"
FT                   /product="phosphoinositide 3-kinase, catalytic protein
FT                   Vps34 (Eurofung)"
FT   mRNA            join(1214059..1214117,1214177..1216811)
FT                   /locus_tag="ANIA_04709"
FT                   /old_locus_tag="AN4709.4"
FT                   /note="transcript_id=CADANIAT00005721"
FT   CDS_pept        join(1214059..1214117,1214177..1216811)
FT                   /locus_tag="ANIA_04709"
FT                   /old_locus_tag="AN4709.4"
FT                   /product="phosphoinositide 3-kinase, catalytic protein
FT                   Vps34 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005721"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005721"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005721"
FT                   /db_xref="GOA:Q5B421"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR008290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="InterPro:IPR042236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B421"
FT                   /protein_id="CBF76951.1"
FT                   /translation="MEAFTFAVSAQVDFPIYVKIGSLEGKQKQIPLSVLLKQPELRHIG
FT                   SVQNPLSDLFVTAQLWSESKPLGVPLQTSYKAFKTVRAWNEWLQLPISIKDAPLRCQLA
FT                   ITIWDLSPFGGEGANGHYIPFGGTTIRLFDDDGKLKTGKQKCKVYRHKAADGFSATTTP
FT                   STPSKRRRGNKPDPLGPSPEELELERVEVLIKKHEMEEIPQIDWMDQLVFRQLERLKLS
FT                   ADKAARKRALLMEANRNRRLESENEEDDEKLEDENFTLYVEFPRFDHPIVWSDHEYPPP
FT                   PISSYPQNAPGNATGTLKSLPEVRFGPGIEGADGEEVIRIYDPEVGQTGNPCEDKHRRL
FT                   IRSHRTGIMDRDLKPNPKIRDDLNIIMSYEPTQDLTAEEKDLVWRFRYYLTREKKALTK
FT                   FVKSVNWRDVGEAHQAVEILPKWTEIDVDDALELLGPTFDNAAVRSYAVERLRKADDDE
FT                   LLLYLLQLVQALKYEDKAHEDADIAAHDSSLANFLITRAANNFKLGSYLHWYLMVECDD
FT                   AGPGTLSSHRRLFARVEYYFMAELERMHPEHRKTLLRQGELVAVLSKISKDIRFARENR
FT                   PIKIEKLKKYLKDPKNDLLQFDPPLPLPLDPDVMVTGCFPEESNVFKSSLSPLLITFKT
FT                   TEGRKYPILFKVGDDLRQDQLVIQIIILMDRLLQKENLDLKLTPYRILATNATAGAMQF
FT                   IPSTSLSAVSAKYKTVLAYLKANNPDENEPLGVRKETMDTYIKSCAGYCVITYLLGVGD
FT                   RHLENLLLAPDGHFFHADFGFILGRDPKPFAPMMKLCKEMVEGMGGTSSPLYLQFKQYC
FT                   FTAYTTLRKSANLILNLFSLMVDANIPDIRVEPDKAVLKVKERFHLEMTEEEAIRHFEQ
FT                   LIGDSANAIFGVVIDRLHDFVQGWRA"
FT   gene            1217146..1218263
FT                   /locus_tag="ANIA_04708"
FT                   /old_locus_tag="AN4708.4"
FT                   /product="mitochondrial GTPase (YlqF), putative
FT                   (AFU_orthologue; AFUA_5G08680)"
FT   mRNA            join(1217146..1217412,1217466..1218263)
FT                   /locus_tag="ANIA_04708"
FT                   /old_locus_tag="AN4708.4"
FT                   /note="transcript_id=CADANIAT00005722"
FT   CDS_pept        join(1217146..1217412,1217466..1218263)
FT                   /locus_tag="ANIA_04708"
FT                   /old_locus_tag="AN4708.4"
FT                   /product="mitochondrial GTPase (YlqF), putative
FT                   (AFU_orthologue; AFUA_5G08680)"
FT                   /note="transcript_id=CADANIAT00005722"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005722"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005722"
FT                   /db_xref="GOA:Q5B422"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B422"
FT                   /protein_id="CBF76953.1"
FT                   /translation="MAASFVPRQAFPNYASIPRSYFLGHHRAGLNKMRNMLSSIDYVIE
FT                   CRDTRVPFTSVNPMFEEALGKTRRLIVYTKRDLGSEAGSREQKSLEKQIRSFNRGTPVF
FT                   FVSPHHLDPRSKSRTNNRPDVNTILTHLREDAQGPDRLVGCRVMVVGMPNVGKSTLINN
FT                   LRNRGVGKAKAVHTGDQPGITRKIGTPVKIIERDNGAHVYVLDTPGVFMPYVPDAENML
FT                   KLALCGCVKDSVISPVTLADYLLYHINLHDPTVYQRWSLPTNEVHPLLDSFARSTGLLA
FT                   KGGIPNMDLAALHFIQKWRGGGLGRFILDDLQEERRRRESSDEDKASISITQALKAEKS
FT                   ARRQQATDPSVRQK"
FT   gene            complement(1218353..1219603)
FT                   /locus_tag="ANIA_04707"
FT                   /old_locus_tag="AN4707.4"
FT                   /product="Pre-mRNA-splicing factor isy1
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B423]"
FT   mRNA            complement(join(1218353..1219195,1219304..1219603))
FT                   /locus_tag="ANIA_04707"
FT                   /old_locus_tag="AN4707.4"
FT                   /note="transcript_id=CADANIAT00005723"
FT   CDS_pept        complement(join(1218428..1219195,1219304..1219306))
FT                   /locus_tag="ANIA_04707"
FT                   /old_locus_tag="AN4707.4"
FT                   /product="Pre-mRNA-splicing factor isy1
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B423]"
FT                   /note="transcript_id=CADANIAT00005723"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005723"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005723"
FT                   /db_xref="GOA:Q5B423"
FT                   /db_xref="InterPro:IPR009360"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR037200"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B423"
FT                   /protein_id="CBF76955.1"
FT                   /translation="MARNSEKAQSMLFRFRAQQAADLGIIDIGRTRRPKAITSVDSIPA
FT                   CEKWRGQVLKEISRKVSRIQEPSLSDHQIRDLNDEINKLMREKWAWEMQIRNMGGPNYM
FT                   RGSGRVYDDEGREIPGGGKGYRYFGRARELPGVKEMLEAAARRGRGPAEEEEDDGKTVG
FT                   RGGDIATKKVDANYFGYGLDEEDGTLLAYEMQREKEAVEKLRKEGEDEEDVEDGWEPLP
FT                   GDAGDGIEWRLPTLEEVQEELVDRRRRRLLEKIS"
FT   gene            complement(1219931..1227358)
FT                   /locus_tag="ANIA_04706"
FT                   /old_locus_tag="AN4706.4"
FT                   /product="myosin II homolog (Eurofung)"
FT   mRNA            complement(join(1219931..1220371,1220428..1226419,
FT                   1226471..1226655,1226714..1226857,1226906..1227358))
FT                   /locus_tag="ANIA_04706"
FT                   /old_locus_tag="AN4706.4"
FT                   /note="transcript_id=CADANIAT00005724"
FT   CDS_pept        complement(join(1219931..1220371,1220428..1226419,
FT                   1226471..1226655,1226714..1226857,1226906..1227358))
FT                   /locus_tag="ANIA_04706"
FT                   /old_locus_tag="AN4706.4"
FT                   /product="myosin II homolog (Eurofung)"
FT                   /note="transcript_id=CADANIAT00005724"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005724"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005724"
FT                   /db_xref="GOA:Q5B424"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002928"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="InterPro:IPR027401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B424"
FT                   /protein_id="CBF76957.1"
