(data stored in ACNUC16935 zone)

EMBL: BN001307

ID   BN001307; SV 1; linear; genomic DNA; STD; FUN; 4492219 BP.
XX
AC   BN001307;
XX
PR   Project:PRJEA40559;
XX
DT   24-SEP-2009 (Rel. 102, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   TPA: Aspergillus nidulans FGSC A4 chromosome VII
XX
KW   Third Party Data; TPA; TPA:reassembly.
XX
OS   Aspergillus nidulans FGSC A4
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RG   the Eurofungbase Aspergillus nidulans re-annotation project
RA   Mabey Gilsenan J.;
RT   ;
RL   Submitted (09-SEP-2009) to the INSDC.
RL   Mabey Gilsenan J.E., School of Medicine, University of Manchester, ERC,
RL   University Hospital of South Manchester, Manchester, M23 9LT, UK
XX
RN   [2]
RP   1-4492219
RA   Russo Wortman J., Mabey Gilsenan J., Joardar V., Deegan J., Clutterbuck J.,
RA   Andersen M.R., Archer D., Bencina M., Braus G., Coutinho P., von Dohren H.,
RA   Doonan J., Driessen A.J.M., Durek P., Espeso E., Fekete E., Flipphi M.,
RA   Garcia Estrada C., Geysens S., Goldman G., de Groot P.W.J., Hansen K.,
RA   Harris S.D., Heinekamp T., Helmstaedt K., Henrissat B., Hofmann G.,
RA   Homan T., Horio T., Horiuchi H., James S., Jones M., Karaffa L.,
RA   Karanyi Z., Kato M., Keller N., Kelly D.E., Kiel J.A.K.W., Kim J-M.,
RA   van der Klei I.J., Klis F.M., Kovalchuk A., Krasevec N., Kubicek C.P.,
RA   Liu B., MacCabe A., Meyer V., Mirabito P., Miskei M., Mos M., Mullins J.,
RA   Nelson D.R., Nielsen J., Oakley B.R., Osmani S.A., Pakula T., Paszewski A.,
RA   Paulsen I., Pilsyk S., Posci I., Punt P.J., Ram A.F.J., Ren Q.,
RA   Robellet X., Robson G., Seiboth B., van Solingen P., Specht T., Sun J.,
RA   Taheri-Talesh N., Takeshita N., Ussery D., vanKuyk P.A., Visser H.,
RA   van der Vondervoot P.J.I., de Vries R.P., Walton J., Xiang X., Xiong Y.,
RA   Ping Zeng A., Brandt B.W., Cornell M.J., van den Hondel C.A.M.J.J.,
RA   Visser J., Oliver S.G., Turner G.;
RT   "The 2008 update of the Aspergillus nidulans genome annotation: A community
RT   effort";
RL   Fungal Genet. Biol. 46(1):S2-S13(2009).
XX
DR   MD5; e08c5b166ddd2aec5c310cfc14d79eb0.
DR   BioSample; SAMEA2272224.
DR   EnsemblGenomes-Gn; CADANIAG00007897.
DR   EnsemblGenomes-Gn; CADANIAG00007950.
DR   EnsemblGenomes-Gn; CADANIAG00008003.
DR   EnsemblGenomes-Gn; CADANIAG00009067.
DR   EnsemblGenomes-Gn; CADANIAG00010578.
DR   EnsemblGenomes-Gn; CADANIAG00010579.
DR   EnsemblGenomes-Gn; CADANIAG00010580.
DR   EnsemblGenomes-Gn; CADANIAG00010581.
DR   EnsemblGenomes-Gn; CADANIAG00010582.
DR   EnsemblGenomes-Gn; CADANIAG00010583.
DR   EnsemblGenomes-Gn; CADANIAG00010584.
DR   EnsemblGenomes-Gn; CADANIAG00010585.
DR   EnsemblGenomes-Gn; CADANIAG00010586.
DR   EnsemblGenomes-Gn; CADANIAG00010587.
DR   EnsemblGenomes-Gn; CADANIAG00010600.
DR   EnsemblGenomes-Gn; CADANIAG00010609.
DR   EnsemblGenomes-Gn; CADANIAG00010613.
DR   EnsemblGenomes-Gn; CADANIAG00010618.
DR   EnsemblGenomes-Gn; CADANIAG00010627.
DR   EnsemblGenomes-Gn; CADANIAG00010628.
DR   EnsemblGenomes-Gn; CADANIAG00010635.
DR   EnsemblGenomes-Gn; CADANIAG00010636.
DR   EnsemblGenomes-Gn; CADANIAG00010639.
DR   EnsemblGenomes-Gn; CADANIAG00010654.
DR   EnsemblGenomes-Gn; CADANIAG00010657.
DR   EnsemblGenomes-Gn; CADANIAG00010658.
DR   EnsemblGenomes-Gn; CADANIAG00010661.
DR   EnsemblGenomes-Gn; CADANIAG00010680.
DR   EnsemblGenomes-Gn; CADANIAG00010688.
DR   EnsemblGenomes-Gn; CADANIAG00010700.
DR   EnsemblGenomes-Gn; CADANIAG00010702.
DR   EnsemblGenomes-Gn; CADANIAG00010704.
DR   EnsemblGenomes-Gn; CADANIAG00010708.
DR   EnsemblGenomes-Gn; CADANIAG00010710.
DR   EnsemblGenomes-Gn; CADANIAG00010713.
DR   EnsemblGenomes-Gn; CADANIAG00010715.
DR   EnsemblGenomes-Gn; CADANIAG00010722.
DR   EnsemblGenomes-Gn; CADANIAG00010727.
DR   EnsemblGenomes-Gn; CADANIAG00010730.
DR   EnsemblGenomes-Gn; CADANIAG00010732.
DR   EnsemblGenomes-Gn; CADANIAG00010734.
DR   EnsemblGenomes-Gn; CADANIAG00010735.
DR   EnsemblGenomes-Gn; CADANIAG00010745.
DR   EnsemblGenomes-Gn; CADANIAG00010746.
DR   EnsemblGenomes-Gn; CADANIAG00010748.
DR   EnsemblGenomes-Gn; CADANIAG00010750.
DR   EnsemblGenomes-Gn; CADANIAG00010758.
DR   EnsemblGenomes-Gn; CADANIAG00010780.
DR   EnsemblGenomes-Gn; CADANIAG00010784.
DR   EnsemblGenomes-Gn; CADANIAG00010785.
DR   EnsemblGenomes-Gn; CADANIAG00010800.
DR   EnsemblGenomes-Gn; CADANIAG00010801.
DR   EnsemblGenomes-Gn; CADANIAG00010805.
DR   EnsemblGenomes-Gn; CADANIAG00010813.
DR   EnsemblGenomes-Gn; CADANIAG00010825.
DR   EnsemblGenomes-Gn; ENSRNA049496523.
DR   EnsemblGenomes-Gn; ENSRNA049496526.
DR   EnsemblGenomes-Gn; ENSRNA049496529.
DR   EnsemblGenomes-Gn; ENSRNA049496536.
DR   EnsemblGenomes-Gn; ENSRNA049496543.
DR   EnsemblGenomes-Gn; ENSRNA049496545.
DR   EnsemblGenomes-Gn; ENSRNA049496560.
DR   EnsemblGenomes-Gn; ENSRNA049496563.
DR   EnsemblGenomes-Gn; ENSRNA049524436.
DR   EnsemblGenomes-Gn; ENSRNA049524450.
DR   EnsemblGenomes-Gn; ENSRNA049524472.
DR   EnsemblGenomes-Gn; ENSRNA049524492.
DR   EnsemblGenomes-Gn; ENSRNA049524508.
DR   EnsemblGenomes-Gn; ENSRNA049524529.
DR   EnsemblGenomes-Gn; ENSRNA049524549.
DR   EnsemblGenomes-Gn; ENSRNA049524570.
DR   EnsemblGenomes-Gn; ENSRNA049524608.
DR   EnsemblGenomes-Gn; ENSRNA049524629.
DR   EnsemblGenomes-Gn; ENSRNA049524660.
DR   EnsemblGenomes-Gn; ENSRNA049524693.
DR   EnsemblGenomes-Gn; ENSRNA049524719.
DR   EnsemblGenomes-Gn; ENSRNA049524744.
DR   EnsemblGenomes-Gn; ENSRNA049524773.
DR   EnsemblGenomes-Gn; ENSRNA049524798.
DR   EnsemblGenomes-Gn; ENSRNA049524821.
DR   EnsemblGenomes-Gn; ENSRNA049524847.
DR   EnsemblGenomes-Gn; ENSRNA049524866.
DR   EnsemblGenomes-Gn; ENSRNA049524900.
DR   EnsemblGenomes-Gn; ENSRNA049524922.
DR   EnsemblGenomes-Gn; ENSRNA049524946.
DR   EnsemblGenomes-Gn; ENSRNA049524970.
DR   EnsemblGenomes-Gn; ENSRNA049524993.
DR   EnsemblGenomes-Gn; ENSRNA049525008.
DR   EnsemblGenomes-Gn; ENSRNA049525027.
DR   EnsemblGenomes-Gn; ENSRNA049525047.
DR   EnsemblGenomes-Gn; ENSRNA049525063.
DR   EnsemblGenomes-Gn; ENSRNA049525075.
DR   EnsemblGenomes-Gn; ENSRNA049525106.
DR   EnsemblGenomes-Tr; CADANIAT00007897.
DR   EnsemblGenomes-Tr; CADANIAT00007950.
DR   EnsemblGenomes-Tr; CADANIAT00008003.
DR   EnsemblGenomes-Tr; CADANIAT00009067.
DR   EnsemblGenomes-Tr; CADANIAT00010578.
DR   EnsemblGenomes-Tr; CADANIAT00010579.
DR   EnsemblGenomes-Tr; CADANIAT00010580.
DR   EnsemblGenomes-Tr; CADANIAT00010581.
DR   EnsemblGenomes-Tr; CADANIAT00010582.
DR   EnsemblGenomes-Tr; CADANIAT00010583.
DR   EnsemblGenomes-Tr; CADANIAT00010584.
DR   EnsemblGenomes-Tr; CADANIAT00010585.
DR   EnsemblGenomes-Tr; CADANIAT00010586.
DR   EnsemblGenomes-Tr; CADANIAT00010587.
DR   EnsemblGenomes-Tr; CADANIAT00010600.
DR   EnsemblGenomes-Tr; CADANIAT00010609.
DR   EnsemblGenomes-Tr; CADANIAT00010613.
DR   EnsemblGenomes-Tr; CADANIAT00010618.
DR   EnsemblGenomes-Tr; CADANIAT00010627.
DR   EnsemblGenomes-Tr; CADANIAT00010628.
DR   EnsemblGenomes-Tr; CADANIAT00010635.
DR   EnsemblGenomes-Tr; CADANIAT00010636.
DR   EnsemblGenomes-Tr; CADANIAT00010639.
DR   EnsemblGenomes-Tr; CADANIAT00010654.
DR   EnsemblGenomes-Tr; CADANIAT00010657.
DR   EnsemblGenomes-Tr; CADANIAT00010658.
DR   EnsemblGenomes-Tr; CADANIAT00010661.
DR   EnsemblGenomes-Tr; CADANIAT00010680.
DR   EnsemblGenomes-Tr; CADANIAT00010688.
DR   EnsemblGenomes-Tr; CADANIAT00010700.
DR   EnsemblGenomes-Tr; CADANIAT00010702.
DR   EnsemblGenomes-Tr; CADANIAT00010704.
DR   EnsemblGenomes-Tr; CADANIAT00010708.
DR   EnsemblGenomes-Tr; CADANIAT00010710.
DR   EnsemblGenomes-Tr; CADANIAT00010713.
DR   EnsemblGenomes-Tr; CADANIAT00010715.
DR   EnsemblGenomes-Tr; CADANIAT00010722.
DR   EnsemblGenomes-Tr; CADANIAT00010727.
DR   EnsemblGenomes-Tr; CADANIAT00010730.
DR   EnsemblGenomes-Tr; CADANIAT00010732.
DR   EnsemblGenomes-Tr; CADANIAT00010734.
DR   EnsemblGenomes-Tr; CADANIAT00010735.
DR   EnsemblGenomes-Tr; CADANIAT00010745.
DR   EnsemblGenomes-Tr; CADANIAT00010746.
DR   EnsemblGenomes-Tr; CADANIAT00010748.
DR   EnsemblGenomes-Tr; CADANIAT00010750.
DR   EnsemblGenomes-Tr; CADANIAT00010758.
DR   EnsemblGenomes-Tr; CADANIAT00010780.
DR   EnsemblGenomes-Tr; CADANIAT00010784.
DR   EnsemblGenomes-Tr; CADANIAT00010785.
DR   EnsemblGenomes-Tr; CADANIAT00010800.
DR   EnsemblGenomes-Tr; CADANIAT00010801.
DR   EnsemblGenomes-Tr; CADANIAT00010805.
DR   EnsemblGenomes-Tr; CADANIAT00010813.
DR   EnsemblGenomes-Tr; CADANIAT00010825.
DR   EuropePMC; PMC3323652; 22506079.
DR   GOA; Q5BBC6.
DR   InterPro; IPR007318; Phopholipid_MeTrfase.
DR   InterPro; IPR016219; Phosphatid-EA_MeTrfase_fun.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00335; snoZ13_snr52.
DR   RFAM; RF00472; snosnR55.
DR   RFAM; RF00476; snosnR61.
DR   RFAM; RF01512; Afu_309.
DR   StrainInfo; 598196; 0.
DR   UniProtKB/Swiss-Prot; Q5BBC6; CHO2_EMENI.
XX
CC   Aspergillus nidulans FGSC A4 CADRE,
CC   updated by Eurofungbase with contributions from
CC   CADRE (http://www.cadre-genomes.org.uk),
CC   AspGD (http://www.aspergillusgenome.org) and
CC     Ensembl Genomes (http://www.ensemblgenomes.org).