FT                   /translation="MLPSQINGSPKRANPFSRASPSPSPTPSPQTKARPKSAVLASAGK
FT                   FEEPKSHIRNSSSISHTSLAPFGRNANRQRSNSLRNDVTSGTFAPEFIKSEDLRHGADQ
FT                   IRGQEGDNDFSGNKYVWLRDPEKAFVKGLVLEEQDGARLLVQTDDGQQREVDVDQVDRV
FT                   NPAKFDKADDMAELTHLNEASVVHNLHTRYLADLIYTYSGLFLVTVNPYCPLPIYSNEY
FT                   INMYKGQSREETRPHIFAMADEAFRNLVEEGENQSILVTGESGAGKTENTKKVIQYLAA
FT                   VATSDNMYSRSGSKQMNTLSQQILRANPILEAFGNSQTVRNNNSSRFGKFIRIEFSRSG
FT                   QISGASIDWYLLEKSRVVKPNLQERNYHIFYQLLRGAEPKLKQKLLLSNLQIEDFAYTR
FT                   EGNDTIAGVSDEKEWDSLLEAFHIMNFSEEDQMCILRTVAAVLHLGNITIVKESLRADQ
FT                   AALSRDALDSVHKACQLLGIETEPFVKGLLHPKVKAGREWVEKVQTPEQVRLALDALAK
FT                   GIYERGFGDLVNRINSRLERNTVTGEDSYFIGVLDIAGFEIFQNNSFEQLCINYTNEKL
FT                   QQFFNHHMFVLEQEEYAREQIEWQFIDFGKDLQPTIDLIEVTNPIGIFSCLDEDCVMPK
FT                   ATDKSFTEKLHSLWDTKSTKYRASRLRQGFILTHYAAEVEYSTDGWLEKNKDPLNDNIT
FT                   RLLASSQDNHIAALFSDCGNADEVDHPRSRVKKGLFRTVAQRHKEQLSSLMNQLHSTHP
FT                   HFVRCIIPNHKKRPKMLNAPLVLDQLRCNGVLEGIRIARTGFPNRLSFNEFRQRYEVLC
FT                   RDMPKSYMDGQSAARIMLQKLALDKAWFRVGRTKVFFRAGVLAELEEKRDELIRTIMTR
FT                   FQSVARGFVQRRISNKRLYRAEATHIIQHNFRAYLEMKANPWWRLFSRMKPLLGETRTA
FT                   QEVKRRDEKIKQLETKMKQDQSERQKVEEERRRAEIEIQRIQQTLESERALALDKEEIF
FT                   KRLQDREVELSEKLAGAIADQENLEDQLDELILAKKKTDEELDLRKTQLEQAGEIIQRL
FT                   EAERKEMQQKLEDLEQKLLEAQSSASETENHMRELGQEVKMLQSHLSLKERKLQDLEAK
FT                   LLKTDQDLDVKLAKTSKELDRSKKEVKDLLDENRTIRQQISDLSKTSTSYEEMLRRKES
FT                   ELTVLRNDAKKHAEEKKQLDVEKSNLSTRHDNMQNKLRELQAQVDAMVSEKIQLEREAA
FT                   DVQKLLQAKISEDAEAGESRKLLEQQIQDLKNQLFQAQADLSRERQSRDDVQMLAEHKL
FT                   AELKDKFESLNEAKITIEKEMYIQQDSLRRATEARVAAEQSRKELQQELIKLRDRFTAA
FT                   EDARLRAEAEMEQALVKQTTQRLESIRKELDNTQHRLEEVEAERSRLAAREQQLMNAIA
FT                   ESESFRIRHDQHKERLERELVTLKGRLTASENDNRALLTKIQQKNLDIARSNSKASESQ
FT                   RLRVATLQKEKAKLEEENKALSRQLGDQQLSITSLEKQKEKLALSVEDLNHEVNREHKA
FT                   SRNAERAASTASIQLAEANRNLETERQLRTQAQANTRKLQSALDSSNKEIDDLHRQLML
FT                   FHKIVEPEADPSADSWDKIQPDLSRKVDLAQLVETLQSQLQVSEEKYNRAEAQLAEMRR
FT                   RHGEEMKELDARYSSSKRALLEEIDQNEVAHNRTPNHLRKNSETAIAKKFGAPTTPNRR
FT                   LNINDNSNDSARSDRTVDTVGYQKRMDLAAEIEELQNKLQMSEMQNKHLQDQLARSVPP
FT                   KDIWQDDSPSIRRMQLLERENGRLHEQLDDSSKKVSALERSIHSGELSLRDVQAKSHEE
FT                   LYDLINSQEQSRRSLLRVHNETVAEITDAKAQFEKLKRAKAALEVELRDACSEAQELQA
FT                   AREQDALSRNQLLQEFSDLQIRLDAETSKSADLAASLSLYKSRADEYFSKLEQAEITLL
FT                   KASRAEQFAKAQAKETEDNCAQIMAERKEMEAIIDDLQRQTQSLEARMEDQAAELQGAL
FT                   QAKQRLQNELEDYRNQRAIDIEDKETSMEQTRQKYQREITTLNNELEMEREKVLNGRTE
FT                   ASRLREELEDLRSKWDNEVLNSSTWAKEKSRMEVMLQDVTTSRDEAVNAHNDAQARVVS
FT                   LLSQVRSLRTSIDDVTAERDMLHKEKKMLEARLTEAGERLEDLAKGESPSMRNAASMDR
FT                   ELLELKAKLAQQEDLSLAAVGKMRRAEALATEMQKEVTAEREATAQLFKDKAALEKQLK
FT                   EAQLRCVDLETKSYSSGSQDIRFLHKRIKELETHLEEQEAKNNSEQRSLRNVDRTVKDL
FT                   QSQIERREKMNAQLEEEVNRGREKVERLLKNIDELQQSESDSQLQARRAERELREEREK
FT                   SLRLERELNGWKALRVERGGSAIARSHVAFSDAGSRKGSGAYTTGDLHRMPSNTKGFL"
FT   gene            1228144..1232603
FT                   /locus_tag="ANIA_04705"
FT                   /old_locus_tag="AN4705.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1228144..1228882,1228936..1230783,1230856..1231500,
FT                   1231542..1231871,1232087..1232603)
FT                   /locus_tag="ANIA_04705"
FT                   /old_locus_tag="AN4705.4"
FT                   /note="transcript_id=CADANIAT00005725"
FT   CDS_pept        join(1228144..1228882,1228936..1230783,1230856..1231500,
FT                   1231542..1231871,1232087..1232286)
FT                   /locus_tag="ANIA_04705"
FT                   /old_locus_tag="AN4705.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005725"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005725"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005725"
FT                   /db_xref="InterPro:IPR019607"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B425"
FT                   /protein_id="CBF76959.1"
FT                   /translation="MSGQPMPPAPPYWGANYTQQWATQPAPSSGSIPHDIQFNPDPSFD
FT                   PQQYRNIHNFYANANLSGLGGASATGTFPPPPFAFPSTFPPAPSAPPFANMPNVGYPLM
FT                   PLSSVHSQMRPNQASTNNMDNSARKTPGQHPTPTTKSNQDLDREEGELTDIEGAASAEQ
FT                   QPHSQKKARRLRGDISGSKPTRRAGSEGDNRLPIGQSQSTRLNGLHAQDERPAIISTGC
FT                   ELLSDLEEGEASPEPRASSRASGSPYNPPMPINAISPPMSKSSPDLLETGTREVGAVEQ
FT                   RSVSASSSSKSSPESAVSVAQLRVQAQGALLSLAPHSIRYTELVGEGINPTILKQLYEE
FT                   VGIKVPITPPADARTQSSSKETADARTDQSAANGQAKQPAKQNEPQLAAAPTATPREPS
FT                   SFPPQSAPASTTKPMERKEVIARMLAAKAAKSSPASAPPTDAAQTAASVQSTPATVEKP
FT                   TLSTSSQDQSANEKETRLREKNKAQTELARQRIEQLKKQGLIRNLQKSQINVDKEQKDV
FT                   QESPQPQPSTIKHPLPERPPLPESASFDHIPGLFMMGQAPPTNGALTTVQDPVSDSAAQ
FT                   PRSSQRKRPRASDFDDDPIPVPKKAFTNGTNHQTPPERLIIDISDDEFYDDDEGSMDVE
FT                   ASTGLSKGTGPPVAEGLPRAYPLPAGNLPHRPATSQSYSSSVISTPGNHKSNEQDDLKK
FT                   KDLEIQAMHRRIAELEQRKKAKLASRTQSPRASDLSSPDIVGTPAAPAPSSFPTPPSAT
FT                   EKKAEDLLAAMNADGLRQLRSKILRMQEIEAGVPSLDAVIRKTEMKLANARREVEELSS
FT                   ELAKGEEGRQQLIDELNALKLEVSGLSLDHVDSALSTIEAKKDLPDEAVQAPTSENEVA
FT                   DNHAMAVAEVPEADGSTNEDTAPPSHTDPTAKNPPPAKDRPIAPNTVEDATNLNATAEE
FT                   LTDTSMSDSSSSMDESSADSSSESGSLNEEMPDAPEPNTNPIAPVDDLNTISPGPSIEP
FT                   ARLQAKEEPLPEDQSFNLQPSTNKDLGADSESLASRESPVSEAYEPPEPEESANASDSN
FT                   YSPAPSPDFHSPAPNMEVSGPSEDQSKVAATKPTFSDWPSGCAINLSSYQDLWTLTCTQ
FT                   NSRRPEDSHRKLTPYSSPLKLFRAYRYHPNYNDEVSGGYRSLTYSHNIDPLKHLCPFET
FT                   SGGVCNDRSCEFQHFRNMALSDDKILIQMGSLREGKTAEESDKYVTGLKEAINDMRRDK
FT                   VKDFNTVAAEIVAYRRRFLQDPTRVLAL"
FT   gene            complement(1237533..1239338)
FT                   /locus_tag="ANIA_04704"
FT                   /old_locus_tag="AN4704.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(1237533..1237594,1238221..1238264,
FT                   1238374..1238439,1239160..1239338))
FT                   /locus_tag="ANIA_04704"
FT                   /old_locus_tag="AN4704.4"
FT                   /note="transcript_id=CADANIAT00005726"
FT   CDS_pept        complement(join(1237533..1237594,1238221..1238264,
FT                   1238374..1238439,1239160..1239338))
FT                   /locus_tag="ANIA_04704"