XX
AH   LOCAL_SPAN       PRIMARY_IDENTIFIER   PRIMARY_SPAN   COMP
AS   1-6997           AACD01000200.1       505-7501       c
AS   6998-11779       AACD01000219.1       1586-6367      c
AS   11780-241084     AACD01000168.1       1-229305       c
AS   241185-282429    AACD01000167.1       728-41972      c
AS   282430-323292    AACD01000166.1       664-41526      c
AS   323293-332704    AACD01000178.1       2908-12319     c
AS   332705-446765    AACD01000165.1       538-114598     c
AS   446766-461863    AACD01000176.1       634-15731      c
AS   461864-612117    AACD01000164.1       1-150254       c
AS   612218-632097    AACD01000175.1       1-19880
AS   632098-907665    AACD01000022.1       729-276296
AS   907666-912647    AACD01000224.1       1-4982         c
AS   912648-978457    AACD01000023.1       1215-67024
AS   978458-984153    AACD01000213.1       1-5696         c
AS   984154-1027452   AACD01000024.1       227-43525
AS   1027453-1255349  AACD01000025.1       1206-229102
AS   1255350-1265616  AACD01000182.1       354-10620
AS   1265617-1654585  AACD01000026.1       403-389371
AS   1654686-1768449  AACD01000027.1       1-113764
AS   1768550-1867447  AACD01000028.1       1-98898
AS   1867548-2393434  AACD01000029.1       1-525887
AS   2393435-2482748  AACD01000030.1       489-89802
AS   2482849-2485338  AACD01000031.1       1-2490
AS   2485439-2921428  AACD01000032.1       1-435990
AS   2921529-2923677  AACD01000033.1       1-2149
AS   2923678-2925097  AACD01000244.1       1681-3100
AS   2925098-3101054  AACD01000034.1       1319-177275
AS   3101155-3185227  AACD01000035.1       1-84073
AS   3185228-3282054  AACD01000036.1       75-96901
AS   3282055-3285210  AACD01000241.1       1-3156         c
AS   3285211-3359990  AACD01000037.1       567-75346
AS   3359991-3592808  AACD01000038.1       569-233386
AS   3592809-3595597  AACD01000242.1       998-3786
AS   3595598-3834869  AACD01000039.1       809-240080
AS   3834970-3841059  AACD01000220.1       1-6090
AS   3841060-3991421  AACD01000040.1       402-150763
AS   3991422-4054554  AACD01000041.1       1170-64302
AS   4054555-4153800  AACD01000042.1       328-99573
AS   4153801-4492219  AACD01000043.1       127-338545
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4492219
FT                   /organism="Aspergillus nidulans FGSC A4"
FT                   /chromosome="VII"
FT                   /strain="FGSC A4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:227321"
FT   misc_feature    1..6997
FT                   /note="contig 1.200 505..7501(-1)"
FT   gene            2167..2471
FT                   /locus_tag="ANIA_11671"
FT                   /old_locus_tag="AN11671.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(2167..2192,2227..2295,2349..2372,2426..2471)
FT                   /locus_tag="ANIA_11671"
FT                   /old_locus_tag="AN11671.4"
FT                   /note="transcript_id=CADANIAT00007793"
FT   CDS_pept        join(2167..2192,2227..2295,2349..2372,2426..2471)
FT                   /locus_tag="ANIA_11671"
FT                   /old_locus_tag="AN11671.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007793"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007793"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007793"
FT                   /db_xref="GOA:C8VKN8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKN8"
FT                   /protein_id="CBF84372.1"
FT                   /translation="MKVLTIVATTVIAGVTGIRDLLAEIIGMVMTGGHIGLISGIIGVA
FT                   AEIVKYEWE"
FT   gene            complement(4058..6584)
FT                   /locus_tag="ANIA_09484"
FT                   /old_locus_tag="AN9484.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(4058..4094,4350..5323,5610..5684,
FT                   5717..5769,5842..6011,6229..6584))
FT                   /locus_tag="ANIA_09484"
FT                   /old_locus_tag="AN9484.4"
FT                   /note="transcript_id=CADANIAT00007794"
FT   CDS_pept        complement(join(4058..4094,4350..5323,5610..5684,
FT                   5717..5769,5842..6011,6229..6584))
FT                   /locus_tag="ANIA_09484"
FT                   /old_locus_tag="AN9484.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007794"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007794"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007794"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQE6"
FT                   /protein_id="CBF84373.1"
FT                   /translation="MPRQHSCLKPRLGDIPFQVVTQRPSCRPCTSRRPLSQPEAWVIIR
FT                   VSLSGSPKAIEQDDDILDSVVERQPEMGGHFVARITDKDNAAKAPIRDDSLIQVRQAGP
FT                   QHPRPNILDRDLECQRGGFYHCLLWIVLQGNVVHDPTGPAVNAIGTNGKGPVEHAAVGA
FT                   GHTDYVLGGCDRAQPGESDWVSRLTGNDVGKEENKEQQLLCHPPRIRGLCAPSAFSRIP
FT                   ALYSITAAQTLPPTDENPISGYYISSFLTTTAGNQYYVITAIIGTTELGAYGINILDLN
FT                   TLQRVVYENTTVYSTTEITSFNFTREDFAFFGADSTNLAIAVRANATASRGDGTTVPVG
FT                   LELLVHATSRALYYGGTGSWMFIDTPAYSFAFPAAMTSGCLRMSLSDLSMANKEDADAA
FT                   TTLQPIDPSASVSWYDRSWGHLGLPNGNYTWFSLYLDDSELILVTYLIDDSSTSASSSR
FT                   THRHTHSRSIHIRPRRNSSALSLEPIDVFEPDLSPDTIWMSPRSGRVYPQQWKLGIEGR
FT                   GLLSIRSILGDQEMFGRGQGGESYSGLTQSPAEQPAG"
FT   misc_feature    6998..11779
FT                   /note="contig 1.219 1586..6367(-1)"
FT   gene            8897..9103
FT                   /locus_tag="ANIA_11673"
FT                   /old_locus_tag="AN11673.4"
FT                   /product="hypothetical protein"
FT   mRNA            8897..9103
FT                   /locus_tag="ANIA_11673"
FT                   /old_locus_tag="AN11673.4"
FT                   /note="transcript_id=CADANIAT00007795"
FT   CDS_pept        8897..9103
FT                   /locus_tag="ANIA_11673"
FT                   /old_locus_tag="AN11673.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007795"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007795"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007795"
FT                   /db_xref="GOA:C8VKP0"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKP0"
FT                   /protein_id="CBF84375.1"
FT                   /translation="MASDSFLSLKVSDLEILSYENAETWFTKMQAVLDGKEIWYPVQDI
FT                   YLIRQGLDPLPDVDEDDEFFLPP"
FT   gene            complement(10711..11489)
FT                   /locus_tag="ANIA_09508"
FT                   /old_locus_tag="AN9508.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(10711..11238,11379..11489))
FT                   /locus_tag="ANIA_09508"
FT                   /old_locus_tag="AN9508.4"
FT                   /note="transcript_id=CADANIAT00007796"
FT   CDS_pept        complement(join(10711..11238,11379..11489))
FT                   /locus_tag="ANIA_09508"
FT                   /old_locus_tag="AN9508.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007796"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007796"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007796"
FT                   /db_xref="GOA:Q5AQC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQC2"
FT                   /protein_id="CBF84377.1"
FT                   /translation="MHSMPVVFAAQNPSAVKELHATIQCGVRPKGAGANKKSNNPAYYG
FT                   TKYPWVNEADGLNQDAVHDGFHLSSYLITAKYLFFDTEEGATALNLTTLPSDNQCSQAS
FT                   GFVFPPLVSTLDIPRDFPDHSSLPSTCAQFASLTLISATEVSPCRVNISPESERAFWPT
FT                   ECHNTLLPVSGCLDRTTKDDITGRDHGRAAWAAITLTFALIFGLGLVGY"
FT   misc_feature    11780..241084
FT                   /note="contig 1.168 1..229305(-1)"
FT   gene            13794..17437
FT                   /locus_tag="ANIA_09056"
FT                   /old_locus_tag="AN9056.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(13794..13962,14199..14275,14656..14821,14946..15722,
FT                   15829..15932,15994..16038,16078..16163,16193..16215,
FT                   16712..16806,17230..17271,17328..17333,17420..17437)
FT                   /locus_tag="ANIA_09056"
FT                   /old_locus_tag="AN9056.4"
FT                   /note="transcript_id=CADANIAT00007797"
FT   CDS_pept        join(13794..13962,14199..14275,14656..14821,14946..15722,
FT                   15829..15932,15994..16038,16078..16163,16193..16215,
FT                   16712..16806,17230..17271,17328..17333,17420..17437)
FT                   /locus_tag="ANIA_09056"
FT                   /old_locus_tag="AN9056.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007797"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007797"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007797"
FT                   /db_xref="GOA:Q5ARM4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM4"
FT                   /protein_id="CBF84379.1"
FT                   /translation="MGLFSRDRGEPWDLGIRGLSLAVSGRTPTTIFSSGLTIYPSQCLP
FT                   QDSMLDCYRDRVAAAAMALQRSRMNPRAAIFLNDSHKAVSVQIQPSAAMSSPIPVGVFF
FT                   NIFALRRIRRRETTSSSTDLDSQEIPNVCYETCNGAFLEAAGRGKMAAICADGSTFSDL
FT                   VDQCRQCIELFVNSPSSNSTASASSGSTTAELNEFIAYCDEQGGGSGNSNVTLVKEIDS
FT                   LLASYSSLSSSQSQLQASLSSLGYTGDFPELTSATATGDVTASSTSMVGPTATAGGEDR
FT                   SFSNEGGTGTEDLPSSDTSDINIIAPAVIVPVFALLVGSVLAWALIRRRRKRQGTEEIG
FT                   AAGDSFDDKAQLHADEFRPELDGLAIAKKRLVNMDEDLAELPAREPIGAELDGLGRIPS
FT                   NLGMYNHDRLGALIQFFNITKKPKEFIGSWDNRIVNALNPSSMLTSQEQRDPSPGQLHR
FT                   IGASGNGELYSDSLAMRCSCTVVHKSVMNAQRGKGRRKLHLDLFNPTHETRQEMGWLDL
FT                   SFMQCRLSALRFKYSMIL"
FT   gene            20646..21184
FT                   /locus_tag="ANIA_09055"
FT                   /old_locus_tag="AN9055.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(20646..20903,20993..21184)
FT                   /locus_tag="ANIA_09055"
FT                   /old_locus_tag="AN9055.4"
FT                   /note="transcript_id=CADANIAT00007798"
FT   CDS_pept        join(20646..20903,20993..21184)
FT                   /locus_tag="ANIA_09055"
FT                   /old_locus_tag="AN9055.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007798"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007798"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007798"
FT                   /db_xref="GOA:Q5ARM5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM5"
FT                   /protein_id="CBF84381.1"
FT                   /translation="MQCCVKLVILISHADEIYENPTIFAEQRMYGRGSSVQHQTQTQTQ
FT                   TVAHELMFGKVVQLGVEYLFPGCGDKDPTLGKRDLFVRFQSSVYQPRKMVRYDVHESVR
FT                   IEDKTLETGVEYLIPSPTETGAGSCIGFLDGTELRSLLKAKNPIP"
FT   gene            24502..25603
FT                   /locus_tag="ANIA_09054"
FT                   /old_locus_tag="AN9054.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(24502..24670,24737..25603)
FT                   /locus_tag="ANIA_09054"
FT                   /old_locus_tag="AN9054.4"
FT                   /note="transcript_id=CADANIAT00007799"
FT   CDS_pept        join(24506..24670,24737..25444)
FT                   /locus_tag="ANIA_09054"
FT                   /old_locus_tag="AN9054.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007799"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007799"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007799"
FT                   /db_xref="GOA:Q5ARM6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM6"
FT                   /protein_id="CBF84383.1"
FT                   /translation="MRSSIALVLAVGTAALADFTFDELWALQNTLWDNFLYPANLQQIN
FT                   ATDTSVFAENVQGRVDITRTFDGRELNNEYIFGLFSDPSHLSLVGIPISYNITQFAANQ
FT                   NITSATTVFTFNATSFNILVPITIDTWILYNADGKILQYDATFRWFGWLLDTLLEAAGT
FT                   GIFNTTDPAETQRALGNLLATTICQTHGQHCVDDNQQYNSNEDCVRFLTEDIRFGSAYE
FT                   LGRNTLLCREVHEHMVQYRPTEHCPHIGPDGGGYCVDDKDYAEVVTERYFREPFVPYGY
FT                   GDTNLWVAA"
FT   gene            29725..30510
FT                   /locus_tag="ANIA_09053"
FT                   /old_locus_tag="AN9053.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(29725..29979,30073..30510)
FT                   /locus_tag="ANIA_09053"
FT                   /old_locus_tag="AN9053.4"
FT                   /note="transcript_id=CADANIAT00007800"
FT   CDS_pept        join(29725..29979,30073..30510)
FT                   /locus_tag="ANIA_09053"
FT                   /old_locus_tag="AN9053.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007800"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007800"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007800"
FT                   /db_xref="GOA:Q5ARM7"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM7"
FT                   /protein_id="CBF84384.1"
FT                   /translation="MAEAIKRAEIYGIGMVSVNHSNHFGMAATYVLQALQANMISLVFT
FT                   SSAKQMPPFGGKETPLGIAPFAAGAPSNREVPYILDIAPSTPMSPQRKYGSDRRTKGLG
FT                   SGIAILMDIMSSVLTVAGFGGQVGDRYKDAKPQDAGHCFIAIKPDVCFSVDDLKARMDT
FT                   LVQRVHGVIPAPGFSEVLFPGEPEQRLCLQRRREGIPYADAERKMFTESAKQYGVPELL
FT                   LSETPLSV"
FT   gene            32617..33323
FT                   /locus_tag="ANIA_09052"
FT                   /old_locus_tag="AN9052.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(32617..32673,32730..33116,33171..33323)
FT                   /locus_tag="ANIA_09052"
FT                   /old_locus_tag="AN9052.4"
FT                   /note="transcript_id=CADANIAT00007801"
FT   CDS_pept        join(32617..32673,32730..33116,33171..33323)
FT                   /locus_tag="ANIA_09052"
FT                   /old_locus_tag="AN9052.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007801"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007801"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007801"
FT                   /db_xref="GOA:Q5ARM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM8"
FT                   /protein_id="CBF84386.1"
FT                   /translation="MRTIYITALIAFLALEAFGYPTDTDAVTEPAFPGYEDGTTTFQVV
FT                   PYPDADKITLSGTMQEVHAKILEINPIYEEDWKNVNNTYSKPEPRSDKPPLLNCDGRNG
FT                   YAKIDKINDGISYLRKFKLPPGLEGNTCQMVSCSYDSAISWCNALPTLRVLPSFDNIAD
FT                   GAQVILNWCQVDWDNVGGVLGHPDSWRVFVDKEKC"
FT   gene            complement(34034..35243)
FT                   /locus_tag="ANIA_09051"
FT                   /old_locus_tag="AN9051.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(34034..34165,34216..35243))
FT                   /locus_tag="ANIA_09051"
FT                   /old_locus_tag="AN9051.4"
FT                   /note="transcript_id=CADANIAT00007802"
FT   CDS_pept        complement(join(34123..34165,34216..35243))
FT                   /locus_tag="ANIA_09051"
FT                   /old_locus_tag="AN9051.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007802"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007802"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007802"
FT                   /db_xref="GOA:Q5ARM9"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM9"
FT                   /protein_id="CBF84388.1"
FT                   /translation="MSIPTRALGRNGPEVSSVGLGLMSIGGIYGAAPSDEDRLALLDRA
FT                   HAIGQWFWDTADVYFDSEDIVGIWRAKNPIKAKDIFLASKFGITMRKDGSQTVDTSPEY
FT                   ARIALKRSLERLQTGTIDLYYAHRVDGKTPIEKTVEAMAQFKKSSRLPLVFSRTNTNYR
FT                   EGKIRFLGLSEVSADTLRRAHAVHPITAVQVEYSPFTLDIEDPRVALLETCRELGVAVV
FT                   AYSPVGRGLLTGRYVTRESITKDFFLSVLPRYSEENFPAIQRLYESIKDVAEKKGVTPT
FT                   QATLAWLLAREPFVIPIPGTRSIKYLVENTASAQIQLTDDENRRITEAANATKLVGARY
FT                   PAGFPENYEFGTTPEL"
FT   gene            35747..37363
FT                   /locus_tag="ANIA_09050"
FT                   /old_locus_tag="AN9050.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            35747..37363
FT                   /locus_tag="ANIA_09050"
FT                   /old_locus_tag="AN9050.4"
FT                   /note="transcript_id=CADANIAT00007803"
FT   CDS_pept        35747..37363
FT                   /locus_tag="ANIA_09050"
FT                   /old_locus_tag="AN9050.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007803"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007803"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007803"
FT                   /db_xref="GOA:Q5ARN0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARN0"
FT                   /protein_id="CBF84390.1"
FT                   /translation="MAKRKSTPRTRSGCRTCKVRRVKCDEQRPSCRRCLDTGRACDGYG
FT                   IWGQPKSTRLLPSPVYPLRTLPGLAEEERRCLDRFRVLLTDKLTRPFGSHFWSSLVLQL
FT                   SVSEPAVLHASIALTSAYDSFALAQIRENVAMVAPAPFLLRQYNYAIRALLTNGALESA
FT                   TSVRVATVSCILFICLEILRGNLDAMKVHFAAGIRLLYQLQRQSHRSAATTGTVLVKHD
FT                   PELFDDHIIEVFARLNLQFLMLGHGPQQKESFVPSFRYGRASYLPRRFSAADEARQALS
FT                   PILLSVMHLVMQVERLTRSTHAHPPSPSAVMLEEQKSLQAAVEDWIASYDNSIQSAFAS
FT                   VARQHRLALLMLRTYADVAIILLSTCFTVKETAYDAHLHVFKSIIQRYSDVHSTDCPLQ
FT                   SDTCEVDPTFMIDSGLFPPLYFTALKCRNHATRHQALAILRQYVHMEGPWTGPMLARVA
FT                   GHVVNLEERHFGDILAKATMSTTVSTVLPEFSRIHCVECKLPAQRHQGSNIASLILRRF
FT                   RHELGSAASWWIDKCTIDLSS"
FT   gene            complement(37548..38783)
FT                   /locus_tag="ANIA_09049"
FT                   /old_locus_tag="AN9049.4"
FT                   /product="transesterase (LovD), putative (AFU_orthologue;
FT                   AFUA_5G00920)"
FT   mRNA            complement(join(37548..38647,38693..38783))
FT                   /locus_tag="ANIA_09049"
FT                   /old_locus_tag="AN9049.4"
FT                   /note="transcript_id=CADANIAT00007804"
FT   CDS_pept        complement(join(37548..38647,38693..38783))
FT                   /locus_tag="ANIA_09049"
FT                   /old_locus_tag="AN9049.4"
FT                   /product="transesterase (LovD), putative (AFU_orthologue;
FT                   AFUA_5G00920)"
FT                   /note="transcript_id=CADANIAT00007804"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007804"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007804"
FT                   /db_xref="GOA:Q5ARN1"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARN1"
FT                   /protein_id="CBF84391.1"
FT                   /translation="MSDFDALLAEYTNRENPKAHGVICKCVDRNGNEIYSKVAGYDSLS
FT                   PDAQPLREDAVLRIASATKLITSIALLQCVEKGLVGLDEPISRVLPEFADKQILTDVVG
FT                   SDLVFGPSKVPVTARHLLTHTSGLGYYFTNKLLSLRAEALARAGVKPSLRITDRFDIPL
FT                   VFEPGTGWLYGCSLDWAGVAVSRLNGGISLEQYMVENIWQKLGLSAPFPHFNIARHPGY
FT                   LARAMGGAQQTSDGRLERLDTWSFDNPEDQDGGSGLSCTAKDYVAVLADLVSDSPKLLR
FT                   LETIAEMFRPQLESKSASVDMLLQLRFAWDIVSGPVSGDAVNHGLAGILCLDEVAEIGQ
FT                   PRGMLGWGGASNIVWWVNRERGVAGFFATQQMPFGNATIKNLVNAWKKDFWAGFNA"
FT   gene            complement(39033..43017)
FT                   /locus_tag="ANIA_09048"
FT                   /old_locus_tag="AN9048.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(39033..39247,39301..39415,39464..39665,
FT                   39727..40420,40535..40731,40779..41414,41463..42587,
FT                   42654..42779,42998..43017))
FT                   /locus_tag="ANIA_09048"
FT                   /old_locus_tag="AN9048.4"
FT                   /note="transcript_id=CADANIAT00007805"
FT   CDS_pept        complement(join(39033..39247,39301..39415,39464..39665,
FT                   39727..40420,40535..40731,40779..41414,41463..42587,
FT                   42654..42779,42998..43017))
FT                   /locus_tag="ANIA_09048"
FT                   /old_locus_tag="AN9048.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007805"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007805"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007805"
FT                   /db_xref="GOA:Q5ARN2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARN2"
FT                   /protein_id="CBF84393.1"
FT                   /translation="MALALEDSLWNPTVLSPELILSMQEYLSPALRQPPLPDSEKKRLR
FT                   ELSRYYCAIRPSSVPQDPDATLTQSEPENEPGLNVAQLPSDITLTALTQLGVHRLGCER
FT                   SFASLIDGHSQYIISEATASISLRDREKHSPNDGLYLGNTTLDLVWGVCPHAIKLFSGY
FT                   DVPHLKNTANVTANPTRYIVRDFTQEDCFKDRPYVTGWPHMRFYAEVPIYSPSGHILGG
FT                   YCVVDNKPRQDFSEDEVIALQEISDAIARHLENVRTVHYHRRSDRLIQGLTTFVKDRLH
FT                   ERSPLDAPAPPRAAETPSLERLGLDELPSSTEVTGGTSLLFSTQNAARKSTHATSLSGT
FT                   LHKAVSSPLLNEVVTDTGPSQDTVPLRMNDNSSAKSTPKPVAKDKVPFLRRIENIYAYA
FT                   SSLIRESMDLDGVMFVDASRCNSGSVSLKADMLNWEPLPKNADPRPRSQYSNSAVADET
FT                   ICDTLGLASNETDTQHGIPDSLLRELIAAFPQGGVLLPDADNDNSQLPETRLAKSFPEA
FT                   KSLLFIPLWDWNKGQWLAGTFVWTKDSEQERALGVDELHYFKVFGDSIISEIARLDWSL
FT                   KEKSKFGLISSVSHEIRSPLHGMLANAELLSSSPLQPEQQQTVKALEMCGITLLDTMNH
FT                   LLDFAKINNLASINQTASSVTSLLTSFDLDVLIEEVVSSVFSGMCHAAIALTPPESPSN
FT                   PDTAYKQDSGFVEISVSLLDPPVKTDPDSAVAHLRFTDTGCGMSQEFLRNKLYSPFAQE
FT                   DALAEGAGLGLSIVKQLVSFFKGSIDVKSEIDVGTQVDIQIPVQLAPDDFATGAFGPEL
FT                   GMGLRETTFSLIGLDAYPELSEEPTGSLSSEAKRRICLQSFFTNLLSGKPNWKISSTAT
FT                   LAEADGEIAIVSEAALKQLFVDESLRRRAEKNQTKFVCLCDGLPTLNANGPGGAQVIRL
FT                   YQPYSPRKVLQAIESVMQAKPQPFAGADDQSPPVSKATPPTNPTNDSAPPASGTHGNKV
FT                   LIVDDNEINLKVLARLMSKLGYQHTTATNGLVAFTKYKESPNSFSMVLMDISMPVMDGI
FT                   DATRNIRSYEWEKQLSSVKVFAVTGIGSAAMQHEALMAGVDEYLVKPLSLGQLGKLMKV
FT                   HL"
FT   gene            complement(43608..45112)
FT                   /locus_tag="ANIA_09047"
FT                   /old_locus_tag="AN9047.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(43608..43929,43973..44293,44341..44952,
FT                   45006..45112))
FT                   /locus_tag="ANIA_09047"
FT                   /old_locus_tag="AN9047.4"
FT                   /note="transcript_id=CADANIAT00007806"
FT   CDS_pept        complement(join(43608..43929,43973..44293,44341..44952,
FT                   45006..45112))
FT                   /locus_tag="ANIA_09047"
FT                   /old_locus_tag="AN9047.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007806"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007806"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007806"
FT                   /db_xref="GOA:Q5ARN3"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARN3"
FT                   /protein_id="CBF84395.1"
FT                   /translation="MSRPSSPPFAPKVCSTCRARKKRCDKALPSCGYCAAKGLQCQYHD
FT                   ERPVGLDLIPTPSVSETSSTVEATVCREVQRIISFTGQYLDEVSVRYFQSIHWYLPIIS
FT                   RQRFHAHLLSFGADPRADFSVLMLSICMLTYAPDPDRSDGRHVDHSTLYLAAKSLFSLA
FT                   QTIGRPSLNLIQAGILIAVYEYWRGELDRGFVSIGGCARMAYAAGLKRPTSLPSMDNDV
FT                   YPDEEDGSTWWGICMCERIGVCDISIVNQPLLSIMPTEVDAFSPQESGCVPSTPSNIYQ
FT                   DGFRQAMRATYLLDHLLEVLAAPESEAKQTHLQELDNSIQVFLTMTMQRFPMASGVYCG
FT                   GISIAIRGLFLLHRHVLAQTKDPSGDVDYPKGAYPSSRAALDTVTKIVSDIATARQQLS
FT                   PDRLDAYPPTYAYLVRAALQYIHEECQPLTPGSWLWEAEKRLQHSLELLKRRWR"
FT   gene            46803..48498
FT                   /locus_tag="ANIA_09046"
FT                   /old_locus_tag="AN9046.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(46803..47035,47297..47377,47430..47465,47601..47602,
FT                   47788..47922,48166..48215,48273..48417,48482..48498)
FT                   /locus_tag="ANIA_09046"
FT                   /old_locus_tag="AN9046.4"
FT                   /note="transcript_id=CADANIAT00007807"
FT   CDS_pept        join(46803..47035,47297..47377,47430..47465,47601..47602,
FT                   47788..47922,48166..48215,48273..48417,48482..48498)
FT                   /locus_tag="ANIA_09046"
FT                   /old_locus_tag="AN9046.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007807"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007807"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007807"
FT                   /db_xref="GOA:Q5ARN4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARN4"
FT                   /protein_id="CBF84396.1"
FT                   /translation="MPRVRVSSSQNCHEKEGRLLLAVQAIKKKEITLICEAAHHFNVPE
FT                   SILCTRLRGTTNRAESRANGHKLTEIEEEVLKQILPDNIYNFDKTGFAIGLCAHQKVIT
FT                   KLLQLSQSVLLDRILKRSYASLVDQKMWLGISYINKLDFLAAYPQARISIFKLDTIRNS
FT                   CQIAMQKVILLEQENRIAHDNGLSVQEATELEEAYNVSFQAIPGPCGPPAEGAQTPKAW
FT                   ALPIYSVVVD"
FT   gene            49259..50724
FT                   /locus_tag="ANIA_09045"
FT                   /old_locus_tag="AN9045.4"
FT                   /product="Exo-polygalacturonasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5ARN5]"
FT   mRNA            join(49259..49861,49909..50526,50596..50724)
FT                   /locus_tag="ANIA_09045"
FT                   /old_locus_tag="AN9045.4"
FT                   /note="transcript_id=CADANIAT00007808"
FT   CDS_pept        join(49259..49861,49909..50526,50596..50724)
FT                   /locus_tag="ANIA_09045"
FT                   /old_locus_tag="AN9045.4"
FT                   /product="Exo-polygalacturonasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5ARN5]"
FT                   /note="transcript_id=CADANIAT00007808"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007808"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007808"
FT                   /db_xref="GOA:Q5ARN5"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ARN5"
FT                   /protein_id="CBF84398.1"
FT                   /translation="MGFKRTIGLLLGILLALDQVSVLAQPGRPTFAKRPDIQPNPIQPY
FT                   KAIPLHSRRNSHKVCYVKPSLNGGDDAGRVEAALRRCNNGGTIVLDKEYSICTPLDLRF
FT                   LKHVDVALTGKVEFCPELEFWQQNVFQFHFQNASSWWVWGGEDIHLYGAGTGVIHGNGQ
FT                   PWWDAAAGNSSVRRPLLFITDGWHGGSITGLKLRQSPNWHNFIANSSDLLISDMDIFSR
FT                   SSSEAWASNLDGWDTFRSDNVVIQNSVINHDDDCVSFKPNSTNIIVQGLHCNGSHGISV
FT                   GSLGNYPYQYDIVSDLYIYNNTMANTTTAARLKVWPGAEAVKKGNPPWVGGGGKGYVRN
FT                   VTYDLMINDNNDLAIQIDQCYGAINASECLDHPSGVILTNVLFKNMWGTSNGANDPVAG
FT                   QLICGSADSCDNIRAENVTLTNSSGQPSEWQCRYMDEELLDLGGVGCIPA"
FT   gene            complement(50772..51568)
FT                   /locus_tag="ANIA_09044"
FT                   /old_locus_tag="AN9044.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(50772..51099,51297..51568))
FT                   /locus_tag="ANIA_09044"
FT                   /old_locus_tag="AN9044.4"
FT                   /note="transcript_id=CADANIAT00007809"
FT   CDS_pept        complement(join(50772..51099,51297..51568))
FT                   /locus_tag="ANIA_09044"
FT                   /old_locus_tag="AN9044.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007809"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007809"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007809"
FT                   /db_xref="GOA:Q5ARN6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARN6"
FT                   /protein_id="CBF84400.1"
FT                   /translation="MAPLLERTVTAEKANGGWPDKVYAPSALAYNQAYLVSPAMTVQQI
FT                   RDFKQAFDDAALRSVKAGLDLVEIHAAHGYLLHQFLSPVSNSQADEVDFLDVSSGGIRA
FT                   KQETSIKSGDGYRAPFALEIKRAVGNVLLVCMVGGVKKTGEIAERFLQQGLDVVMCGRW
FT                   FQKNPGLVYQFADELGVKINMSTQYGRAFQGGRNRR"
FT   gene            <52014..54404
FT                   /locus_tag="ANIA_09043"
FT                   /old_locus_tag="AN9043.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(<52014..52096,52145..52273,52457..52756,52938..53124,
FT                   53296..53412,53634..54148,54182..54404)
FT                   /locus_tag="ANIA_09043"
FT                   /old_locus_tag="AN9043.4"
FT                   /note="transcript_id=CADANIAT00010524"
FT   CDS_pept        join(<52014..52096,52145..52273,52457..52756,52938..53124,
FT                   53296..53412,53634..54148,54182..54404)
FT                   /locus_tag="ANIA_09043"
FT                   /old_locus_tag="AN9043.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="submitted as non-partial"
FT                   /note="transcript_id=CADANIAT00010524"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00010524"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00010524"
FT                   /db_xref="GOA:C8VKQ5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKQ5"
FT                   /protein_id="CBF84402.1"
FT                   /translation="FGLNAQPPSCQKASIFRRTPSRASRNIASRRCHARKVKCSGRTPC
FT                   DSCQQATKPVECVYSRKSRLIKVSEHLVAEASDSAFASRFRQAMAQSGHDHIPRVSFPS
FT                   DEQLLAWSETECPWPAPLSRSSARLSGFEWPRPLLPHRQAQFDPARAGQRLSRRLAQKQ
FT                   TLGSVCDSLAGSAIRLAIIMGLNPNIPESQLSDAGEREHRERIFRTAYTFDRMWTAKLD
FT                   YPCTISDDEIEAFSDLRRWLEDLPSSLRLPTCSEGDWDPKARCLHHLFNQLDKRLLSGL
FT                   RFFLHPVSILSYYRLSNFHLTPRKDRQSDEEQFEVAVSFLVQLQGNGNYAAAEFHKHIE
FT                   ATTDLMHSTKVRLGVQSASENATAPQDSAYNSILDAAITECRLHPRMCHSGRRSSIISC
FT                   KGSWNSPLSTWNSLIRLYTWMTSRGFTGQMNAPKCYHMSIGRGQVGHMRHLAYMYQVYQ
FT                   GIPCATGLIYITSAAIPETALIPNLRTEVVDSVIKDDRTACLFPRTDNDGRWTKPQSSA
FT                   "
FT   gene            55371..57647
FT                   /locus_tag="ANIA_09042"
FT                   /old_locus_tag="AN9042.4"
FT                   /product="putative alpha 1,3 glucanase, GH71 family
FT                   (Eurofung)"
FT   mRNA            join(55371..55498,55545..56070,56120..56345,56398..56855,
FT                   56910..57647)