FT                   /old_locus_tag="AN4704.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005726"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005726"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005726"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B426"
FT                   /protein_id="CBF76961.1"
FT                   /translation="MQFRIPETTAELQQSCKTKKVYLIARLHLDIIIFSEIIEGRCIMV
FT                   DFVCRVARITNVLFPKMKIANVVQFKMERNGVYDFVRANARRVSVLLCPVRVCPGGTGT
FT                   FIYAPKERVRHL"
FT   gene            1242966..1243910
FT                   /locus_tag="ANIA_04703"
FT                   /old_locus_tag="AN4703.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1242966..1243242,1243388..1243451,1243592..1243910)
FT                   /locus_tag="ANIA_04703"
FT                   /old_locus_tag="AN4703.4"
FT                   /note="transcript_id=CADANIAT00005727"
FT   CDS_pept        join(1242966..1243242,1243388..1243451,1243592..1243910)
FT                   /locus_tag="ANIA_04703"
FT                   /old_locus_tag="AN4703.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005727"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005727"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005727"
FT                   /db_xref="GOA:Q5B427"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B427"
FT                   /protein_id="CBF76963.1"
FT                   /translation="MTLLTVIDSDDLPPAILTPWTLLPTPTKLPLGWYEEGLQRIQELF
FT                   SGDIPSWWFAGQVETSHFADWNSLPWWNCTFDQEHPILRLLSDEFLLGDTCDTVLPMPI
FT                   SRSTRSTHGIPRVNANINLCHNNASNKYRKLPHNPYDTAGPTQKGFLAQCKYVFSSPSF
FT                   NHDKQRLQGSRCAGIYCADMATNYGVALETMYELNPVSNGDCSGFWPEYTYCIEAS"
FT   gene            complement(1245344..1246394)
FT                   /locus_tag="ANIA_04702"
FT                   /old_locus_tag="AN4702.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1245344..1245550,1245609..1245922,
FT                   1245983..1246394))
FT                   /locus_tag="ANIA_04702"
FT                   /old_locus_tag="AN4702.4"
FT                   /note="transcript_id=CADANIAT00005728"
FT   CDS_pept        complement(join(1245344..1245550,1245609..1245922,
FT                   1245983..1246196))
FT                   /locus_tag="ANIA_04702"
FT                   /old_locus_tag="AN4702.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005728"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005728"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005728"
FT                   /db_xref="GOA:Q5B428"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B428"
FT                   /protein_id="CBF76965.1"
FT                   /translation="MLMSTSPSPWLAAAMLCIGLANAHTVIVYPGYRGNNLHTTGTVEG
FT                   ADGLGIAWSSDNETLIYPYGMQWSYPCGGMPTSENRTKWPVQGGAVSFQPGWFQGHSRA
FT                   QIYINIGLGTVPPNMSHPMITPFEIVGPDNDPYPGTICLPQVRLPAGIEVQVGDNATIQ
FT                   VIELAQHGAALYNCADITFAEPEDVAEVNSTNCFNSSHISFETIFTTSSLENAGLEAVT
FT                   VPSFLTAVVPTFLGIAYGLLMA"
FT   gene            1247226..1248258
FT                   /locus_tag="ANIA_04701"
FT                   /old_locus_tag="AN4701.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1247226..1247778,1247843..1248258)
FT                   /locus_tag="ANIA_04701"
FT                   /old_locus_tag="AN4701.4"
FT                   /note="transcript_id=CADANIAT00005729"
FT   CDS_pept        join(1247226..1247778,1247843..1248258)
FT                   /locus_tag="ANIA_04701"
FT                   /old_locus_tag="AN4701.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005729"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005729"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005729"
FT                   /db_xref="GOA:Q5B429"
FT                   /db_xref="InterPro:IPR012942"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B429"
FT                   /protein_id="CBF76967.1"
FT                   /translation="MPHTRRKKPSPSQNKRLQVTDDSGWTHVTTNKHARRIRQPSVNPN
FT                   SGSSSTGNRNGLEKDAAKEEIAEELVPAEAPQKTTLSDLQRQLGLYKQRWEESVTWDCV
FT                   VEGLRRGVPSLLAERGSSSNSDGDGEKEVKDKDENQSKNGISIICIGLGSPSGFLRGGW
FT                   VDRRAVSMYQLAALASILEWIGESTSMQNPNPGMRAYAQDPVFNTHDETLLNELKITVL
FT                   THPGAFQKVTPKTLLFCPGAERRHIELLLAHDPAIVVGGPLEDIESDVVRRFVERRESV
FT                   RLKEFAELETAFWGMRIYFPRSGAEKQDKVSSRIQEGGAEG"
FT   gene            complement(1248560..1250927)
FT                   /locus_tag="ANIA_04700"
FT                   /old_locus_tag="AN4700.4"
FT                   /product="Endo-beta-1,3-glucanasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5B430]"
FT   mRNA            complement(join(1248560..1249050,1249123..1250927))
FT                   /locus_tag="ANIA_04700"
FT                   /old_locus_tag="AN4700.4"
FT                   /note="transcript_id=CADANIAT00005730"
FT   CDS_pept        complement(join(1248906..1249050,1249123..1250927))
FT                   /locus_tag="ANIA_04700"
FT                   /old_locus_tag="AN4700.4"
FT                   /product="Endo-beta-1,3-glucanasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5B430]"
FT                   /note="transcript_id=CADANIAT00005730"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005730"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005730"
FT                   /db_xref="GOA:Q5B430"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B430"
FT                   /protein_id="CBF76969.1"
FT                   /translation="MGDRSEQYGDIPPISSQHRMHGYGNNGEPAAMPGDGQQNWGSGPG
FT                   IAHTHSMRTASTATPGMDNLGPSAVGGGISGIALGVANTHDRQSGIDAFRDADATLGYI
FT                   PAERGYHTTGADNPYVPSPPSVGPGPDESSEGLRSHETFGSSAALSAAGAPAGNWTPPS
FT                   GSRHSFLDGSYQGVASGPYQRHSAYSSQDYPADINPDDILDDGDDGFAAAPSNKPNAAG
FT                   GAATGGAAGGLLGEFFGAKKAADASYDPVPGAGLPSVEKYAKPRPSGASRKRGWIIGGI
FT                   LAFIVIGAIVGGAVGGTLGNRRSETASESSEVSADDDTETNGDLDKNSDEIKSLMAMEG
FT                   LHKVFPGMDYTPWGVQHPECDKWPPSQNNVTRDMAVLSRLTNTVRLYGTDCNQTEMVLH
FT                   AIDRLELTDMKLWLGVWIDTNTTTNERQLSQLYDILDKRSDHSVFKGAIIGNEALYRAG
FT                   STKEEARKNIIDYMRQVRKHFNDHNIDIKVATSDLGDNWDETLADATDVVMSNVHPFFG
FT                   GVEVSKAAGWTWSFWNSHNAPLTQGTNKGNIIAEVGWPSGGGNDCGDGANCKDDTSGAV
FT                   AGVKQMNQFMADWVCPALENGTDYFWFEAFDEPWKVKFNKGDEQWEDKWGLMDPGRNLK
FT                   PGIEIPDCGGKTAA"
FT   gene            complement(1252763..1255155)
FT                   /locus_tag="ANIA_04699"
FT                   /old_locus_tag="AN4699.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1252763..1252956,1253054..1253770,
FT                   1254114..1255155))
FT                   /locus_tag="ANIA_04699"
FT                   /old_locus_tag="AN4699.4"
FT                   /note="transcript_id=CADANIAT00005731"