FT                   /locus_tag="ANIA_09042"
FT                   /old_locus_tag="AN9042.4"
FT                   /note="transcript_id=CADANIAT00007810"
FT   CDS_pept        join(55373..55498,55545..56070,56120..56345,56398..56855,
FT                   56910..57502)
FT                   /locus_tag="ANIA_09042"
FT                   /old_locus_tag="AN9042.4"
FT                   /product="putative alpha 1,3 glucanase, GH71 family
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007810"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007810"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007810"
FT                   /db_xref="GOA:C8VKQ6"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKQ6"
FT                   /protein_id="CBF84404.1"
FT                   /translation="MKLSTFLSALGALPQLISAAPNAVANKPRQSSDDRLVFAHFMIGI
FT                   VSNRNSAADYDDDMKRAKSLGIDAFALNIGVDPYTDQQLNLAYQSAANNDMKVFISFDF
FT                   NWYNTGQGYQVGQKIAQYANLPAQLKVDGKVFVSSFAGDGLDIAAMRQAAGQDIYWAPN
FT                   YHPEYGTNLDGVDGLLNWMAWPNDGNNKAPRPGASVSVEEGDEMYIRTGKDYIAPASPW
FT                   FFTHFGPEVPYSKNWVFPGDLLWYDRWQQLLTMGPRFIEIVTWNDYGESHYIGPLSSPH
FT                   TDDGASKWVNDMPHDGWMDMSKPFIAAYKDGATSVDDYITEDLLVYWYRPAPRDVNCDA
FT                   TDTCMVPANNASGNYFYGRPNGWETMEDAVFVVTTLTEPATVTVNSGGNVEVFDAPAGA
FT                   SAFKVPMGVGSQAFSLSRNGQVIQSDISLLPIIDGCVCGLYNFNPYVGSLPPSPIDSLE
FT                   PAGLYSLTQGLHVQTCLPTPSLGKTTPTPPPGWGAAPTTTRTSSTTGTTGTTTRTTRTT
FT                   TRTTTTRPTTSTSTSTTTRTTTTTRPTTTTRTTTTTNPTGGTGNVCVAGTGPGNYVGLC
FT                   SFCCNFGYCPPGPCTCTAYGAPVPTPPTTGVRGVPLPWLENYNSYLGLCSFACDHGYCP
FT                   PTACQVA"
FT   gene            complement(57704..58591)
FT                   /locus_tag="ANIA_09041"
FT                   /old_locus_tag="AN9041.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(57704..58591)
FT                   /locus_tag="ANIA_09041"
FT                   /old_locus_tag="AN9041.4"
FT                   /note="transcript_id=CADANIAT00007811"
FT   CDS_pept        complement(57704..58591)
FT                   /locus_tag="ANIA_09041"
FT                   /old_locus_tag="AN9041.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007811"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007811"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007811"
FT                   /db_xref="GOA:C8VKQ7"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKQ7"
FT                   /protein_id="CBF84406.1"
FT                   /translation="MDLTQIRRHHWTTSITYDASNIITYNLSVGSKGQDLRHCWEEHPE
FT                   FQALPTFSSLAVIDIMGKVTVDMPKLLPLYKPSQHPHVHAEHSLEIRGPLPRSGTLTSE
FT                   ARILDVVDRRTGVALIVGISIRNEDTGEWICYSEWTSFLMKMPGDGASKASSSMQSTLL
FT                   PSREPDAVLSHQTTPEQGALYRAATGEWNPMHIDPATAQRAGFPGPILSGTCTIGIGVN
FT                   HVIEAFAGGDSARFQRLKLRLSKPVFPGEVVTTKMWRFNETKIVYQQVAGDGRVVISNA
FT                   EIKLKAGGKQRSQL"
FT   gene            complement(58876..59415)
FT                   /locus_tag="ANIA_09040"
FT                   /old_locus_tag="AN9040.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(58876..59415)
FT                   /locus_tag="ANIA_09040"
FT                   /old_locus_tag="AN9040.4"
FT                   /note="transcript_id=CADANIAT00007812"
FT   CDS_pept        complement(58876..59415)
FT                   /locus_tag="ANIA_09040"
FT                   /old_locus_tag="AN9040.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007812"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007812"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007812"
FT                   /db_xref="GOA:Q5ARP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP0"
FT                   /protein_id="CBF84408.1"
FT                   /translation="MWLTRGFSRITETLSSLFCRSHSQSHSCSQTRERTRSAFNEGELE
FT                   GESGWQTCRPRHLTERRLSGFQPPPTEEEYTSSFFHGWYLPYNVRGLSQVEPEPEPEPA
FT                   PEADVELEDLPRYEHPPAYTNRSPPAEAHEIGSNSRNESLDVTECRPAPGLSNEPDTMA
FT                   VTGQPDNAPNDRRGPT"
FT   gene            complement(60985..62376)
FT                   /locus_tag="ANIA_11161"
FT                   /old_locus_tag="AN11161.4"
FT                   /product="phosphatidylserine decarboxylase family protein
FT                   (AFU_orthologue; AFUA_7G01730)"
FT   mRNA            complement(join(60985..62287,62339..62376))
FT                   /locus_tag="ANIA_11161"
FT                   /old_locus_tag="AN11161.4"
FT                   /note="transcript_id=CADANIAT00007813"
FT   CDS_pept        complement(join(60985..62287,62339..62376))
FT                   /locus_tag="ANIA_11161"
FT                   /old_locus_tag="AN11161.4"
FT                   /product="phosphatidylserine decarboxylase family protein
FT                   (AFU_orthologue; AFUA_7G01730)"
FT                   /note="transcript_id=CADANIAT00007813"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007813"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007813"
FT                   /db_xref="GOA:C8VKQ9"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR022237"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKQ9"
FT                   /protein_id="CBF84410.1"
FT                   /translation="MPSHSSNTHRYHRVGHWMPSGYDDHHKWLGGVIAHVDSKQDKELH
FT                   PVLKEFQHLIETNTRVYMLISAMFAEVPKNRHYCKDPTGCSQIRDYHHMLQVLNHLITT
FT                   APSWNDFSLEVGLVGLPINAVLDWSMGTPSGYAAYLDPDINAMLKKVLNAWGEYLTSED
FT                   SAKVLGDDEYGWFGETGKNNLMHVANLPLGTDHEFDKLFVCDPSAKYHGYKSWDDFFTR
FT                   TFRPGVRSVASPDDDTVIVNACESQPYKVARGVKARDTFWIKGQPYSVADMLSHDPVTP
FT                   QFEGGTVYQAFLSALSYHRWHAPVSGKIVRAYVVDGTYYSEPLFEGLWDEEENKPKEQG
FT                   IDPGGEVTTQEYLTCVATRAIILIECDNPAIGLMAFLGVGMCEVSTCDITVKEGEHVRK
FT                   GDQLGMFHFGGSTHCLLFRKGVDVEGLPSPDLGRNVAVNSQLGVVKA"
FT   gene            complement(62473..64007)
FT                   /locus_tag="ANIA_11159"
FT                   /old_locus_tag="AN11159.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(62473..63050,63097..63161,63211..63602,
FT                   63693..63800,63846..64007))
FT                   /locus_tag="ANIA_11159"
FT                   /old_locus_tag="AN11159.4"
FT                   /note="transcript_id=CADANIAT00007814"
FT   CDS_pept        complement(join(62473..63050,63097..63161,63211..63602,
FT                   63693..63800,63846..64007))
FT                   /locus_tag="ANIA_11159"
FT                   /old_locus_tag="AN11159.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007814"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007814"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007814"
FT                   /db_xref="GOA:C8VKR0"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKR0"
FT                   /protein_id="CBF84412.1"
FT                   /translation="MYETLPLVGHSLAIFVVAAVMVGFSIVAVFLRCFVRVYLVRAFGW
FT                   DDALMLTALALFIALCALCMLAPAAGVGHKVSDFMSLDQLQRALKLWWLGQMLYLWASA
FT                   VAKIAIALALLRLAVRRLHRFILWTICAVVVVIGLVFWLVLLFDCWPVEYFWEQTDIRK
FT                   QGKCISTEILLIIAYCYSSLTIVCDIMLGILPACLIWSLQMSRRTKLALVGVLSLGAIA
FT                   SVAVVIRLPYLENYADPDFLYSTYQIAIWSVVETGLAIIAGSLITLRPLFRWFLDGSSS
FT                   YKHQHTPQQKTNKKYVLSTLTANASMPGIEDPKYWRPDLGEDPHTVVTSIMAPLGRSMD
FT                   DNSTVALSPILPPPRKISVCVHQTFAVYKDPSSPVASSFGCPGQCSPAPVPASIQSATP
FT                   SLIPTPAPAQAPRLDNGRRYNRGYGAGYAGYTYEF"
FT   gene            complement(65984..67391)
FT                   /locus_tag="ANIA_09038"
FT                   /old_locus_tag="AN9038.4"
FT                   /product="molybdenum cofactor biosynthesis protein (MoeA),
FT                   putative (AFU_orthologue; AFUA_3G15170)"
FT   mRNA            complement(65984..67391)
FT                   /locus_tag="ANIA_09038"
FT                   /old_locus_tag="AN9038.4"
FT                   /note="transcript_id=CADANIAT00007815"
FT   CDS_pept        complement(65984..67312)
FT                   /locus_tag="ANIA_09038"
FT                   /old_locus_tag="AN9038.4"
FT                   /product="molybdenum cofactor biosynthesis protein (MoeA),
FT                   putative (AFU_orthologue; AFUA_3G15170)"
FT                   /note="transcript_id=CADANIAT00007815"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007815"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007815"
FT                   /db_xref="GOA:Q5ARP2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP2"
FT                   /protein_id="CBF84414.1"
FT                   /translation="MALSYADAVWLVKTEAQRHASLQRERCSIYSACDRVAAERITSPI
FT                   STPEYDTSAMDGFALSSTATETASPETPVTFNVMATTTAGDRPYPAADSLRDAKDSIPP
FT                   CVEIMTGAPFPTGQEWERFDCSVPIEEVVVQEDRCPPSQRRYVSVCKPARRWQHRRFAG
FT                   GDFTQGDRIIEAGDCIQPQHIMAMASVGLREIPVLRRPRIAVFSTGSELMSDASKAHQF
FT                   MIYDANGPYLTSILRQWGFDVVFRGVLQDDSAAMEESIVRALDYGYDMIVTSGAVSAGR
FT                   CDIIPGLVKRIGGRTVFHKVAVKPGHPILFAMLPPPRETGETAFFGLPGNTVAAAACLR
FT                   FFALPYLRTLQRQSPEEPKAAALRLSNGETEPCNGAAGKVLTFREAPDIFRPAISTQSG
FT                   QVWIIDDHSPGKTRPFLQANCWAHIPSGVSEMRAGSRVDIYPL"
FT   gene            67513..70705
FT                   /locus_tag="ANIA_09037"
FT                   /old_locus_tag="AN9037.4"
FT                   /product="periplasmic nitrate reductase, putative
FT                   (AFU_orthologue; AFUA_3G15190)"
FT   mRNA            join(67513..67658,67703..67813,67871..69909,69972..70705)
FT                   /locus_tag="ANIA_09037"
FT                   /old_locus_tag="AN9037.4"
FT                   /note="transcript_id=CADANIAT00007816"
FT   CDS_pept        join(67513..67658,67703..67813,67871..69909,69972..70705)
FT                   /locus_tag="ANIA_09037"
FT                   /old_locus_tag="AN9037.4"
FT                   /product="periplasmic nitrate reductase, putative
FT                   (AFU_orthologue; AFUA_3G15190)"
FT                   /note="transcript_id=CADANIAT00007816"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007816"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007816"
FT                   /db_xref="GOA:Q5ARP3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP3"
FT                   /protein_id="CBF84416.1"
FT                   /translation="MPEYTESRDSIKNIWGERTPYKHQWPTRCDSHLVDTPDTWVQSAC
FT                   VLCSNGCGLDIGVKEGKVVGVRGRTVDRVNKGRLGPKGLNGWVSINHPDRLTHPLIRRN
FT                   GKLERASWDEAMSLIVERAKDIQTRLTNHGIAFYTSGQLLLEEYYVLAMVGKAGLNTLH
FT                   MCATLNLSPSYRSQDAKPMNRDGNTRLCTATAAASMRESFGSDGQPGSYADIDYTDCLF
FT                   LVGHNMAATQTVLWTRVLDRLEGPNPPKLIVVDPRTSDTAKKATVHVRPRLGTNVALLN
FT                   GLQHLIIKNGWVNDQYVASHVCGLEELKKVVEKYTPEYVEKITGVPVAQLHETAEALAL
FT                   SGSLLSTALQGVYQSNQATAAACQINNINLLLGHIGKPGSGILQMNGQPTAQNNRETGC
FT                   DGEFPGFRNHQNPNHIRDIARVWNINYEQVPHWSEPTHIMNMLNYIESGSIEMFWVSGT
FT                   NPLVSLPHLYRVRQLLTKPDLFVVVQDLFLTETAAIADVVLPAAQWAEKTGCFTNVDRT
FT                   MHLSRKAVDPPGEAKADLDIFLDFAQRMDFRNRDGGPLIPFTNPEEVFEEWKKMSYGRP
FT                   LDCSDLTYEKLSGGSGIQWPCTKEYPFGKERLFDDGKFFTDTDYCESYGHDLETGTPLT
FT                   KGQYEAMNPAGRAILKAAHYRKPWESPDEEFPFYLSTGRNVFHFHTRTKTGRSKRLQNA
FT                   DKDACLVICQADADELGVTNGEMVIVRSRRGQVELPVKTEGISKGHVFIPFHFGYWDSK
FT                   DQRARAANELTIEQWDPVSKQPMFKSGAVRIEKCVQKENEPPISRERQSEAIQNVEANK
FT                   ANATETRKDGQDSRVRWLEMWLGATHESLEMLRQIYDKLIPQLVHDLEIQAGLGVMRRI
FT                   TADIIAKLEPIVHRYHESRVYGRRVCERLRKALFPMEDDKDNSYETLIVLQSLEMFLTY
FT                   IDGHLTALSPASQALWDQEFVDAVSFAAQHIQRQKAWVNTHIKVKSPQTLLVPQRPPME
FT                   VDADRDEEAAENVLVREFYY"
FT   gene            complement(70747..72153)
FT                   /locus_tag="ANIA_09036"
FT                   /old_locus_tag="AN9036.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(70747..71147,71209..71276,71323..71830,
FT                   71883..71919,71962..72153))
FT                   /locus_tag="ANIA_09036"
FT                   /old_locus_tag="AN9036.4"
FT                   /note="transcript_id=CADANIAT00007817"
FT   CDS_pept        complement(join(70747..71147,71209..71276,71323..71830,
FT                   71883..71919,71962..72153))
FT                   /locus_tag="ANIA_09036"
FT                   /old_locus_tag="AN9036.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007817"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007817"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007817"
FT                   /db_xref="GOA:Q5ARP4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP4"
FT                   /protein_id="CBF84417.1"
FT                   /translation="MGVTSTVCEIPPRNRKSTQLAVGWIFIVLTTLALGLRLMARPPLS
FT                   ASFGIDDGIGIGTYVQLLSCTALVDMILMIQGANLGWGTDMWALQAEQIILQMKVDANL
FT                   QPIFILFTNNSTLCQLFYAGIIAFYLSVSLAKLSILFFYLRIFTTDTFKRIAYTMIFLC
FT                   SAYGVGSVVTSILDCMPPSYFWTRFDGVSTGYCVSKAAFKVIPPVNIALDVVVMVLPLP
FT                   LLARLNLPLQKKIRVLSMFSMGVLIIVADILRITHLFHSITAYNITYNGGELSYFGVIE
FT                   SGVGVICICMPAIAALLKRVLPQCFGSLAKRSYLYRTINSRSNTEFGASRSRSQRGAIQ
FT                   PSAYAHTNPNNPVSFSAIAWGAREDERDGDGNTSDIHLTLLPATEIADERIQRPQKALT
FT                   SR"
FT   gene            complement(73021..75288)
FT                   /locus_tag="ANIA_09035"
FT                   /old_locus_tag="AN9035.4"
FT                   /product="Putative alpha-galactosidasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5ARP5]"
FT   mRNA            complement(join(73021..74557,74645..75288))
FT                   /locus_tag="ANIA_09035"
FT                   /old_locus_tag="AN9035.4"
FT                   /note="transcript_id=CADANIAT00007818"
FT   CDS_pept        complement(join(73021..74557,74645..75288))
FT                   /locus_tag="ANIA_09035"
FT                   /old_locus_tag="AN9035.4"
FT                   /product="Putative alpha-galactosidasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5ARP5]"
FT                   /note="transcript_id=CADANIAT00007818"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007818"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007818"
FT                   /db_xref="GOA:Q5ARP5"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ARP5"
FT                   /protein_id="CBF84419.1"
FT                   /translation="MTNSKARYVLEPVQVTGTTFALNGTTLSYQFHVDEPSADLRSDHF
FT                   GGSISGPIPVDPEPIVDGWTGMPDRVRREFPDQGRGDFRVPAFRIRQAEGHTVSAFRYR
FT                   EHEIVPGKEVSASGLPGVFGDAHDATTLIVRLVDPYSDLAAELKYTVFPKYDTVVRSAS
FT                   ITNKSNSDVTIESLASLSVDFPFDELEMIGLRGDWAREAHRLRRKVDYGVQSFGSTTGF
FT                   SSHLHNPFVALVHPSTTESQGEAWGFSLIYSGSFTINVEKSSQGLTRVSIGPSQLSWTL
FT                   KPGETFDSPECVAVYSSTGIGGMSRSLHGLYRKHLMKSKFATEDRPVLLNSWEGLYFHI
FT                   DQDRMYRLAQEAAALGVKLLVMDDGWFGDEHPRTSDDAGLGDWIPNPARFPDGLTPLVN
FT                   RITALKVANSQRNMRFGIWVEPEMVNPRSTLYQQHPDWVLHAGNYPRTEQRNQLVLNMS
FT                   LPEVQEFIISAMSEILNAADITYVKWDHNRGLAETPSPCANHAYMLGAYRVFDVLTTRF
FT                   PNVIWEGCASGGGRFDPGILQYFPQVWTSDDSDAVERIFIQFGTSLAYPASAMGGHISS
FT                   VPNHQTGRTTPLTFRAHVAMMCGSFGLELDPAHLTDSERRDIPGLIALAEKISPIVVKG
FT                   DLWRLALPEDSNWPAALFLSENRTQGVLFFFQLAPMVNHSLPRVRLQGLEDGALYRVDG
FT                   EGPYSGSMLMNLGLQYSFRGDYGSRLAFIERE"
FT   gene            77777..79418
FT                   /locus_tag="ANIA_09034"
FT                   /old_locus_tag="AN9034.4"
FT                   /product="aldehyde dehydrogenase ALDH (AFU_orthologue;
FT                   AFUA_8G02310)"
FT   mRNA            join(77777..77901,77952..78151,78208..79418)
FT                   /locus_tag="ANIA_09034"
FT                   /old_locus_tag="AN9034.4"
FT                   /note="transcript_id=CADANIAT00007819"
FT   CDS_pept        join(77777..77901,77952..78151,78208..79418)
FT                   /locus_tag="ANIA_09034"
FT                   /old_locus_tag="AN9034.4"
FT                   /product="aldehyde dehydrogenase ALDH (AFU_orthologue;
FT                   AFUA_8G02310)"
FT                   /note="transcript_id=CADANIAT00007819"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007819"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007819"
FT                   /db_xref="GOA:Q5ARP6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP6"
FT                   /protein_id="CBF84421.1"
FT                   /translation="MADLFVDLVAPNGTHYSQPTGLFINNAFVASSGQTITSLDPATDK
FT                   PIATVHAASAEDVDRAVIAARAALVHPSWKKLPGTERGQLMARLADLMEKNKELFATID
FT                   AWDNVLSLTEKSGKPYHIALSEDLVEAIGTIRYYSGWADKTFGQTISTTPAKFAYTIRQ
FT                   PVGVVGQIIPWNYPLSMACWKLGPALACGNTVVLKPAEQTPLSVLVLGSLIKEAGFPPG
FT                   VVNIVNGYGREAGAALAGHPLIDKIAFTGSTVTAREIMKLAAGTLKNITLETGGKSPLL
FT                   VFPDADLEQAVKWSHFGIMSNQGQICTATSRIYVHQDIFQLFLSKFKAAVETTSKIGDQ
FT                   WDESTFQGPQITRAQYDRILSYIETAKKGGMAVVTGGSAHAPSSEKNKDGYFIQPTVFT
FT                   GTDDSHAIVREEVFGPVVVILPFASEEEAIRRANDTTYGLGAAVFTCDLERAHRVAAEI
FT                   EAGMVWVNSSQDCDPRVPFGGVKQSGIGRELGEAGLEAYTQVKAVHVNMGNKL"
FT   gene            80729..82562
FT                   /locus_tag="ANIA_09033"
FT                   /old_locus_tag="AN9033.4"
FT                   /product="amino acid transporter (Eurofung)"
FT   mRNA            join(80729..80922,80986..81404,81461..81601,81655..81869,
FT                   81935..82132,82186..82329,82497..82562)
FT                   /locus_tag="ANIA_09033"
FT                   /old_locus_tag="AN9033.4"
FT                   /note="transcript_id=CADANIAT00007820"
FT   CDS_pept        join(80729..80922,80986..81404,81461..81601,81655..81869,
FT                   81935..82132,82186..82329,82497..82562)
FT                   /locus_tag="ANIA_09033"
FT                   /old_locus_tag="AN9033.4"
FT                   /product="amino acid transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007820"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007820"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007820"
FT                   /db_xref="GOA:Q5ARP7"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP7"
FT                   /protein_id="CBF84423.1"
FT                   /translation="MPFHADIPQFQPTNDDIERTQAEKKHKETPTMAVDEQKAESVPYR
FT                   QDVFGDEEHAEVKYKVLKWWQCGLLMVAETISLGILSIPAAIAGLGLVPAIVILLVMGL
FT                   IASYTGYVIGQFKWRYPHVVSMADAGEVLMGRFGREVLFGGQMLFLIFLMASHILTFTV
FT                   AMNRLTNHGTCSLVFGVIGLLVSLVFSLPRTMKNMSWLSLASFISIFTAVMIAMVAIGV
FT                   EHPGGPVKATAETNLVTGFTAALNIILSYASHNAFFNVIAELKEPRDFPKALTLLQCID
FT                   ITLYLVSGVVIYYFAGDDVKSPALGSINPLVSKVAYGVALPTIIIAGVINGHIACKSIY
FT                   TRVFAGTSHMHKQDFRAVGSWIGIAVGLWVIAWVVATAIPVFSNLLSLMTALFASWFSF
FT                   SLPAAFWLFMNRGLWFSSPRKTGITIFNCLVFGMGVVMSLGTILLACICVSSGNGKSSS
FT                   "
FT   gene            complement(85841..86904)
FT                   /locus_tag="ANIA_09032"
FT                   /old_locus_tag="AN9032.4"
FT                   /product="trihydroxytoluene oxygenase (AFU_orthologue;
FT                   AFUA_8G02470)"
FT   mRNA            complement(join(85841..85951,85998..86054,86110..86904))
FT                   /locus_tag="ANIA_09032"
FT                   /old_locus_tag="AN9032.4"
FT                   /note="transcript_id=CADANIAT00007821"
FT   CDS_pept        complement(join(85841..85951,85998..86054,86110..86904))
FT                   /locus_tag="ANIA_09032"
FT                   /old_locus_tag="AN9032.4"
FT                   /product="trihydroxytoluene oxygenase (AFU_orthologue;
FT                   AFUA_8G02470)"
FT                   /note="transcript_id=CADANIAT00007821"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007821"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007821"
FT                   /db_xref="GOA:Q5ARP8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP8"
FT                   /protein_id="CBF84425.1"
FT                   /translation="MPNPSDRRVQLLKTAFVVYNHADLDKAKEFLLDFGLHVAFEKPGQ
FT                   KIYFKGYGAEPYVYVACKADTSSFGGGAYVVDSFAELEKAKQIPGASTIMQLEDEAGGG
FT                   QLVTLTDPFGHKVHLIWGWREKSAEPMKLEKLVVNYEDEKPRKGRFQRFKPGPAPVHRW
FT                   GHYGVTYPEGQYQAMYDWYTQNLSLATSDIVYKDGKPITCFFHVDRGQDYTDHHAFFFK
FT                   KAKPGEPLTVAHAAFEVHDFDIQQLGHDYLASKGHELCWGVGRHVLGSQVFDYWFDSSR
FT                   FVVEHYADGDLVNCDTPVSHVQAGPDALSVWGPPVPKVF"
FT   gene            87193..88132
FT                   /locus_tag="ANIA_09031"
FT                   /old_locus_tag="AN9031.4"
FT                   /product="fumarylacetoacetate hydrolase family protein
FT                   (AFU_orthologue; AFUA_4G01490)"
FT   mRNA            join(87193..87466,87519..88132)
FT                   /locus_tag="ANIA_09031"
FT                   /old_locus_tag="AN9031.4"
FT                   /note="transcript_id=CADANIAT00007822"
FT   CDS_pept        join(87193..87466,87519..88132)
FT                   /locus_tag="ANIA_09031"
FT                   /old_locus_tag="AN9031.4"
FT                   /product="fumarylacetoacetate hydrolase family protein
FT                   (AFU_orthologue; AFUA_4G01490)"
FT                   /note="transcript_id=CADANIAT00007822"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007822"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007822"
FT                   /db_xref="GOA:Q5ARP9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP9"
FT                   /protein_id="CBF84427.1"
FT                   /translation="MCPIEICWTHLVRYSSTANGPIKYGEPILGQTGDIGKLARDDQLK
FT                   VKRLLGSDPFLLEKTDVVETVYRLYGPLEPKDVPIIRCIGLNYKTHILETGRPLPTCPT
FT                   VFTKPSPAVADHDAPVPIPKIAQEQCDYEGELVIVIGREGKNIPEAEALNYVAAYTAGN
FT                   DISARDWQREAGKAGPVPQWTFSKSFDNYAPLGPCLVRQDQLNEASMLSLRTLVNGDVR
FT                   QESHTSDLCFGVRKLVAFCSQGQTLQRGSLIMTGTPGGVGLFMKPPQFLKDGDVVSVEI
FT                   ESIGTLQNTISFEN"
FT   gene            complement(88691..90266)
FT                   /locus_tag="ANIA_09030"
FT                   /old_locus_tag="AN9030.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            complement(join(88691..90106,90159..90266))
FT                   /locus_tag="ANIA_09030"
FT                   /old_locus_tag="AN9030.4"
FT                   /note="transcript_id=CADANIAT00007823"
FT   CDS_pept        complement(join(88691..90106,90159..90266))
FT                   /locus_tag="ANIA_09030"
FT                   /old_locus_tag="AN9030.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007823"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007823"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007823"
FT                   /db_xref="GOA:Q5ARQ0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ0"
FT                   /protein_id="CBF84428.1"
FT                   /translation="MIFAQLPTLTAQVVHFMQSRLLLCITAFVVLCIIHTFLYAFLLSP
FT                   VRHVPGPWWARVSRIPLLYATWQRRRSRYASDLLRKYGRLVVIAPDQIHTSDETAMKTI
FT                   YAKSSIKTRFYAGMGSWKGVKSTLGFVDYRSAAPTRNNLIQCFQNRNLDTLVDSMACHI
FT                   TEFCDMLKPKVSNNKAVDGVVIFRLLALDIVTDILWGEKDTLLSKGFDQTPVFLRRFHA
FT                   FSSWNALKSFIPGLDTYVRFLGSSNMRQLRADCNDMDVTAREALDRWHARPEERHQKDV
FT                   LSMLQAMSNSDDPTKRIPSEHIPAYMVEMLAAGSSTTSHTAAFACDQLARYPKALEALQ
FT                   KELIEAFPDKENIDERKMLSLRYLEGVIYETMRLYPMIPGPLERHLGEWIEVDGMKVGP
FT                   GVIASTAAYDQGRLPDVFPEPEKWNPERWLQATDRMKLNWIPFGHGCRSCPGSNLALTE
FT                   LKYILGTLFRRFRVQLPEDYPNEPLELADVFAAGSKTGHCWLEFEEMPK"
FT   gene            90672..92468
FT                   /locus_tag="ANIA_09029"
FT                   /old_locus_tag="AN9029.4"
FT                   /product="FAD dependent oxidoreductase, putative (JCVI)"
FT   mRNA            join(90672..90885,90943..92468)
FT                   /locus_tag="ANIA_09029"
FT                   /old_locus_tag="AN9029.4"
FT                   /note="transcript_id=CADANIAT00007824"
FT   CDS_pept        join(90672..90885,90943..92468)
FT                   /locus_tag="ANIA_09029"
FT                   /old_locus_tag="AN9029.4"
FT                   /product="FAD dependent oxidoreductase, putative (JCVI)"
FT                   /note="transcript_id=CADANIAT00007824"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007824"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007824"
FT                   /db_xref="GOA:Q5ARQ1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ1"
FT                   /protein_id="CBF84430.1"
FT                   /translation="MDVPVLIIGTGPSGATAALHLGRLGIKSIVVSRHRGTANTPRAHI
FT                   FNQRAMEVLRDAEIEAQCYREASSMEHMAHSSFLDKLTGQEYGRLWAWGNKPQQKGEYE
FT                   VASPCHMSDLPQSHLEPILVDEAKKLGAQFRFYTEFVSVTQDESGVSTILRDRESEKTY
FT                   MVRSNYLLGCDGARSAVVSALGIPITGRQINTAFNVHIQADLTKYIAHRPGSLNWILNP
FT                   EAPDWSAVGNFRMVRPWHEWVVSMHPASKNGKRFTPTEADIIKRLHQMIGDTSIPIKVL
FT                   STFEWTINDQVADYWQRDRILCIGDAVHRHPPINGLGSNTCLSDAFNIAWKLAYVIKGI
FT                   AKPALLETLSVERKPVGDGIVRRANTGMEAHRNLWSIIGLTPEDRQNALSLLSEDSPAG
FT                   QQKRKDWANALEAIDAEVQALGIQMNQFYVGSPGVIAEPDDLPPDFGALDPIKELKVST
FT                   YPGYHLPHIWLSKNGQSERESTLDLAGHGRFALFTGVGGDCWISAAKALTASAWGVEVV
FT                   GYKVGFGGDYMDCYREWAQVRGVDEDGVVLVRPDHFIAWRYPRRSDDAEARLRCVLEKI
FT                   LGF"
FT   gene            92996..94126
FT                   /locus_tag="ANIA_09028"
FT                   /old_locus_tag="AN9028.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            92996..94126
FT                   /locus_tag="ANIA_09028"
FT                   /old_locus_tag="AN9028.4"
FT                   /note="transcript_id=CADANIAT00007825"
FT   CDS_pept        92996..94126
FT                   /locus_tag="ANIA_09028"
FT                   /old_locus_tag="AN9028.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007825"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007825"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007825"
FT                   /db_xref="GOA:Q5ARQ2"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ2"
FT                   /protein_id="CBF84432.1"
FT                   /translation="MAKTALITGANGITGSAILEYLVKNTTASEWERIIITSRSPLKTA
FT                   VNDSRVEFIALDFSNPPEKLADQMRSQCADVTHAYFSSYVHKDDFAELNEANRSLFENF
FT                   LNALVDVAKGLQNCTLQTGGKYYNVHVRPVPWPAHEGHPRLVRAEENFYYHQEDFLAEK
FT                   QRGSNWTWNVIRPEAIIGYTTKPNGMNEALTIALYFLINKELGVEAPMPTNAAYFNGVD
FT                   DVSDARLIADLTIYASTHKNCANEAFNVTNGDVFSWRYMWPRLADWFGAKASSNQSFNR
FT                   TSFKEGETHLDLNLEQWAQDKREVWNRLCDKAGSPLSKASFDAGTWTFQDWVFQRTWSS
FT                   PLSINKARKFGWTGHLDSFDSFVDAFKRFKELGQIP"
FT   gene            94623..95897
FT                   /locus_tag="ANIA_09027"
FT                   /old_locus_tag="AN9027.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(94623..94668,94719..94733,94792..94842,94901..95279,
FT                   95358..95488,95545..95897)
FT                   /locus_tag="ANIA_09027"
FT                   /old_locus_tag="AN9027.4"
FT                   /note="transcript_id=CADANIAT00007826"
FT   CDS_pept        join(94636..94668,94719..94733,94792..94842,94901..95279,
FT                   95358..95488,95545..95775)
FT                   /locus_tag="ANIA_09027"
FT                   /old_locus_tag="AN9027.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007826"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007826"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007826"
FT                   /db_xref="GOA:Q5ARQ3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ3"
FT                   /protein_id="CBF84434.1"
FT                   /translation="MSSVNIDQAPQGTKLWLLHLGYVEADEGFFLAGAGTSTMTNPNCK
FT                   NPRRKLVLTSALIDHPIEGLILFETGPGEAYPEVWGPPVNDIFGRVDYSPEHELEAALA
FT                   KSGHSIKDIKAVIMGHLHIDHAGGLEKFSGTDIPIYVHEEELKHAFYSVATKSDAGVYH
FT                   GKDLDAKLNWTAIHGETFELAQGITLRHAPGHTPGLVLMQVNLPDSGTWLFTTDQYHVS
FT                   ENYEQSIPHGWLARDYHAWVKTHQMVKTIAKRTNANLVFGHDLGVFFQYEHAPHAYT"
FT   gene            96552..99300
FT                   /locus_tag="ANIA_09026"
FT                   /old_locus_tag="AN9026.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(96552..96670,96728..96755,96812..97450,97567..98115,
FT                   98200..99300)
FT                   /locus_tag="ANIA_09026"
FT                   /old_locus_tag="AN9026.4"
FT                   /note="transcript_id=CADANIAT00007827"
FT   CDS_pept        join(96552..96670,96728..96755,96812..97450,97567..98115,
FT                   98200..99300)
FT                   /locus_tag="ANIA_09026"
FT                   /old_locus_tag="AN9026.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007827"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007827"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007827"
FT                   /db_xref="GOA:C8VKX4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKX4"
FT                   /protein_id="CBF84436.1"
FT                   /translation="MEPPSNSQTESAAGSPSISEETKRKHRKRRNGRTRVSKACANCAR
FT                   RKVKCDGAIPCMPCLLRSKSCQAKPVGDKRGHEQIGANSGIIWAKRFASQCTDSHYDHC
FT                   GQPLSPASTAPSRPQSTLPGEAYDENVRLNAFLDSESSLASRDEWNSWLEAFCREVHPQ
FT                   YPFLHLPTLKYLYTQLPDPSGLSGEHVFQNEEQRCQVSLVLVCLAIGCYCKSSYSSNFK
FT                   GSCPGGWGIYSTAIDVYGNMMKTATNPSTGLLFTQTIVLMLLSLAISQLHCQGCHQRDT