FT   CDS_pept        complement(join(1252763..1252956,1253054..1253770,
FT                   1254114..1255155))
FT                   /locus_tag="ANIA_04699"
FT                   /old_locus_tag="AN4699.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005731"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005731"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005731"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B431"
FT                   /protein_id="CBF76971.1"
FT                   /translation="MATTQMHRPYPPIYHTPQSSSPASVASQPHEHNRSLYTQSPQMTS
FT                   TIYGYQQALSALPVQPSPYGAHPSPQQHPLTTQSLMMSHQTSTSQLQHQSSQAPTAALT
FT                   SPTTATVQQATPSQRALLNPPHPATSAPLQPSNSNHQSSNIGTSSSAAPGPIPATTPLV
FT                   VRQDSNGVQWIAFEYSRDRVKMEYTIRCDVESVNVDNLSQEFKAENCVYPRACCSKDQY
FT                   RGNRLVYETECNAVGWALAELNATLRGKRGLIQRAVDSWRNSNQDPRLRSRRVRRMAKI
FT                   NRRQGALPAPPPQHMAPTTGVPPGVSSSSIAPVGPRPSLGPLSAMGPPQLHHHHAQPDG
FT                   PIHEEASGSADYASGTHRPLPPAPSSSGHSPTDIRNAHVFHGYPTFPLSANSSSGHRGP
FT                   SIPPLLRDNGLGSFGRNPAVATSGRVEEIEDDEHDPNKDDLFGTLPEGKRRKFILVDDT
FT                   QRPGCRVRVKVMLDQVDMDEIPDSYRMANSVYPRTYFPVQMKTPRGQGLPGDRYIKDDT
FT                   QINDVDEDEATVGRTMVPAPQVDDESEIAVPRISRRRHRKEVLLNDLGYRMSWSQSRVF
FT                   SGRMLFLQRSLDAYRNKMRSTMLAAGQNENSIPPHFETRAGKRRFLERRKRAAMSRDTE
FT                   HTVSASQHDAEEIEP"
FT   gene            complement(1265627..1267891)
FT                   /locus_tag="ANIA_04698"
FT                   /old_locus_tag="AN4698.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1265627..1265995,1266066..1267891))
FT                   /locus_tag="ANIA_04698"
FT                   /old_locus_tag="AN4698.4"
FT                   /note="transcript_id=CADANIAT00005732"
FT   CDS_pept        complement(join(1265829..1265995,1266066..1267746))
FT                   /locus_tag="ANIA_04698"
FT                   /old_locus_tag="AN4698.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005732"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005732"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005732"
FT                   /db_xref="GOA:C8VAX8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAX8"
FT                   /protein_id="CBF76973.1"
FT                   /translation="MSSAARYRPISPGSANMIDPLRASTGTVQLASSYDPYDPAGRPIY
FT                   TGYRSDVPYSPTYDSRYPVAPRLEAHPVSQQTYHDPGQSTRLRTEYAIRPRQRSSTTSA
FT                   ADSHGRLGVPPISSVSRTSAVVLSDYGRSPSPLTDQDGYLVPASSRHHRHHRHSSYDYA
FT                   SDTGGQPTSRRHYGAYPTYVSRRRYPQNGGLRKGEDIDKYDAYSYTNPREQFEKEAVAK
FT                   LQYHRNARKERPLSLTGIEDPRLLGRRDPRAHGPPPSHRGYDKVHRDDLRRSTYGFGNS
FT                   ELDLASARQRPPRSVTLHQDHDEGYSSYRDEFDDTRPAHREHKRPDGDARKRDTIDSHG
FT                   ARKPFNKQSPPSVSGSGLGTAVLASGYSEGQDYDLSSHADRYRHRGRVPRDRSRSRRRS
FT                   RRRGGSESDECSSDDDLKKYRREPSVRPRINGSDSSKENEPHRHRSRSRHHERPSDKKS
FT                   DQKKTDSKEPDAPPKGILKPPRDKFPEEPNPVREGVAPLKDAHKKGIPPGARWTKIDRR
FT                   LVNPAALEAGQERFEERPDHVIVLRVLTKEEIQAYAVKTQEIRDSRYREYIRERRRQRE
FT                   EDRRRGRPVDDFSSDDEDESDNFPLAIEGPGEPRSSQKS"
FT   gene            complement(1274331..1274882)
FT                   /locus_tag="ANIA_10592"
FT                   /old_locus_tag="AN10592.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1274331..1274435,1274491..1274882))
FT                   /locus_tag="ANIA_10592"
FT                   /old_locus_tag="AN10592.4"
FT                   /note="transcript_id=CADANIAT00005733"
FT   CDS_pept        complement(1274504..1274779)
FT                   /locus_tag="ANIA_10592"
FT                   /old_locus_tag="AN10592.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005733"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005733"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005733"
FT                   /db_xref="GOA:C8VAX9"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAX9"
FT                   /protein_id="CBF76975.1"
FT                   /translation="MPSYLAPSQTPETYRSLSGLSGSFEMETSPALHYTRSHRGHGISQ
FT                   FQRPKYFSTSSLYICCQCNDGPKVYSHNVQCVLCHHIACDECTHVK"
FT   gene            1276687..1278346
FT                   /locus_tag="ANIA_04697"
FT                   /old_locus_tag="AN4697.4"
FT                   /product="Palmitoyltransferase pfa5 (EC 2.3.1.-)(Protein
FT                   fatty acyltransferase 5)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B433]"
FT   mRNA            join(1276687..1276798,1276848..1277346,1277396..1277596,
FT                   1277698..1278346)
FT                   /locus_tag="ANIA_04697"
FT                   /old_locus_tag="AN4697.4"
FT                   /note="transcript_id=CADANIAT00005734"
FT   CDS_pept        join(1276687..1276798,1276848..1277346,1277396..1277596,
FT                   1277698..1278346)
FT                   /locus_tag="ANIA_04697"
FT                   /old_locus_tag="AN4697.4"
FT                   /product="Palmitoyltransferase pfa5 (EC 2.3.1.-)(Protein
FT                   fatty acyltransferase 5)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5B433]"
FT                   /note="transcript_id=CADANIAT00005734"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005734"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005734"
FT                   /db_xref="GOA:Q5B433"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5B433"
FT                   /protein_id="CBF76977.1"
FT                   /translation="MAGQPDRRINLAVARVIPVVLFGIIIYSCYVITKPLCIDYLIDPL
FT                   PKYNRPSRVGAGAAILVVFYILLLFVIITYVRLLYTVVYNPDLLPRSQAADQQSTPAKR
FT                   SKSRSRRKGHGHGHRKSKSDEVSDKPVSDVERALDYNAGPMVLPWDTAGLEYFYKKDVF
FT                   VCQPDGRPIYCSKCCHYKPDRTHHCREVDRCVRKMDHFCPWVGGVVSETSFKFFIQFVF
FT                   YTALFCMTVLIVCAIYTAELRQDVSLISGSRNMLIISRLVMLTLIGLSDSLQLAAFNLT
FT                   TIENLNRRSAVWTLAIRVPNHMISRIQPGTRWAPTFRTITYPLPPVPPPLSGMPTQPAT
FT                   GEGDNPYSPPPVPSTDPSAEQHIFAILQTLPGENPFALGSPLKNLQQVLGHSIIDWLLP
FT                   IKRSPCADHSSAESEFVMGPVVSRLKKEAGLESKDAAAGSITTKHKNSSYNSSPSAPAD
FT                   KRSKRKQKRGKHHHHHHHHRHSSTTGTT"
FT   gene            1279667..1283673
FT                   /locus_tag="ANIA_04696"
FT                   /old_locus_tag="AN4696.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1279667..1279702,1279792..1283673)
FT                   /locus_tag="ANIA_04696"
FT                   /old_locus_tag="AN4696.4"
FT                   /note="transcript_id=CADANIAT00005735"
FT   CDS_pept        join(1279667..1279702,1279792..1283673)
FT                   /locus_tag="ANIA_04696"
FT                   /old_locus_tag="AN4696.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005735"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005735"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005735"