FT                   LSSIPVVRGEFMRRLWCSVYALDRELSIQTEDEFMIKDINVDFALPMNLGDTWMTIHYD
FT                   DNRSSSDLADLIQNEILKRPTMEIPCLRETTCYARAASKTREMLCDKDTNNHHENSPLL
FT                   IESLERYISGAFRTIVLAFHAENCQASQPSTEKQEIEKKGWSLRTIRWGYLRLLISLKA
FT                   LKRSKESDLPDSQASRFTCLHLIEEILLALNSLPHEFPKYTFPILHYWNSVVSIGLEMV
FT                   AEEPLLRQFYGGTILEAVISLREFYSKTWLSSQMSQNILRMSYAARSIFADEIAEREGF
FT                   LDQPRGLSSQRNMTAGLKKVPFTTSTLSPESAMNNSLDETFGLSSTTGAPGDVSIDQTT
FT                   GNHGRTTANHSQEQNLSHISPELYIENSNGQASFHSQGAPGVPETNNPHHAESDPHILY
FT                   ANGHLGSQEASIVHDELNSQQLYTNPDSPVAQDTSGPGIPLNLSNSLDVHNRPDRFGST
FT                   LANETTQTIMSDSHISPGDQSFEPCDSGLSNALDCGIPELGLDENHLFTLSDAGLSPL"
FT   gene            complement(99386..102813)
FT                   /locus_tag="ANIA_09025"
FT                   /old_locus_tag="AN9025.4"
FT                   /product="Putative transcription factor with C2H2 and
FT                   Zn(2)-Cys(6) DNA binding domain (Eurofung)"
FT   mRNA            complement(join(99386..102406,102752..102813))
FT                   /locus_tag="ANIA_09025"
FT                   /old_locus_tag="AN9025.4"
FT                   /note="transcript_id=CADANIAT00007828"
FT   CDS_pept        complement(join(99793..102406,102752..102813))
FT                   /locus_tag="ANIA_09025"
FT                   /old_locus_tag="AN9025.4"
FT                   /product="Putative transcription factor with C2H2 and
FT                   Zn(2)-Cys(6) DNA binding domain (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007828"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007828"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007828"
FT                   /db_xref="GOA:Q5ARQ5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ5"
FT                   /protein_id="CBF84438.1"
FT                   /translation="MEKIELRAGREIRSHVKLPERMHSCQVCDKTYQTRGSLTRHLRNH
FT                   SVNDSQHVCPTCGVAFSRRDLLRRHVRIHRLAQNNLNTTTTSNDLATPAPRRRCHTACQ
FT                   PCREARVKCDGGNPCSQCIATQTECLLGSRTGRVSRVVEKERRQEQYSHSDDGGSAGED
FT                   DKEDGDQEQDFSRVRVETSITAAPAMLHSPVSNVDAPIIPFLGSEDPLPDMDNIDHLAE
FT                   MDFSWTDSLPCTTTSWPWLHESLLLQGNPLLNWTNDSIYALDTGDMVPDSCPGIIPLDT
FT                   AQQLPVISPTKTVTSMSARDDAESGSAPPSEPGKPETRLQGPDMPEFQGQAALQQDQIV
FT                   EELVAYAEKRIVTPGSKLSRSLFWQSMSIRIAEAFRIDPCDSPGSESTLNRLMQIYKEN
FT                   FSPLWPLLSGKEFDSSELHPLLFLTVVSIGCMYGTSQECNFGNKLHERVRRCLAASLIG
FT                   LEDAEGDILWLGRARLLTQVAALYFGQRRAFSYAQHVGAITLAQARRMDLFSTVGRPGM
FT                   TGELSLEQQTVLWQNAEARKRLAFGILRADVFTSVLLNTRPLLSAEEIYLDLPASDEIW
FT                   MNLDTIPLEQLASRLKDESSRALGLPFCDLVRVASDRGEALLNMNPRGYELLIFGLQEY
FT                   VWRFSHDRSMFPRLIGQSDHTVAQKENLPSSPNGLSISASLQTDQLGRTYRRMNDLRND
FT                   RCRITQTLQRWEQSFTSTRTTQSFGQDRTSVMSSLLLLYISYLRLCVPLADLHSAAYIL
FT                   MDNKPLEPKKLQTLQEWAKGTGAVEAIKHVCQIWSLLSQERFRTGTDKAKYNLLSFSGL
FT                   HHAAVVIWTFAGVHSEPVAEVAELPGWRDMAPISIQRDQTRSLLRAVVSLYKHLIPRGW
FT                   YSFAAVAESLAAQPFPDSSR"
FT   gene            complement(107206..108194)
FT                   /locus_tag="ANIA_09024"
FT                   /old_locus_tag="AN9024.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(107206..107450,107501..107937,
FT                   108031..108194))
FT                   /locus_tag="ANIA_09024"
FT                   /old_locus_tag="AN9024.4"
FT                   /note="transcript_id=CADANIAT00007829"
FT   CDS_pept        complement(join(107206..107450,107501..107937,
FT                   108031..108194))
FT                   /locus_tag="ANIA_09024"
FT                   /old_locus_tag="AN9024.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007829"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007829"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007829"
FT                   /db_xref="GOA:Q5ARQ6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ6"
FT                   /protein_id="CBF84439.1"
FT                   /translation="MNIYATGFSRQKFILCTTRGTTEFRNHRDPLMAPFDKIKPYSELK
FT                   LNSDGEISERYGFPHLGHPSQKYSLSWKTDQAGGGWLSLGNYFGFSTVFIKKREVVKPR
FT                   TGFPKLQRAFHENLVGLIEAFQDGADIYLAYNYHGFAVSLSQVCSTPGIRLAESDLASI
FT                   CRSVLKGLEYIHETLLVAHGNVDSNNTLLCHDGAVKIANIGDSMMDVGHQRSFALDREN
FT                   VGSLLVQLSIAHMTELPPRNQGSNLGAYINLSKYAEHFGFLVLDGSSRKKPRLVGFGPT
FT                   "
FT   gene            108395..110297
FT                   /locus_tag="ANIA_09023"
FT                   /old_locus_tag="AN9023.4"
FT                   /product="metalloreductase, putative (AFU_orthologue;
FT                   AFUA_7G07120)"
FT   mRNA            join(108395..108987,109045..109244,109392..109786,
FT                   109854..109900,109949..110141,110200..110297)
FT                   /locus_tag="ANIA_09023"
FT                   /old_locus_tag="AN9023.4"
FT                   /note="transcript_id=CADANIAT00007830"
FT   CDS_pept        join(108415..108987,109045..109244,109392..109786,
FT                   109854..109900,109949..110141,110200..110297)
FT                   /locus_tag="ANIA_09023"
FT                   /old_locus_tag="AN9023.4"
FT                   /product="metalloreductase, putative (AFU_orthologue;
FT                   AFUA_7G07120)"
FT                   /note="transcript_id=CADANIAT00007830"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007830"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007830"
FT                   /db_xref="GOA:C8VKX7"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKX7"
FT                   /protein_id="CBF84441.1"
FT                   /translation="MSVGWRIYSFHLLRVPLFPQIQLRYQLNMDILVIYAITAGSVLVS
FT                   LVAFRLLRLLSQWKSPILVLLSRHIIYPHVVARHRFLGPWSRLSVLTHLAYATVNSILV
FT                   FFLNFSLENVSRRAGDLSLINMIFLLTSSHLSYSADLLGIPLRTYRQMHRASGWMAMAL
FT                   VVLHVGALVFNRKDGITRSDGQTLFPVIATACLAALSLIFLPFVRKFSYELSLRVHQAL
FT                   TIVSVYGIWKHLPQDKLLPRLYLYIGLSVFTGTSCLPVNVRAGQYVNLWLPGVSFWSWT
FT                   QTHPFTVVSWSQGKQSELEFLVQPRSGLTATIARQMRVIGPDGYSCLALYSGPHGLSES
FT                   VNNYETVLLIAGGAGLPAVIPYAKRLIYGYNTCTSHVRRVHLVWQAETREQLNDLLKED
FT                   VLDDGYILSISIYVEQGPPVREKLLFGKHERATLYQGAPDYATVVSTELSREKIEKLSP
FT                   IRDNQGQVLLIVSAPGVLRDELRHIVRGHLHQRIKMVELEYQP"
FT   gene            complement(110677..111329)
FT                   /locus_tag="ANIA_09022"
FT                   /old_locus_tag="AN9022.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(110677..110940,110963..111177,
FT                   111243..111329))
FT                   /locus_tag="ANIA_09022"
FT                   /old_locus_tag="AN9022.4"
FT                   /note="transcript_id=CADANIAT00007831"
FT   CDS_pept        complement(join(110677..110940,110963..111177,
FT                   111243..111270))
FT                   /locus_tag="ANIA_09022"
FT                   /old_locus_tag="AN9022.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007831"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007831"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007831"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKX8"
FT                   /protein_id="CBF84443.1"
FT                   /translation="MNTNGVVKIGCLEKCVLRDQNESHKAELVSVGNITMELLQKYVKN
FT                   EGRVGIDKLDRWSSDSVAVSFLSATTSANSIKTLMEENGALTYVSLQASPNKQNAFLQG
FT                   GTNRPRVVCTPFDENILVLCPTGKRETASFVSCWIKLLLRLSRSRICESCTSSKDSDIH
FT                   RSTRD"
FT   gene            112517..115618
FT                   /locus_tag="ANIA_09021"
FT                   /old_locus_tag="AN9021.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(112517..112928,112979..113277,113327..115618)
FT                   /locus_tag="ANIA_09021"
FT                   /old_locus_tag="AN9021.4"
FT                   /note="transcript_id=CADANIAT00007832"
FT   CDS_pept        join(112517..112928,112979..113277,113327..115618)
FT                   /locus_tag="ANIA_09021"
FT                   /old_locus_tag="AN9021.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007832"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007832"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007832"
FT                   /db_xref="GOA:Q5ARQ9"
FT                   /db_xref="InterPro:IPR022198"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ9"
FT                   /protein_id="CBF84445.1"
FT                   /translation="MRRALFNEDDAKQARERRLKYQGTARVKISEIGFDSANYIDDKNV
FT                   ERLCGIFRKSGCRRFDVEHHIPATVSRNALAEALQKAGVPARALLLSSGEDTPFLTFSR
FT                   GQLVGLHGRHRLSAGARVLAPLERWWTVDLFLDDISKDLRVSLVEEYSNQKKLTDGEIY
FT                   WTIRQYESEGSSLLRQKWFTRLSDWKQKRIKQLDREENRQLREAFDRLLTIQGLWYDGM
FT                   RLGMIHRLIALAATEEILTYFDHIYETYLFFVNGDRGSLNRIDTETVLGLQLKCPRVCE
FT                   KDRKEVNGLVLSGQVFSSFSESERRNICRRLQSFDGIIPSLYTFWEDFKYLECCAQCIR
FT                   RLFGQVNGSIWNTMKHMFVGTADEDYGIVQTSEFSFRRQTAGNNERLDLGYRQLWLYAM
FT                   RNYRLLPQPAKEEEELLVKPSRREADDRVLYEMAELARRLGFWSDEIRALLDGSPDRQI
FT                   ARAALLQARKPDQFQYDPVQLEGLVDRVVACFSAAIEYVRQPPELLADSEVSTRARRGL
FT                   PQVKAHAQDAPHLFLDKVHNEVTSSSATLTTFFVRRCVYFAFFGKCSLSGSRVRDLGPG
FT                   GPPGDTPGLFVNENMQTTGASSTVPESTVAQGSGTRPTHEDIPTRQRLEGHSEPILEDG
FT                   VGRSSQLALSGENTGYDEMADEGTRSHSPANQVATSGIPESLSLGLQRVSSADASSLNG
FT                   EQLGHQNAEQTPLSRDSDWPSTPAESNLDTSLGEQPQPMDYSPSIYSVRESGARNTGTG
FT                   AERQYSQELERAIQERERLDNDWERERLEQELGLPTSSSAQGEIAPVQCSKEDEVPETL
FT                   RQTVEPPDGSDQEPSSSNVGTNDQQTREPLTQGDRPVTLLDIHNSALVPSGRQGGQSPT
FT                   AGAFEDSRVEDRMELVEFTFWSLERGQWRRADHLWVDPADTFRVELIAKKYIWKDFSLY
FT                   DRHWNSLSPAQCFRAATVDGSNAIFVVSEDEERRLQAEGRRMKMTQIQAISHRAGSDPT
FT                   EPERQLKRNRL"
FT   gene            116117..116443
FT                   /locus_tag="ANIA_09020"
FT                   /old_locus_tag="AN9020.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            116117..116443
FT                   /locus_tag="ANIA_09020"
FT                   /old_locus_tag="AN9020.4"
FT                   /note="transcript_id=CADANIAT00007833"
FT   CDS_pept        116117..116443
FT                   /locus_tag="ANIA_09020"
FT                   /old_locus_tag="AN9020.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007833"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007833"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007833"
FT                   /db_xref="GOA:Q5ARR0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR0"
FT                   /protein_id="CBF84447.1"
FT                   /translation="MDASDDPQGHQLNELTAQRLQCYQGCAIVRLQNLEFETNPLHGSL
FT                   DFDERKVERLLTIFEIEGCGNLAPEHRVAALINRGTLSKAISQSGITWESLLDPTIQPQ
FT                   LLLE"
FT   gene            118142..119381
FT                   /locus_tag="ANIA_09019"
FT                   /old_locus_tag="AN9019.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(118142..118560,118961..118997,119133..119381)
FT                   /locus_tag="ANIA_09019"
FT                   /old_locus_tag="AN9019.4"
FT                   /note="transcript_id=CADANIAT00007834"
FT   CDS_pept        join(118142..118560,118961..118997,119133..119381)
FT                   /locus_tag="ANIA_09019"
FT                   /old_locus_tag="AN9019.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007834"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007834"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007834"
FT                   /db_xref="GOA:Q5ARR1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR1"
FT                   /protein_id="CBF84449.1"
FT                   /translation="MDPHPSGNLDPPPPLAADFEDPSCNYPLERKHYLYGHRKIPEILR
FT                   MWYQSSREVIIIFLFESRIYYKFNRAGGFNLRSTLQDLSREHIFLIINDFGIRVPDTHK
FT                   AYDEALKERLLLVARRDNPGRRKDDVGQISVDKLRECFKLSQYEELGAPQAEWVCGRWG
FT                   GESTIGLPKRCRTPIATAYSHRGEPKMRRRWLCTPGDAIGREIFKRMGKLSSSIVFLSR
FT                   HQKRSQWPKNVD"
FT   gene            119671..120491
FT                   /locus_tag="ANIA_09018"
FT                   /old_locus_tag="AN9018.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(119671..120392,120455..120491)
FT                   /locus_tag="ANIA_09018"
FT                   /old_locus_tag="AN9018.4"
FT                   /note="transcript_id=CADANIAT00007835"
FT   CDS_pept        join(119854..120392,120455..120491)
FT                   /locus_tag="ANIA_09018"
FT                   /old_locus_tag="AN9018.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007835"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007835"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007835"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR2"
FT                   /protein_id="CBF84450.1"
FT                   /translation="MTQSSHHVDDVSQFQEFEPWELNSQYAPTPGYIGSPYVSRSSYSP
FT                   SPSRELVNVPEAASQSRPDTLRLLQLSEWEEGRAYDENPPSCIHYLIEWRVTINNRVVA
FT                   KDTDEDLVLAPSAHWQLFLEDKLENVLRRKVSRNRRVRADDTEIVVSVNDRSHRDLTKR
FT                   FDNTDINWTAIEKQLVIGWTLSNRWTER"
FT   gene            complement(120620..122820)
FT                   /locus_tag="ANIA_09017"
FT                   /old_locus_tag="AN9017.4"
FT                   /product="Putative C2H2 finger domain transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(120620..120834,121121..121301,
FT                   121545..121875,121929..122309,122363..122820))
FT                   /locus_tag="ANIA_09017"
FT                   /old_locus_tag="AN9017.4"
FT                   /note="transcript_id=CADANIAT00007836"
FT   CDS_pept        complement(join(120620..120834,121121..121301,
FT                   121545..121875,121929..122309,122363..122820))
FT                   /locus_tag="ANIA_09017"
FT                   /old_locus_tag="AN9017.4"
FT                   /product="Putative C2H2 finger domain transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007836"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007836"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007836"
FT                   /db_xref="GOA:Q5ARR3"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR031348"
FT                   /db_xref="InterPro:IPR039327"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR3"
FT                   /protein_id="CBF84452.1"
FT                   /translation="MSGLEALGIAASIIQVADLGTKLSVKLFSFYKQFKDANESMHFLS
FT                   SEIAFVSAILRELGDTLKDEESSKLCSEEAFRSLKHTLDQCRDVLEQIQRVTSHTDRSG
FT                   KTRFQQVAGKFRMVLLEPSLDPLKNRLERLKSTMLLLLNVIMYAGQIRSSHGFPPLLQD
FT                   QRVLMDSLLKDKIKNGQEPRQFAVAEQCPKAPSVSTSSNGAHADIDGTIDTDEPAEFKE