FT                   /db_xref="GOA:Q5B434"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B434"
FT                   /protein_id="CBF76979.1"
FT                   /translation="MFRRRRSASQHRHQHQLSTSNTQNAQSAATRAFIQSQPSSSNLSS
FT                   AAAAAALRSLTPTPTPIENVQTKRMLQRRASLSSQPVGSATLRPSSRNGLRRSNSSASM
FT                   SARTFRDQSPGRPSSSYSTMSTSAVVPPLPSIPPEFSGRKNQPRRSVSLGPSALPPTSR
FT                   TRQTEGRRNVTSPTNVPDSPRDVASSEASPSSPRHQRSESRNSINFSYPMNSRTNSPTI
FT                   PSGFHDRQDSAASAATSLNQRASAQYHQNKTHAAAPGSPARSTRPVTSALAAAQAVTLS
FT                   WNEEPNTPPGSSRPARQQHAIDRSPSRSPASLDVKPRPAPKRTSATSEDRSVKERSRPS
FT                   PAQSSSPIPMPLKEKENRPLAAPLKEPPRPLTPTTTENENVVRTPTVSPPQAKPAAELD
FT                   RERQPAALGQPGSPARSAHFPSQLTVKGFPGDQLHQPPPRSLSPAKSAMKNRNSSLSPD
FT                   GRLSGILRPGPSLSEISDATSVASDDGVRPNHRRKPVKVSFEDEAEIVGVAASPPTSPE
FT                   DIVPESPPGKSKSKTSWFNLHKRKSSPLRSTDNDEFDGVLKPRAALPSFGSIRGNKDGA
FT                   RLDAAIQQGVDDDSDMESDDDFINGHFVNSINPRASEAKVTKQERADNELPAVLTVTAA
FT                   KGVAEKDATPVGEFNMEPTFFHKTQLSPLVEVPSEQNLPLSEEQNLELPDITLQPATPD
FT                   PEKGRASLEEWISPEEYPHQSIEAEPEEPSRLMGKRDSADDDSSSSIYSDAEEDLAGGG
FT                   YGSINAIVDHETASSVPGVAVTTLQDETRLAEHSPYATDVPETCQIARVQTPVREDLTA
FT                   PTPGSPGLIEPLPLSSPPVQSKAETASAQGKNTRSTEPVEVYSIANLREDNPQEVNTRS
FT                   KQVKANGSGAQQIQQQSQTREALTPLVQNDVKSQGPAELEVSGGAHIPRRQLSNGSDSS
FT                   SSFKRARRAGRGGMGMKRTLRGSQQESSAPVSPSRSAAHVDSSTMPSALGTGTLRTTLR
FT                   NNASRKEKPSIFSAGKAHKGKLAKSFNLPFASRFPDSDSDSDDGVQNRRLPRLGHRSAR
FT                   SMSDFDMRPVRGIPRRQDAYDGDSTELEDSSDGERRPNSAPRGLAAEAPAPKPQSPTVR
FT                   DPALAAVAKSRGMTEEQLEELLNRGSPRKPNILNRLSMKKSKPAPKRGKLQLPQVLSNG
FT                   IFPEHEQAQGQDAEVDHDSPKVVSNSSKLTKKSFHKAAHSDSWPLSSEQADPVDSGIGS
FT                   VSSPSSTQQSAQAQTPNGGAANGNRPFSQQQPFGTTAECAPSQEHDQSVLKSNRASDVV
FT                   IEGSGRKKRFQRLKKAFGIGR"
FT   gene            1285974..1288327
FT                   /locus_tag="ANIA_04695"
FT                   /old_locus_tag="AN4695.4"
FT                   /product="Woronin body major protein
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q9P8K9]"
FT   mRNA            join(1285974..1286543,1286934..1287376,1287509..1288327)
FT                   /locus_tag="ANIA_04695"
FT                   /old_locus_tag="AN4695.4"
FT                   /note="transcript_id=CADANIAT00005736"
FT   CDS_pept        join(1287355..1287376,1287509..1288020)
FT                   /locus_tag="ANIA_04695"
FT                   /old_locus_tag="AN4695.4"
FT                   /product="Woronin body major protein
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q9P8K9]"
FT                   /note="transcript_id=CADANIAT00005736"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005736"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005736"
FT                   /db_xref="GOA:Q9P8K9"
FT                   /db_xref="InterPro:IPR001884"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR037318"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9P8K9"
FT                   /protein_id="CBF76981.1"
FT                   /translation="MGYYDDDVRYRDGVKENVRIVEPRGAAATTSETVPIPTHFIRVGD
FT                   ILVLQGRPCQVIRISSSPMTDQRRYTGVDLFTRELHEESSFVSNPKPSVVVQTMLGPVY
FT                   KTYRILDIQEGTIVALTESGDVKSGIPVIPQGNLYQRIKDAFLEGRGSVRALVINDGGR
FT                   ELVVDYKIIHSSRL"
FT   gene            complement(1289161..1291616)
FT                   /locus_tag="ANIA_04694"
FT                   /old_locus_tag="AN4694.4"
FT                   /product="transcriptional regulator (Cti6), putative
FT                   (AFU_orthologue; AFUA_5G08840)"
FT   mRNA            complement(join(1289161..1290112,1290178..1290465,
FT                   1290700..1291616))
FT                   /locus_tag="ANIA_04694"
FT                   /old_locus_tag="AN4694.4"
FT                   /note="transcript_id=CADANIAT00005737"
FT   CDS_pept        complement(join(1289161..1290112,1290178..1290465,
FT                   1290700..1291280))
FT                   /locus_tag="ANIA_04694"
FT                   /old_locus_tag="AN4694.4"
FT                   /product="transcriptional regulator (Cti6), putative
FT                   (AFU_orthologue; AFUA_5G08840)"
FT                   /note="transcript_id=CADANIAT00005737"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005737"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005737"
FT                   /db_xref="GOA:Q5B436"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B436"
FT                   /protein_id="CBF76983.1"
FT                   /translation="MSPRRSSRARTSQPSPAIQHTNSSSSSASMTRERSTRSNHKNPSP
FT                   RSQSDDDADKGDFRETRQRQRARGDEENDVHSKIGDGEDDDVDEEDEEEITRCLCGQQD
FT                   YPGLPPSRREALNRNGARSGIKDENPLDSSLDSSDLMSDDIGSMFIQCDSCKVWQHGGC
FT                   VGIMDEAMSPDEYFCEECRKDLHRIKSETNGSHSSQYLPVAPAPSSTVSSRDSSRDNAK
FT                   RAKDQKSRQSDPFPNPKRRSTMNSRDAAYDEEEQLRRAIEESKEDNKTTDGEESTTRRP
FT                   KRSRSDSDAHRQLAKRPRTRSPSPTINPKQSNPASPALSDDEAKSRPIVNGNRKPRAAS
FT                   RGQREKDTKELDEPEVEQPEHTGRRKGRSDRRKGEGEIQGDAIQKIPANSIQGAESDHE
FT                   IVESPVKMTAIEPEIPPRSPETSAPVPETAPSRPSTRKSGRPPARRGRVGRNQYTRDRD
FT                   LNGTGTDSNTGNSPRRGQSLDTGGDSPRIGSLSTPVNGTDTGKPSRPRYVHQRTTMNEM
FT                   KRRVAAILEFISRMQVEMAVAGESTTPPERSNGFDAQRAENVSKTAGEGSSDGVRTEKD
FT                   FKDLSSVEMMDVLTRHLLKWQQEYGKFGER"
FT   gene            1293256..1295378
FT                   /locus_tag="ANIA_10580"
FT                   /old_locus_tag="AN10580.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1293256..1293466,1293620..1294402,1294453..1295378)
FT                   /locus_tag="ANIA_10580"
FT                   /old_locus_tag="AN10580.4"
FT                   /note="transcript_id=CADANIAT00005738"
FT   CDS_pept        join(1293451..1293466,1293620..1294402,1294453..1295378)
FT                   /locus_tag="ANIA_10580"
FT                   /old_locus_tag="AN10580.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005738"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005738"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005738"
FT                   /db_xref="GOA:C8VAY4"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAY4"
FT                   /protein_id="CBF76985.1"
FT                   /translation="MAATLNGVIYSAPDTPSPVYPDRLIRPLPKRTLRSRLSSDAADSI
FT                   LYPPAPPATQLFYGACTTNRDAVNDSKVHVQQSDGGPDLSPDSRDHHIPYENGVDFDSG
FT                   DEDGPVVVRRSTGFRGSSLSPTPSKVQHQTPGIGKEQSTKSSPTGPDGYDAFENTNNKK
FT                   KRKIPTPGNMGSHHSSLSPEFATMALANPGQQGSASSGEGGHVSTFYGTGSPASPVGSG
FT                   MSGSGRGRLGRQGRRSSIHGHITWSSQNRGAGRRDGPLSSPGPTGESGARNQGIISAAI
FT                   ASAAASAFSPSAFKTSAQGSMLEQQTTPTRTQFTFTCESDSSKGMALHAQNPHSAQQRS
FT                   PIAESQQGNNPRGLSTQGTQTSPTVTAQMSQQSNPQQQPPPSHQPQASTELPAERKKKR
FT                   SPGSIYMLAARQRKIQQQYANLHHPPSLQDIWICEFCEYESIFGRPPEALIRQYEIKDR
FT                   KERKRLAEKKRLLEKAKMKGRKHKKAPKNATKHTAAQHAAYDHGYDRVSVDHSSVGEGP
FT                   HHDDWGHEYDNEATTAGPPATPEGTFKSPLPPGSAAKKPTAAPLGGRGAVEGGLKPP"
FT   gene            1296522..1297073
FT                   /locus_tag="ANIA_10588"
FT                   /old_locus_tag="AN10588.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            1296522..1297073
FT                   /locus_tag="ANIA_10588"
FT                   /old_locus_tag="AN10588.4"
FT                   /note="transcript_id=CADANIAT00005739"
FT   CDS_pept        1296522..1297073
FT                   /locus_tag="ANIA_10588"
FT                   /old_locus_tag="AN10588.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005739"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005739"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005739"
FT                   /db_xref="GOA:C8VAY5"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAY5"
FT                   /protein_id="CBF76987.1"
FT                   /translation="MSKRAKIKALLSTALAVVQFAFGLAVIGLYSQDINTARDNGDSAP
FT                   SRWVYAVVTAFLSTVTAFLYLVLGWWWKKRSKPSFSQRAGLFLPLFAWESVLVILWLVV
FT                   FGIFGEMYIGVYHVGGKDGGESKVTRMRRAVWVDLACLVLWVLSGAWRGVRWWKAKGMG
FT                   QGVGFFRRRADVESGEKEMA"
FT   gene            complement(1297139..1299449)
FT                   /locus_tag="ANIA_04692"
FT                   /old_locus_tag="AN4692.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(1297139..1298345,1298403..1299272,
FT                   1299338..1299449))
FT                   /locus_tag="ANIA_04692"
FT                   /old_locus_tag="AN4692.4"
FT                   /note="transcript_id=CADANIAT00005740"
FT   CDS_pept        complement(join(1297273..1298345,1298403..1299272,
FT                   1299338..1299449))
FT                   /locus_tag="ANIA_04692"
FT                   /old_locus_tag="AN4692.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005740"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005740"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005740"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B438"
FT                   /protein_id="CBF76988.1"
FT                   /translation="METLPKGLIAVSEKVSEGLDDLDLDVVDIGDIVQLWKACSINPSA
FT                   HEGDAGYRLQNLFWRIWGSKRLSSSLTGSALSRLFLQISEPASTPTPANRSTTFTSPSF
FT                   RPPAKTEEKVGTRTHRHFPCDHAAAVTVADLQMQESEPLSSSLKRDEQHPKNQHQHQKQ
FT                   QRPPSHGKSQSHPTPGASNSGTKPLQPVLKKSNSSSHGEVQKTTRLLLTGLGGQSVTRK
FT                   PSNPPTPIPPSRPILFGEPQAPGATSRAGQKKTFAVASKAKAKTPKRRPVLMRRKSSQQ
FT                   SSVSVSSTRTHSPQTDFGDLPSIDSDNDKTNTAAVLDEDAVEDSPDEMITTRIAPITTP
FT                   NPNPSTSSTISTTITDKSTSTSSTPAPFPPLPSEEQTFEPDEMTKPALPSPFIQDLKTL
FT                   MHKNTPLPPLRPHASPPTVGFFSATACRHFDVRHLSEENYEQPNSSELVAPDFRTRFAE
FT                   QKRIADEYYAQLYRRNAEQGGQEQNDSYGQGQGQVALGLFAQNTNLHPADEVDGAGSPG
FT                   AGTTTEETETISPSKSRFGDSHSHTQSHGASTVATSILTGGSASAGPDIYHGAQGADTA
FT                   TGMLTGMDPASIQGHDRNQELGIEHGHRDEHQYGSVKASANAATSAMAVPMSVPGTGNL
FT                   FSTPPGLSLPRGRGGLSLLIEQSRHSMVSQEMGKLTTTGPEKERSDKGQ"
FT   gene            complement(1302442..1303727)
FT                   /locus_tag="ANIA_04691"
FT                   /old_locus_tag="AN4691.4"
FT                   /product="D-arabinitol dehydrogenase (EC 1.1.1.250)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q6T5L8]"
FT   mRNA            complement(join(1302442..1302622,1302687..1303112,
FT                   1303172..1303277,1303364..1303727))
FT                   /locus_tag="ANIA_04691"
FT                   /old_locus_tag="AN4691.4"
FT                   /note="transcript_id=CADANIAT00005741"
FT   CDS_pept        complement(join(1302442..1302622,1302687..1303112,
FT                   1303172..1303277,1303364..1303727))
FT                   /locus_tag="ANIA_04691"
FT                   /old_locus_tag="AN4691.4"
FT                   /product="D-arabinitol dehydrogenase (EC 1.1.1.250)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q6T5L8]"
FT                   /note="transcript_id=CADANIAT00005741"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005741"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005741"
FT                   /db_xref="GOA:Q5B439"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B439"
FT                   /protein_id="CBF76990.1"
FT                   /translation="MFRPAILRQVVRAVDQSTRPAALVAGPHQFIRPLSTTVSRAQRDD
FT                   KNDPLTKATTKAPGGAAGEHEGKYARTDENVVIEYPDDADMPRSPVVQGRGGMHFKRTL
FT                   AQFSLENRVTLVTGGARVSPEVTVANSIPGDEAEESARKLVEQFQKENPGLEQLPNVTA
FT                   HYADVSNPDSVNNALSEVIAKHGKIDHLVTSAGFTENFDAISYPYDRMQKLWGVNVDGT
FT                   YLFATGVAKHLMERKAPGSIVMIGSMSGAIVNVPQPQAPYNAAKAAVRHLASSFAVEWA
FT                   GHGIRVNCISPGYMLTALTRKILDENPELRDKWISLIPTGKMGVPEDLMGAVTFLLSDA
FT                   SKYITGADLRVDGGYTLT"
FT   gene            complement(1305974..1308803)
FT                   /locus_tag="ANIA_04690"
FT                   /old_locus_tag="AN4690.4"
FT                   /product="3-methylcrotonyl-CoA carboxylase biotin-containig
FT                   subunit3-methylcrotonyl-CoA carboxylase biotin-containing
FT                   subunit (EC 6.4.1.4);(EC 6.4.1.4)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q6T5L7]"
FT   mRNA            complement(join(1305974..1306150,1306458..1308075,
FT                   1308131..1308228,1308284..1308482,1308527..1308803))
FT                   /locus_tag="ANIA_04690"
FT                   /old_locus_tag="AN4690.4"
FT                   /note="transcript_id=CADANIAT00005742"
FT   CDS_pept        complement(join(1306085..1306150,1306458..1308075,
FT                   1308131..1308228,1308284..1308482,1308527..1308684))
FT                   /locus_tag="ANIA_04690"
FT                   /old_locus_tag="AN4690.4"
FT                   /product="3-methylcrotonyl-CoA carboxylase biotin-containig
FT                   subunit3-methylcrotonyl-CoA carboxylase biotin-containing
FT                   subunit (EC 6.4.1.4);(EC 6.4.1.4)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q6T5L7]"
FT                   /note="transcript_id=CADANIAT00005742"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005742"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005742"
FT                   /db_xref="GOA:Q5B440"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B440"
FT                   /protein_id="CBF76992.1"