FT                   YNLLIQKMLQEIGRCKYKLEESRHSRIKTGVLNIHSGEIMRFQLEYGHHVRTDHSLFTE
FT                   EKASRQMANVRKDENRPQRPIASTEATGANMPDNRTDGPPEVTVSSLTRESRRPSPRLA
FT                   KGKEPRESIFDLPLSPVPLAPVKEEEPVQSSNLTKETTALPTPYMFPATTVKSSAPIPG
FT                   AQQHNRPRRRYEEIERMYKCGWNGCEKTYGTLNQLNSHVTMQSHGAKRTAGEFKEIRKE
FT                   WKARKKEENAQRKAAEEYERAATQAALTSQVEPPGLFPDNLEDLLLRWTTLDRREICVE
FT                   VPAC"
FT   gene            123111..124327
FT                   /locus_tag="ANIA_11158"
FT                   /old_locus_tag="AN11158.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(123111..123369,123441..123764,123832..124327)
FT                   /locus_tag="ANIA_11158"
FT                   /old_locus_tag="AN11158.4"
FT                   /note="transcript_id=CADANIAT00007837"
FT   CDS_pept        join(123129..123369,123441..123764,123832..123914)
FT                   /locus_tag="ANIA_11158"
FT                   /old_locus_tag="AN11158.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007837"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007837"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007837"
FT                   /db_xref="GOA:C8VKY4"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKY4"
FT                   /protein_id="CBF84454.1"
FT                   /translation="MELLPTEILFDIVEHLCNRETKTLSLVSKRVRDVCLPVLFRKINI
FT                   EFSTEGFDLLESLLKSSIRRYIVSFQYIVPKLVKPQIRNYEIFRTEILTPGQYVEACEY
FT                   HDDVDSYEDWDEMEYVSGDQPSYTRMYKTIRRTCARQQEIIEARRDSTLMKLAFQQLSN
FT                   LKELVLVFSQAQGDEDWEEEYQEEYANLSKGFSSPVSNILPTLWWKAHIRTL"
FT   gene            124831..125619
FT                   /locus_tag="ANIA_11160"
FT                   /old_locus_tag="AN11160.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            124831..125619
FT                   /locus_tag="ANIA_11160"
FT                   /old_locus_tag="AN11160.4"
FT                   /note="transcript_id=CADANIAT00007838"
FT   CDS_pept        124831..125619
FT                   /locus_tag="ANIA_11160"
FT                   /old_locus_tag="AN11160.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007838"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007838"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007838"
FT                   /db_xref="GOA:C8VKY5"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKY5"
FT                   /protein_id="CBF84456.1"
FT                   /translation="MANNTTPNLVVLVDADNAMPSTARLILAEVAKYGTVYVKRAYGDW
FT                   TSTSLKGWKKELLSQSIQPFQQFAYTNGKNSTDSAMIIDAMDLLYSNRFGGFCLVSSDS
FT                   DFTRLAARIRESGLTVYGFGEQKTPKPFVAACNKFIYTENLSFHGELVPHPDRVIVPKN
FT                   HVPARHAHADGHLKTLLHTTIETASDDDGWAELSNVGTLLTKKHPDFDSRTYGYNKLGD
FT                   LISALSLFDVVRQLPRKGKAGKIYVRDKRRGRKDSAASST"
FT   gene            complement(126351..128554)
FT                   /locus_tag="ANIA_09015"
FT                   /old_locus_tag="AN9015.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(126351..126393,126452..127103,
FT                   127161..127504,127568..127677,127736..128291,
FT                   128337..128554))
FT                   /locus_tag="ANIA_09015"
FT                   /old_locus_tag="AN9015.4"
FT                   /note="transcript_id=CADANIAT00007839"
FT   CDS_pept        complement(join(126351..126393,126452..127103,
FT                   127161..127504,127568..127677,127736..128291,
FT                   128337..128554))
FT                   /locus_tag="ANIA_09015"
FT                   /old_locus_tag="AN9015.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007839"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007839"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007839"
FT                   /db_xref="GOA:Q5ARR5"
FT                   /db_xref="InterPro:IPR021842"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR5"
FT                   /protein_id="CBF84458.1"
FT                   /translation="MAWSASFRVCPICLALFLTLEKMIADNLQKALADRIARAKSRGFT
FT                   LEYQNEQEQQENVICRRELAPATFNKYEFSLKALTAARWRLSRNEPQNANFSKDDPDPS
FT                   PQLLKLFVEDYIVTREHTPTQKTACSILICFVSRWERETSRSMPEAVKEDVLNVRHPLF
FT                   LLLSFITDRSKHIRTALTTKYGLPTRPRERFLVTAKDIELLLRHLFVNDTHDYVHERAR
FT                   VQTGTGLSLFAGSGARAGAIVESSSYRGTNECLYYRHLSFHLKWSRKGDGLKRWVTIDP
FT                   EFLKGWRYRDDVTLPKNWLREHPVLGMNFVFWVIVHGVADGAFKGLPTVANVLAAKPPE
FT                   GRESWTLEWSDKAKDLPFFRMVTPEGPHATRALTFSSLHHNFTSLAQRDCFKDQLRVHG
FT                   IRGGVANLIDPKASEATRGQALDHQNHETYLKYQSVLKALDIQSLFYDLEPEYECRDME
FT                   QSMAHHRDTNVPQKLDAAAIAEFEAQDEIVKINRRIAVLTAEIAGNPRGHEDLVSERAR
FT                   LYTKKAKRRRAWKAEFIRRWWDSSYDEYISGNNFAERDTTPLFGIYKKYLPERARLSEN
FT                   LFRETPLDSDIGRQCLEDMVALCKSTERVVYYPDMSPVSGCCPTCSKPMSGGRQSTFYN
FT                   VEEAL"
FT   gene            complement(129134..130561)
FT                   /locus_tag="ANIA_09014"
FT                   /old_locus_tag="AN9014.4"
FT                   /product="FMN-dependent dehydrogenase family protein
FT                   (AFU_orthologue; AFUA_8G02300)"
FT   mRNA            complement(join(129134..129209,129265..129341,
FT                   129409..129764,129992..130226,130280..130420,
FT                   130475..130561))
FT                   /locus_tag="ANIA_09014"
FT                   /old_locus_tag="AN9014.4"
FT                   /note="transcript_id=CADANIAT00007840"
FT   CDS_pept        complement(join(129134..129209,129265..129341,
FT                   129409..129764,129992..130226,130280..130420,
FT                   130475..130561))
FT                   /locus_tag="ANIA_09014"
FT                   /old_locus_tag="AN9014.4"
FT                   /product="FMN-dependent dehydrogenase family protein
FT                   (AFU_orthologue; AFUA_8G02300)"
FT                   /note="transcript_id=CADANIAT00007840"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007840"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007840"
FT                   /db_xref="GOA:Q5ARR6"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR6"
FT                   /protein_id="CBF84460.1"
FT                   /translation="MAHRGESFHKDVSCIADLKALGSSRLPATSDYYNEGAMDLITLRD
FT                   NEAAFDRYKILPRVLINVAKVDTSTEILGTKVSLPFGFSPAASQKLAHPDGELATSRAA
FT                   ANFGICMGLSSYSNYSLEDVAAQGMGNPYVMQMCVLRDRSITLQLLQRAENAPNRPSLP
FT                   DPSLDWASTIPWLREHTSMQIWLKGVCSPADVELAIHYGVDGIVISNHGGRQLDGVPAT
FT                   LDSLRLCAEVAKGRIPLAIDGGIRRGSDIFKALALGARYCFMGRIPIWGLAYNGQEGVE
FT                   LAIKILRQELRVTMALAGCQTISEIRESHLSVLQPDGRLSKL"
FT   gene            131163..133385
FT                   /locus_tag="ANIA_09013"
FT                   /old_locus_tag="AN9013.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor,
FT                   putative (Eurofung)"
FT   mRNA            join(131163..131388,131453..132390,132446..133120,
FT                   133185..133385)
FT                   /locus_tag="ANIA_09013"
FT                   /old_locus_tag="AN9013.4"
FT                   /note="transcript_id=CADANIAT00007841"
FT   CDS_pept        join(131163..131388,131453..132390,132446..133120,
FT                   133185..133385)
FT                   /locus_tag="ANIA_09013"
FT                   /old_locus_tag="AN9013.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor,
FT                   putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007841"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007841"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007841"
FT                   /db_xref="GOA:Q5ARR7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR7"
FT                   /protein_id="CBF84461.1"
FT                   /translation="MPRPRRSHTLGACRTCRRRHVKCDQKRPACGTCRTLGVPCEGFAN
FT                   EVRWMRDGSDDGDDGSKAEEQQGARRHLYTEQLRQSMSTSLGSNLVSGSISASLAEIDL
FT                   KTRDAEHPGGDIVIGPFGVLDFGSTQPQEKKQDSQKMTPKQLEPSREAPHSPPQTASTA
FT                   GQEIQELPTLVNDSPSYIDDFLHWSDILGLSPEQPGFFQPSMLDLDTYLADPIPESFDV
FT                   DMNVETRAGPRSMAIPTPPSSAMEMASTFLDAAALADAPYLFKHFNENVVPQMMIMPLG
FT                   DKSPWRILNLSAAMATYNELTILGSQSISHARLANLYALLACSAAHLSISHGSTVSTGS
FT                   THWQQASGQMFEQARDHMQKSLKLETREPKRAKYKDQLMAICCLIQYTVISGQQQHGRS
FT                   FMVNAEYILRMRGLLKHRISQKSRLLHHVYTWLRLVGESTYVLHDYNPSSTFIEALKSN
FT                   FQRPRVDPIVDSSPELNPRLDDFLRLEAHDADSDLNINEPKDEQTGLHDIHLQDSRSFS
FT                   NTLYKQVYGIPETWLSLLSQTTRLANVMETFRIAQQACGNTSLDAWETLHRRSVRLENL
FT                   ICSCDLSLVRDAFRPHDHMLRALNAALVIFFYRRIRRLPCRLNIALDLELHGRRLLQVA
FT                   KPSHLSGERRFWHGLTMPSQTAALPVSAPREISWSTCGISRTSI"
FT   gene            complement(133560..134456)
FT                   /locus_tag="ANIA_09012"
FT                   /old_locus_tag="AN9012.4"
FT                   /product="dihydrodipicolinate synthetase family protein
FT                   (AFU_orthologue; AFUA_8G02270)"
FT   mRNA            complement(133560..134456)
FT                   /locus_tag="ANIA_09012"
FT                   /old_locus_tag="AN9012.4"
FT                   /note="transcript_id=CADANIAT00007842"
FT   CDS_pept        complement(133560..134456)
FT                   /locus_tag="ANIA_09012"
FT                   /old_locus_tag="AN9012.4"
FT                   /product="dihydrodipicolinate synthetase family protein
FT                   (AFU_orthologue; AFUA_8G02270)"
FT                   /note="transcript_id=CADANIAT00007842"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007842"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007842"
FT                   /db_xref="GOA:Q5ARR8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005264"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR8"
FT                   /protein_id="CBF84463.1"
FT                   /translation="MSDLNLNGILVALVTPFTDDKTAIDEARLELHIKHMLDAGIHGLV
FT                   PGGSTGEFTTLSLSERKQLTELCVRFAGGRVPVVAGTGATSTSEAVELAVHAKEVGAAA
FT                   VMVVPPFYDPVNLQQLTELLAEIHEKSTLPIMYYNIPSASGLKLSPSEIAGLSRVGVRW
FT                   LKDTSGDAPAFTELVFGLSDQITALNGWDTLTFYGLAAGCPGGVWGAANIIPELAVELY
FT                   EAVSIKKDLDKGKELWSKAWPICKFLESHNYAAAVKTGVELTGQATGGLRKPFALLGPE
FT                   LQEELKGLLKNAGVATV"
FT   gene            135753..137748
FT                   /locus_tag="ANIA_09011"
FT                   /old_locus_tag="AN9011.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(135753..136206,136268..137263,137345..137748)
FT                   /locus_tag="ANIA_09011"
FT                   /old_locus_tag="AN9011.4"
FT                   /note="transcript_id=CADANIAT00007843"
FT   CDS_pept        join(135753..136206,136268..137263,137345..137748)
FT                   /locus_tag="ANIA_09011"
FT                   /old_locus_tag="AN9011.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007843"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007843"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007843"
FT                   /db_xref="GOA:Q5ARR9"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARR9"
FT                   /protein_id="CBF84465.1"
FT                   /translation="MTQSQVHESGDSPVASIEEFTTTPFDFIVCGGGTAGLAIAARLSE
FT                   ISNVNVGIVEAGKYRIGDPLIETPATFMQMFEDPEYDWCLFTAPQEANNGKVHHIPRGK
FT                   VLGGSSAINYLMYVRGSLQDYDDWAALVGDEGWSAANMKAYMRKHQAQPVNPESKAAAS
FT                   PIAPEHHGTTGPIRTSFNESNLPIETDFVKACAETANLPNMPIDAWSGDHIGFYHTLGA
FT                   VARTGPNRGKRSYAGIEYYEANRLRPNLKLLCEARVNKVILNGTRATGVSITFRGQEYT
FT                   VSASREVIVSGGTIQSPQILELSGIGDPEVLAASGVQCLVENRAVGANVQDHSVSLISW
FT                   QMQPGVVTSDTLGQVPEAAAAALHQYAESRTGPLSSIGSTQGFIPVKSILSDAELAEIV
FT                   QSIRDIKPSSAFHEKQLQQVIAHLESETSANLQVVFLPCSVHENGVEHQRGLFTPPPVG
FT                   EPVCVSAAPCLQYPVSRGSIHINSNDPSVPPTIQPNYISHSADVALLAAFLSWIDRVGH
FT                   AAPFASSVSRRILPKSSLDLQDSEQAKRAIHDTVIGEYHICGSVAMGDALDSRLRVKGV
FT                   EGLRVVDASVFPNNVSGNIMSSVYAVAEKGADLVKEDHGLL"
FT   gene            complement(137873..139824)
FT                   /locus_tag="ANIA_09010"
FT                   /old_locus_tag="AN9010.4"
FT                   /product="MFS nicotinic acid transporter Tna1, putative
FT                   (AFU_orthologue; AFUA_3G03820)"
FT   mRNA            complement(join(137873..138096,138146..138259,
FT                   138325..138615,138678..138969,139045..139184,
FT                   139264..139330,139384..139499,139557..139824))
FT                   /locus_tag="ANIA_09010"
FT                   /old_locus_tag="AN9010.4"
FT                   /note="transcript_id=CADANIAT00007844"
FT   CDS_pept        complement(join(137873..138096,138146..138259,
FT                   138325..138615,138678..138969,139045..139184,
FT                   139264..139330,139384..139499,139557..139824))
FT                   /locus_tag="ANIA_09010"
FT                   /old_locus_tag="AN9010.4"
FT                   /product="MFS nicotinic acid transporter Tna1, putative
FT                   (AFU_orthologue; AFUA_3G03820)"
FT                   /note="transcript_id=CADANIAT00007844"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007844"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007844"
FT                   /db_xref="GOA:Q5ARS0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS0"
FT                   /protein_id="CBF84467.1"
FT                   /translation="MAIPDADLEYEKPSVIALEGNDHGGLTSLDQVFPPDMQKRVLRKM
FT                   DLRLIPMLALLYLLAFLDRGNIGNAKIEGMLDDLHMSGSEYNWCLTVFFFTYVAFELPS
FT                   NLLLKKLRPSRLLPLLMVAWGIVMTLMGIVQDYHGLLISRLFLGVAEAGLYPGIAYYIT
FT                   LWYPRHLAQYRQAMFFSAASVAGAFSGILAWAIAKMDGVGNYAGWRWIFILEGILTVLV
FT                   GIIAPFAMYDFPETATFLTEEERKYVIHALRTQNSGQDTLSAGGDAVEEQAKFRPRYVL
FT                   DALTDWQIYVGLFMYWGITCPLYGISFFLPSIIRDLGYTSSTAQLLTVPIYITAAAVAV
FT                   AGAWLSDRYKKRSPFILFFMSLIAIGFVIVLASSDRGVPGVVYFGVFIAVVGIYPAFPG
FT                   NVTWISVNLAGDYKRAAGMAIHIGLGNMAGAMASNFYREQDAPKYTLGHALELGFCVVG
FT                   LLAVLILRFSYKRINKKREAMDLSQWDSYEMAKMGDRSPMFRYML"
FT   gene            140489..141154
FT                   /locus_tag="ANIA_09009"
FT                   /old_locus_tag="AN9009.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(140489..140562,140686..141154)
FT                   /locus_tag="ANIA_09009"
FT                   /old_locus_tag="AN9009.4"
FT                   /note="transcript_id=CADANIAT00007845"
FT   CDS_pept        join(140489..140562,140686..141154)
FT                   /locus_tag="ANIA_09009"
FT                   /old_locus_tag="AN9009.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007845"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007845"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007845"