FT                   /translation="MPLSSLLRTSARLGQTVVARRSRRTASTVTSNSSSNFRALDSILI
FT                   ANRGEIALRVGRTAAQHGIRVTTLYTDPDSQAQHALSTPYAFNLGSVSAYLDGDRIIEI
FT                   AKAQGCQGIHPGYGFLSENSEFARKCTEAGLVFIGPPWKAIEDMGDKSQSKHIMTAAGV
FT                   PCVPGYHGENQDPNFLEAEADKIKYPVLIKAIKGGGGKGMRIARSKEEFQAQLQSAKSE
FT                   AMNSFGDDHVLVEKYITTPRHIEVQVFADKHGNCVALGERDCSIQRRHQKILEESPAPH
FT                   LPDATRKDIWAKARSAALAVRYEGAGTVEFIFDNDTGEFFFMEMNTRLQVEHPVTEMVT
FT                   GQDLVHWQLKVAEGAELPLTQEEVEANIATHGHAIEARIYAENPAQGFIPDSGALLHVR
FT                   TPATTEDVRIDAGFVQGDEVSAHYDPMIAKLIVRGADRQEAIRKLAAALEEYEVAGPAT
FT                   NIEFLKSVCKSADFISGKVETGYIEKHHDELFAQSPIEPEVLAQVALACLHDDARLAAQ
FT                   KATNFQGSAVGFGPGFQQHHMTFTNSASANNEAFDVKVQQTGENVFNVKIGEHTFEQVT
FT                   SHPNADFRIITSFFPHTRLDTTVIRDGDSIVVFQRGRQYRLTTPRAKWMEKALGMKDVT
FT                   NSVLAPMPCKVLRVEVQAGDTVEKDQPLVVIESMKMETVIRSPQRGKIAKVVHQKGDQC
FT                   KSGTPLVEFAGEDEEASK"
FT   gene            1309149..1310257
FT                   /locus_tag="ANIA_04689"
FT                   /old_locus_tag="AN4689.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1309149..1309271,1309334..1310257)
FT                   /locus_tag="ANIA_04689"
FT                   /old_locus_tag="AN4689.4"
FT                   /note="transcript_id=CADANIAT00005743"
FT   CDS_pept        join(1309182..1309271,1309334..1310257)
FT                   /locus_tag="ANIA_04689"
FT                   /old_locus_tag="AN4689.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00005743"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005743"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005743"
FT                   /db_xref="GOA:Q5B441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B441"
FT                   /protein_id="CBF76994.1"
FT                   /translation="MSDDEDDYYEYDEFEDDGIFWVEEADPTAADDLAAAATYDSSFPD
FT                   DPSLETADLYSDWEEISDDYYDDDPTVVRRLRAIGAWPIDQPTHINAPSSKRRKGAATL
FT                   AADLTSFQGVAWKHPQDETDVVEIYAPGDGEKVSLLKNWREVFRDAKPAIGRLRGRIPP
FT                   SKTLDVVSSEQSESDLDVPSLVEDNIEDEMGSLDAAEALPANMLPTRIHSQVVIETPSR
FT                   ESSVHSKKGKLEELKNILEPVIEDQGTTTNGAATEYPAEEAKEPTATAPQRGRKRKASI
FT                   SVDDQLDQSGNNTGAERQTRAKRAATTKFSQNKTLLTAEPAPASSAPVRRSARHKK"
FT   gene            complement(1310403..1312040)
FT                   /locus_tag="ANIA_04688"
FT                   /old_locus_tag="AN4688.4"
FT                   /product="Isovaleryl-coenzyme A dehydrogenase (EC
FT                   1.3.99.10) [Source:UniProtKB/TrEMBL;Acc:Q6T5L6]"
FT   mRNA            complement(join(1310403..1310817,1310885..1311162,
FT                   1311212..1311447,1311511..1311605,1311665..1311752,
FT                   1311809..1312040))
FT                   /locus_tag="ANIA_04688"
FT                   /old_locus_tag="AN4688.4"
FT                   /note="transcript_id=CADANIAT00005744"
FT   CDS_pept        complement(join(1310403..1310817,1310885..1311162,
FT                   1311212..1311447,1311511..1311605,1311665..1311752,
FT                   1311809..1311992))
FT                   /locus_tag="ANIA_04688"
FT                   /old_locus_tag="AN4688.4"
FT                   /product="Isovaleryl-coenzyme A dehydrogenase (EC
FT                   1.3.99.10) [Source:UniProtKB/TrEMBL;Acc:Q6T5L6]"
FT                   /note="transcript_id=CADANIAT00005744"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005744"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005744"
FT                   /db_xref="GOA:Q5B442"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B442"
FT                   /protein_id="CBF76996.1"
FT                   /translation="MATIRLPLLIRRSLPTRAPARFTRPLIPCVRTLATTKHPRGFVPP
FT                   TEDDLLELRESVQEFTKREIPEEVAARTDAQNEFPAEMWKKLGNAGFLGVTADEEYGGL
FT                   GMGYQAHCVVMEEISRASGSIALSYAAHSQLCVNQLSLNGTPEQKARFLPGLLSGEKIG
FT                   ALAMSEHSAGSDVVSMKTSAKEVDGGWVLNGTKMWITNGPDADYIVVYAKTEPEKGSKG
FT                   ITAFVVEKTFKGFSCARKLDKLGMRGSNTGELIFEDVFVPRENLLGEVNRGVKVLMEGL
FT                   DLERLVLSAGPLGIMQAALDLVLPYTHVRKQFGAPIAHNQLIQGKLADMHTKLAASRAY
FT                   TYATARHIDSHASLGSAAIRTQDCAGAILYAAERATECALDAIQLMGGNGYINEIPAGR
FT                   LLRDAKLYEIGAGTSEIRRMVIGRAFNKEYAQ"
FT   gene            1312243..1314224
FT                   /locus_tag="ANIA_04687"
FT                   /old_locus_tag="AN4687.4"
FT                   /product="Non-biotin containing subunit of
FT                   3-methylcrotonyl-CoA carboxylase (EC 6.4.1.4)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q6T5L5]"
FT   mRNA            join(1312243..1313849,1313930..1314224)
FT                   /locus_tag="ANIA_04687"
FT                   /old_locus_tag="AN4687.4"
FT                   /note="transcript_id=CADANIAT00005745"
FT   CDS_pept        join(1312378..1313849,1313930..1314224)
FT                   /locus_tag="ANIA_04687"
FT                   /old_locus_tag="AN4687.4"
FT                   /product="Non-biotin containing subunit of
FT                   3-methylcrotonyl-CoA carboxylase (EC 6.4.1.4)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q6T5L5]"
FT                   /note="transcript_id=CADANIAT00005745"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005745"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005745"
FT                   /db_xref="GOA:C8VAZ1"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAZ1"
FT                   /protein_id="CBF76998.1"
FT                   /translation="MRVSVPLHSIRRSCNSSIANAATRLTPQRLYLSYGRRSSIVQAHP
FT                   RTQARPIASYTHPHHASAISVLSTAVDTSSPDFRENERQMQEVLNRMNSLHSTISQGGP
FT                   QKAKDKHVARGKMLPRDRVSALIDPGTSFLELSQLAGHEVYPGEDVPAGGIITGIGTVE
FT                   GVTCMIVANDSTVKGGTYYPVTVKKHLRAQAIAQENKLPCIYLVDSGGANLPHQADVFP
FT                   DKEHFGRIFFNQARMSSQGIPQISVVMGPCTAGGAYVPAMSDETIIVENQGTIFLAGPP
FT                   LVKAATGEVVSAEDLGGGQLHSTISGVTDYLAVDDAHAIVLARRSISNLNYPKAKQPLE
FT                   SNDDIKEPLYDPAELNGIVGTNLRRQIPVHEVIARIVDGSEFAEFKRDYGTTLVTGFAR
FT                   IHGHRVGIVANNGILFSESSLKGAHFIELCAQRNIPLVFLQNISGFMVGADAEKGGIAK
FT                   NGAKLVTAVACADVPKFTVVFGSSAGAGNYGMCGRAYSPRFLFMWPNAKIGVMGSEQLS
FT                   SVMEAVGRTADPELKARIDRESEATFSSARLWDDGIIPPAHTRHVLGLSLAAALGGKSD
FT                   KDVQTKFGVFRM"
FT   gene            complement(1314623..1316010)
FT                   /locus_tag="ANIA_04686"
FT                   /old_locus_tag="AN4686.4"
FT                   /product="ChitosanasePutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q6T5L4]"
FT   mRNA            complement(1314623..1316010)
FT                   /locus_tag="ANIA_04686"
FT                   /old_locus_tag="AN4686.4"
FT                   /note="transcript_id=CADANIAT00005746"
FT   CDS_pept        complement(1315048..1316010)
FT                   /locus_tag="ANIA_04686"
FT                   /old_locus_tag="AN4686.4"
FT                   /product="ChitosanasePutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q6T5L4]"
FT                   /note="transcript_id=CADANIAT00005746"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005746"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005746"
FT                   /db_xref="GOA:G5EB46"
FT                   /db_xref="InterPro:IPR009939"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB46"
FT                   /protein_id="CBF77000.1"
FT                   /translation="MFFEIAKTLTLALAITAPVIAKKVHPSAFAASKAIDVAAISSASE
FT                   KVKQVPAHATYPMSIKDFKDKSTIHSDWASFAEGAAFVFRADMDTDCDGVNYKCDGNVD
FT                   GGPLTNWGALSAFEVPYIVIPQAFLEANPTAIPGQNVAAVICNNKMFYAVLGDTNGNNP
FT                   QVTGEASWLLARSCFPENNLNGNRGHDKADVIYILFTGPEAVFPPSAINEHYITDFSKL
FT                   RSMGNRLTASLMKNLGIKPLGASGLSPPKDDNLHAGNHDDIPILPDIPQENGDVPNDNQ
FT                   GSTDTGSDDNDDIDSAASGGATPEILALFVAVLVMVIYV"
FT   gene            complement(1317379..1318829)
FT                   /locus_tag="ANIA_04685"
FT                   /old_locus_tag="AN4685.4"
FT                   /product="RAS small monomeric GTPase (Rsr1), putative
FT                   (AFU_orthologue; AFUA_5G08950)"
FT   mRNA            complement(join(1317379..1317785,1317943..1317971,
FT                   1318037..1318059,1318111..1318190,1318271..1318297,
FT                   1318369..1318400,1318481..1318829))
FT                   /locus_tag="ANIA_04685"
FT                   /old_locus_tag="AN4685.4"
FT                   /note="transcript_id=CADANIAT00005747"
FT   CDS_pept        complement(join(1317379..1317785,1317943..1317971,
FT                   1318037..1318059,1318111..1318190,1318271..1318297,
FT                   1318369..1318400,1318481..1318491))
FT                   /locus_tag="ANIA_04685"
FT                   /old_locus_tag="AN4685.4"
FT                   /product="RAS small monomeric GTPase (Rsr1), putative
FT                   (AFU_orthologue; AFUA_5G08950)"
FT                   /note="transcript_id=CADANIAT00005747"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005747"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005747"
FT                   /db_xref="GOA:C8VAZ3"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8VAZ3"
FT                   /protein_id="CBF77002.1"
FT                   /translation="MRPQREYHIVVLGAGGVGKSCLTAQFVQNVWIESYDPTIEDSYRK
FT                   HIEVDGRQCILEILDTAGTEQFSQGFLLVFSITSMSSLNELAELREQIVRIKDDENVPI
FT                   VIVGNKSDLEEDRAVPRARAFSLSQSWGSAPYYETSARRRANVNEVFIDLCRQIIRKDA
FT                   QGRSEDYELAPRKRENTSRQERKRGKRREPKRKGPCVIL"
FT   gene            complement(1320474..1321926)
FT                   /locus_tag="ANIA_04684"
FT                   /old_locus_tag="AN4684.4"
FT                   /product="triglyceride lipase-cholesterol esterase,
FT                   putative (AFU_orthologue; AFUA_5G08960)"
FT   mRNA            complement(join(1320474..1321756,1321812..1321926))
FT                   /locus_tag="ANIA_04684"
FT                   /old_locus_tag="AN4684.4"
FT                   /note="transcript_id=CADANIAT00005748"
FT   CDS_pept        complement(join(1320474..1321756,1321812..1321926))
FT                   /locus_tag="ANIA_04684"
FT                   /old_locus_tag="AN4684.4"
FT                   /product="triglyceride lipase-cholesterol esterase,
FT                   putative (AFU_orthologue; AFUA_5G08960)"
FT                   /note="transcript_id=CADANIAT00005748"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005748"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005748"
FT                   /db_xref="GOA:Q5B446"
FT                   /db_xref="InterPro:IPR006693"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B446"
FT                   /protein_id="CBF77004.1"
FT                   /translation="MARVPFIGRLFWFEYLTLFGSLILVLLEWIIHIITFCLPELIINF
FT                   CYERSKTIFNLVITPERPEKQGRRKRRASAVAHASDFAEICSIYGYEAEEHIVQTGDGY
FT                   LLGLHRLPHRKGEESQTVNQGEGSTKKKVVYLHHGLMMCSEVWVCLTDEERCLPFQLVE
FT                   RGYDVWLGNNRGNKYSKKSTRHSPLSNEFWDFSIDQFAFHDIPDSINYILDLTGQPSLS
FT                   YIGFSQGTAQAFATLSIHPQLNQKIDVFVALAPAMAPARISNPVVDSLMKASPNFLFLL
FT                   FGRRSILSSTTMWQTILYPPIFMRIIDTSLSFLFNWKCKNISHDQKLAGYLHLFSFTST
FT                   KSVVHWFQIIRNRNFQFYDDEIYAPFSIVASERFYKPVKYPTKNIKTPIVLLYGGSDSL
FT                   VDIDVMQKELPRGTTAKIITKYEHLDFLWASDVSELVFGHVFEALDRYGPTKRLPDGSV
FT                   NGLINGA"
FT   gene            complement(1323110..1324651)
FT                   /locus_tag="ANIA_04683"
FT                   /old_locus_tag="AN4683.4"
FT                   /product="oligosaccharyl transferase subunit (beta),
FT                   putative (AFU_orthologue; AFUA_5G08970)"
FT   mRNA            complement(join(1323110..1323538,1323584..1324284,
FT                   1324338..1324448,1324510..1324651))
FT                   /locus_tag="ANIA_04683"
FT                   /old_locus_tag="AN4683.4"
FT                   /note="transcript_id=CADANIAT00005749"
FT   CDS_pept        complement(join(1323110..1323538,1323584..1324284,
FT                   1324338..1324448,1324510..1324651))
FT                   /locus_tag="ANIA_04683"
FT                   /old_locus_tag="AN4683.4"
FT                   /product="oligosaccharyl transferase subunit (beta),
FT                   putative (AFU_orthologue; AFUA_5G08970)"
FT                   /note="transcript_id=CADANIAT00005749"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00005749"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00005749"
FT                   /db_xref="GOA:Q5B447"
FT                   /db_xref="InterPro:IPR005013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B447"
FT                   /protein_id="CBF77006.1"
FT                   /translation="MRWCSSLLLFGFLAAVNALSSSGSRLLVVLEDATEKGLYSTLWGD
FT                   LEGRGYNLIFESPKNEQLSLFELGERAYDHVLLLPPKSKGFGPSLSPKNLVDFLNSEGN
FT                   ILLALSGKSTTPSAVSSLLLEFDLHLSTDRSSITVDHFNYDTLSASEKHDVLLLERPGK
FT                   LRYDTKEFFSGEGVVAVPSASPHTLGDNSLLAPILRAPATAYSYNPKEDTGSVEDVFAT
FT                   GSQLALVSAMQARNSARFTVLGSVETLQDKWFSATVKAPGGEEVQTVNREFAKQLTAWT
FT                   FKETGVLKVGKIEHHLAKDDLTAEDLNPSIYRIKNETVFSIEISEYNYDGYVPFEVPVN
FT                   DNIQLEFTMLSPFHRLNLQQSATTPNSTIFSTRFTVPDQHGIFSFRVNYKRPFLTNIEE
FT                   KHEVTVRHFAHNEYPRSWKITGGWVWIAGLWSVIVGFLAFVVVWLYSEPATAEKAKTKK
FT                   TQ"
FT   gene            1325042..1325498
FT                   /locus_tag="ANIA_04682"
FT                   /ol