FT                   /db_xref="GOA:Q5ARS1"
FT                   /db_xref="InterPro:IPR032345"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS1"
FT                   /protein_id="CBF84469.1"
FT                   /translation="MATVHPNAEKLISLAEEFFAEVADLTPGRALEEYLNEHYGPGNKY
FT                   YDTFCSLILSGLRNNEGWVATDELDGPRYRRSRLCDPSERTRYFSITTVYMQSQDEYRG
FT                   QYHLHPYGEINCVVQVDRTAELKGMNGWQAAGWTSPAAGTHHYPEVRGGALVALFFLPA
FT                   GRISYKATPEMAQPPYV"
FT   gene            complement(141221..145309)
FT                   /gene="fphA"
FT                   /locus_tag="ANIA_09008"
FT                   /old_locus_tag="AN9008.4"
FT                   /product="PhytochromePutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5K039]"
FT   mRNA            complement(join(141221..141704,141761..145309))
FT                   /gene="fphA"
FT                   /locus_tag="ANIA_09008"
FT                   /old_locus_tag="AN9008.4"
FT                   /note="transcript_id=CADANIAT00007846"
FT   CDS_pept        complement(join(141411..141704,141761..145309))
FT                   /gene="fphA"
FT                   /locus_tag="ANIA_09008"
FT                   /old_locus_tag="AN9008.4"
FT                   /product="PhytochromePutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5K039]"
FT                   /note="transcript_id=CADANIAT00007846"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007846"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007846"
FT                   /db_xref="GOA:G5EB62"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB62"
FT                   /protein_id="CBF84471.1"
FT                   /translation="MSELPSRSISPRDPSPGETPGRDPSTPSTDAGVGYSASQDAPSFG
FT                   AYDRVYPIRSLVSLEPPATSEPSSNKSKSPLSPTSGARQFSIIDGHTWTRLRSDSRANS
FT                   TDYSGGTGLSPESSEAPSSQRMSDSSSARPPSNTTGLRRGDDHTTFTPSSEDSHPQVQE
FT                   PYELMTTRFRHVVTDDGHAVITGRTVDSFKACEDEPIHIPGAIQSFGALVAVREEPGEQ
FT                   MVVRIVSENSQDILGYSPNDLFSLPTLCDIFPEDQADNFLDHVDFVKEEGYDPSVDGPE
FT                   VFILTVNQPNGSTIRVWCAIHTNPALNGLVICEFELEDDHVNPLTSSGHISPAVPTNTL
FT                   DVVPTIEQMAGSTITINQPLRVLRRARRRKGEAAAMEVFSIVSQIQEQLARADNMEALL
FT                   DTTSGIVKELTGFHRILVYQFDSEFNGKVVSELVDPTMSIDLFKGLHFPAADIPKQARD
FT                   LYRINKVRLLYDRDHVTARLVCRALEDLETPLDMTHAYLRAMSPIHIKYLANMQIRSSM
FT                   SISINSMNDLWGLISCHSYGPRGMRVSFPIRKMCRLIGDTVSRNIERLSYASRLQARKL
FT                   INTVPTDANPSGYIVASSDDLLRLVDADYGALCIRGEVKILAKSPQSQEMLALLEYLKV
FT                   RKYNSVLTSNHIVKDFQDLNYPPGFKDISGLLYVPLSTDGLDFIVFFRRGQLTEVKWGG
FT                   NPNEAKFTEGHLEPRKSFQTWRETVLDRCRDWTESEVDTAAVLCLVYGKFIKVWRQQEA
FT                   ALESSSLTKLLLANSAHEVRTPLNAIVNYLEIALEGALDGETRDHLSKSYSASKSLIYV
FT                   INDLLDLTNVEKGQSLIKDEPFDLPTTFSEATAMFESEAKRKGLNYKVLSQPGIPETVI
FT                   GDQRRVRQSISNLISNAVQNTSSGGVTVEVWHAPGEGDTDKATVKIAVLDTGRGISSST
FT                   LELLFRELEQVSGEDDSHYYGGSEEGEESAPEAKASKDKAVLGLGLALVARIVRNMHGQ
FT                   LTVRSEEGKGSRFQISLQFPIPEGSDTKSPTAEHRPVATGDSAAPFSTGDDVILVDSTT
FT                   GSKRNSQDSLTRPDVPRKSEPEDTAPADGAGEQASGESEAQTRPKKTGESTASTSHEQS
FT                   ETARSRPSGPSSGPSAPERRPLRVLVAEDDPINAKIIEKRLEKLGHTVQRTVNGEECAN
FT                   AYSAESTQWDVVLMDIQMPILDGIESTKRIRQHESQSEVANLHIPIFAVSASLLEKDVQ
FT                   MYMDIGFDGWIMKPINFVRLNTLLAGIHEERARNGAVYQPGQWEKGGWFTPYTHS"
FT   gene            147871..149790
FT                   /locus_tag="ANIA_09007"
FT                   /old_locus_tag="AN9007.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            join(147871..147986,148057..148668,148714..149586,
FT                   149767..149790)
FT                   /locus_tag="ANIA_09007"
FT                   /old_locus_tag="AN9007.4"
FT                   /note="transcript_id=CADANIAT00007847"
FT   CDS_pept        join(147900..147986,148057..148668,148714..149586,
FT                   149767..149790)
FT                   /locus_tag="ANIA_09007"
FT                   /old_locus_tag="AN9007.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007847"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007847"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007847"
FT                   /db_xref="GOA:C8VKZ4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKZ4"
FT                   /protein_id="CBF84473.1"
FT                   /translation="MTETELIIMLQLLLPRSWPAALLAAGTILSFVWIAYYRFIHPLSR
FT                   VPGPFLASVTPLVQLYHGLKGDRHLWIYELHQRYGDHVRLAPNFVSINNVEGLHKIYGH
FT                   GNKFRKADFYNGFLAIPGVYNTHNAIDKLVHGRKRRVLSQAFSDTALKGMEDVMLLHVR
FT                   QLCSILGRERPTSQSGDKDGATFNMANWFGYLTYDVMGELCFGKSFDMLIDGAKRRMIH
FT                   LVDRAAYRHYVCGLWMPLHRWHLDQIFIRRLTNDRWNFIMESRQEANIRAKERTSLGQD
FT                   AKKDFFYYLLNARDPETGKGLATQELWGEANVLMIAGSDTTSTSLSAAIFYLVRNPHAL
FT                   EKLKNEVRSHFSDVEEIVTGSKLNQLTYLKACIDEAMRLAPAVPGSIPREASDPVVTVD
FT                   GLVLPEGTGCGTPPYCIHRRPDYYREPLSYLPDRWIEGSTCKTADAAWTVTREEVDLAR
FT                   KAFCPFSIGPRGCIGKSMALMEMRVTLARLMYLFDFELADATGEDENGHFKMVDHFVVS
FT                   KTGPNVINIITRSL"
FT   gene            complement(151066..151647)
FT                   /locus_tag="ANIA_09006"
FT                   /old_locus_tag="AN9006.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(151066..151248,151315..151647))
FT                   /locus_tag="ANIA_09006"
FT                   /old_locus_tag="AN9006.4"
FT                   /note="transcript_id=CADANIAT00007848"
FT   CDS_pept        complement(join(151066..151248,151315..151647))
FT                   /locus_tag="ANIA_09006"
FT                   /old_locus_tag="AN9006.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007848"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007848"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007848"
FT                   /db_xref="GOA:Q5ARS4"
FT                   /db_xref="InterPro:IPR021054"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS4"
FT                   /protein_id="CBF84475.1"
FT                   /translation="MKVFNAILILYTLLPSLAIAQSPIDAALAQFQQLNDRIDSAQRSI
FT                   NAYNGGVLLALPVANSLYSAHTAATTARQSLTALDPLSPEDSQRALDAYNEVHPRLLAT
FT                   LAAGRDKAQVFRDAGVGYVAQGMISNLYNEKNRFEAALRDKIYPGYFQNDLAEAVDHAF
FT                   QGTLAQFY"
FT   gene            152386..160547
FT                   /locus_tag="ANIA_09005"
FT                   /old_locus_tag="AN9005.4"
FT                   /product="polyketide synthase, putative (JCVI)"
FT   mRNA            join(152386..153053,153102..153615,153659..154340,
FT                   154383..154829,155222..157056,157120..157219,
FT                   157269..157294,157342..158220,158252..158536,
FT                   158610..158645,158699..159051,159107..159584,
FT                   159636..160547)
FT                   /locus_tag="ANIA_09005"
FT                   /old_locus_tag="AN9005.4"
FT                   /note="transcript_id=CADANIAT00007849"
FT   CDS_pept        join(152386..153053,153102..153615,153659..154340,
FT                   154383..154829,155222..157056,157120..157219,
FT                   157269..157294,157342..158220,158252..158536,
FT                   158610..158645,158699..159051,159107..159584,
FT                   159636..160547)
FT                   /locus_tag="ANIA_09005"
FT                   /old_locus_tag="AN9005.4"
FT                   /product="polyketide synthase, putative (JCVI)"
FT                   /note="transcript_id=CADANIAT00007849"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007849"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007849"
FT                   /db_xref="GOA:Q5ARS5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS5"
FT                   /protein_id="CBF84476.1"
FT                   /translation="MVTFVQSHFPASDSQASDGEPILHQRVYPDSEGHDQNGAEAGSGG
FT                   ADTSGNTVSFNSVQGCPPIAIVGMALRLPGGVKSPDELWQFLIEKRNGVCEVPGTRYTV
FT                   DSFYSETMARCVKTRHGYYLQDDPACFDAGFFSINSHEAGRMDPQQRQLLEVVWECLES
FT                   AGETNWRGKNIGCYVGVYGEDWLDLASKDPQHTDRYHILGTGQFALSNRLSYEYDFQGP
FT                   SMTLQTGCSASLVGLHEACQALYSRDCCSAIVAGTNLMFAPTMTATMSDNTVMSPTGTC
FT                   RTFDEAADGYGRGEGVNALYVKRLEDAIRDNDPIRAVIRATSTNCDGHTPSITTPGSHS
FT                   QEALVRWAYKKAGISDITQTGFFECHGTGTVAGDTAEASVVAKLFEGKGIIMGAVKPNV
FT                   GHGEGASGISSVIKGVLALEHNTIPPNVFFKTPNPRIPFEEGKLQVPVEVMPWPKDRRE
FT                   RVSVNCFGVGGANAHAILDSISSVCGDNFRPLIENCEDDRARLLVVSARGAESLKQRIR
FT                   AVTDYANKDLSKLRDLAYTLGERREHLSHRAFTVANPNELLDEPNFQTGRDKAPEVTFV
FT                   FTGQGAQWAGMGKNLLTAFPTARKDIQHLEEALGSLADGPSWSIEEELSRTEKSRINEA
FT                   ELSQPLCTALQIVLVNILSAWGITPSSVVGHSSGEIAAAYASGAISARSAIIIAYYRGK
FT                   LAKELEGKGAMAAVGLSKDLVAPFLEESVVIACENSPQSVTLSGDSTAVDIVVDAIKRD
FT                   RPDILCRRLPVSTAYHSITAGLAHAGGIAINLNIINGPGNTISNLPPYPWQHNTRYWHD
FT                   SRLTREWRFRPHLHHELLGARSVESSELEPAWRNLLRLEDVPWVSEHALQGNVIFPAAG
FT                   YISMAGEAVCQLIPEASDFSIKNMLIKNPLLMKESAEYEIITTLKPVKITDLVESDWYS
FT                   FSIVSFDGASWTKHCHGQVRAGSDYPPKGRKIKQYARVLDVGTCYRFVERLGFAYGPLF
FT                   RRFTCISSDPNDRKASARLRDLGRTRYPLHPAIIDHLLQAFPMAIAQGLSRRFQIIVPA
FT                   AIGHIYVRRADVPESEMSLEALMAETGFGTWMGHGIMMAGDGNDAVPVLSMTDVAGFPA
FT                   SGTGDTASIPLGSQIRWAPDIDFVEASSLLLPAEPSDEYVSMMRACDALSILYILETAR
FT                   KLESVTEDPEVPHLKDWKAWITSTANRFGQQTDGYALDTGASNWAQLSSDERQSLMKVL
FT                   SSEVQHANEDQSGEVPAPLSCLRYVYNNVENLLTSTTLSDETRSQIEQYGAYLHSQHER
FT                   SWGHFLTLLGHTNPAMRIIEVGGSAGSVTRSILKHLTSPETVRLYSAYTFTDASAENVE
FT                   AARKAFAEEEIDFKLLAIEKDLGEQGFEKHSFDLVIASNVLRGRRGQLETSLRNIRELL
FT                   APRGRLMLNELDEGHLPTAFVMGLLPIWNRNKDVIPVHITREEIDAALRSTGFSGIEAI
FT                   RRDIESPDSVSLSILSSLNAEIPKKTITLLVKAAITYSESWVELLKGTLEQQGYEVCIC
FT                   DLQAGLPVEGEYLTISLLDMDGPYLHDLSEAGFTSLQGLLADIKQPILWVTGMSQFRCE
FT                   NPRYGLVFGFARTMRHEKDADFSIFETDTFGAESVKSLVSVVEKLLWSRADAETDPEYE
FT                   FALYQGTIYVGRCHWVCLADHIDSNSSMNLPRQLDIESLGSIDTLRWAPFEGPPLEEGQ
FT                   VEIEMKYIGLNFRVRHLHFRDILVSLGLFGEPNEFGLEGSGIVRRVAPGAIRDLKPGDR
FT                   VALLTTGTFRTRFVVHSRYCLRIPDHISLEGAATMPSVYITAAYCLIHLARLQKGELAE
FT                   ASVSRLSASLIAQIYATVGSDEKVQYLIDRFGIPRSRIFNSRTPDFLHDVMRETNGRGV
FT                   NVVLNSLTGALLHASWDCLASFGRMIELGKRDFLSNGQLNMGPFIKNRSYMGFDLTQFG
FT                   KEAYHTYESMHTQFETLTAENELVPIRPVRVYEATDVIDAFRYMQQGVHMGKILIRVPE
FT                   NPSSLSVSPGNSPFSLRPDASYLLVGGLGGLGRSVSTWMVEKGARHLVYLSRSAGLSEK
FT                   DQAFVRELEAQGCQAICVPGDVSAIADVEAAISKSSQPLGGVVQMAGFLQDAMFDKMKY
FT                   SEWESCVASKVQGTWNLHETTSSSALDFFIVVGSVAGICGNPGQANYAAANTFLDSFVQ
FT                   YRRDLGLPAAVIDLGAIDEVGMMAANQEAMQRAQAASVCFPSEQQLIEGLKLALSQCAV
FT                   PPSSKSLLSTSCIVGLSNTKPLSNPSVRPYWVRDVRFAIYKNLESRSTEAVQGGQSNEL
FT                   RTLLRRVEQNPSLLNDPESEEIVRREIGNQVTQRMPQAENMDEDEIANITIDSLMAIEI
FT                   RGWARRNLGLEITLVQIAKAKTVGGLTRAAVDHLKAKYGMKREDNENEARIGDRDGED"
FT   gene            161720..163663
FT                   /locus_tag="ANIA_09004"
FT                   /old_locus_tag="AN9004.4"
FT                   /product="xenobiotic compound monooxygenase, DszA family,
FT                   putative (AFU_orthologue; AFUA_1G17580)"
FT   mRNA            join(161720..161789,161853..161993,162099..162309,
FT                   162368..162380,162457..162516,162569..163303,
FT                   163445..163663)
FT                   /locus_tag="ANIA_09004"
FT                   /old_locus_tag="AN9004.4"
FT                   /note="transcript_id=CADANIAT00007850"
FT   CDS_pept        join(161720..161789,161853..161993,162099..162309,
FT                   162368..162380,162457..162516,162569..163303,
FT                   163445..163663)
FT                   /locus_tag="ANIA_09004"
FT                   /old_locus_tag="AN9004.4"
FT                   /product="xenobiotic compound monooxygenase, DszA family,
FT                   putative (AFU_orthologue; AFUA_1G17580)"
FT                   /note="transcript_id=CADANIAT00007850"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007850"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007850"
FT                   /db_xref="GOA:Q5ARS6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS6"
FT                   /protein_id="CBF84478.1"
FT                   /translation="MSTQQQQPDRPRKSLILNAFVEMCSGHQSPGLWVHPEDESHRFND
FT                   IDHWIELAQLLESAKFHGIFIADVLGGYDVYKGPRNLEPAITSGAQWPVNEPLAVVPAM
FT                   AAATKNIGFGVTVTTTYEQPYHLARRLSTVDHLTKGRIGWNIVTGYLDSAARNLGHAEQ
FT                   PQHDDRYAIAEEYIKVAYKLWESSWRSDAVILDKQRRVYTEPSRVREINHVGKYFNVPG
FT                   PHLCQPSPQRTPVILQAGTSKAGKTFAAQHAEAIFVAGHSPSVVAKNVAEIRELAKSQY
FT                   GRDPSSIKFLALLCPVLGKTEEEAKEKFAYYRSLGSIDGALALFGGWTGINLDVYGDDE
FT                   ELRSVPSNAIRSAVEGWSKATPEVPKWTKKTVGEHITVGGLGSTPVGTPEQVADEMERW
FT                   VREADVDGFNLAYAIKPGSFKDIIDLLIPELRRRGLFHEDYAAPRATYRENLYGKPGQS
FT                   GPPADHPAAKYRWHAGVEGHQIPE"
FT   gene            164400..168604
FT                   /locus_tag="ANIA_09003"
FT                   /old_locus_tag="AN9003.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(164400..168505,168547..168604)
FT                   /locus_tag="ANIA_09003"
FT                   /old_locus_tag="AN9003.4"
FT                   /note="transcript_id=CADANIAT00007851"
FT   CDS_pept        join(164400..168505,168547..168604)
FT                   /locus_tag="ANIA_09003"
FT                   /old_locus_tag="AN9003.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007851"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007851"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007851"
FT                   /db_xref="GOA:Q5ARS7"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS7"
FT                   /protein_id="CBF84480.1"
FT                   /translation="MDPLSITASVAGLATLAYQIIGYLGTVRSGGKDRLNLCREVTYLW
FT                   MSITSLLEQLSSDAIKDDKIPDSLRPLFDPDGIIKEIKIQLEDLEHTIKSRSTHGKIAQ
FT                   TLAWPFTQKDAEKMIDRIHRLKSTLQDGINQSTHALSQDIYRDGQGIKKVIDESRLKEL
FT                   IEWISPLNFITKQSMIWNEHHKGTCKWFLERDDFREWREGSNTRIFCPGIPGAGKTFLS
FT                   SIVYNELEALRVRDEGGLKGAAVVMLYCKWDDPLSQDIDNLLASVIKQFVQRYDVGTSD
FT                   MMELFTKHSKEGTRSSRAQLQSTLELLYSRFTKVFIILDGLDELRSEKEQLPLLMSLAP
FT                   NGSPYTVNLMVTSRPVPNIVRHFRHWPSLGGSIICDGCNAEGLAVQYHCADCEDYDLCQ
FT                   SCYKAGTRCGYKGHTYHLEFNARTIPIAAVEEDLTTYVHWRTSASETLQQFLEIKEGLM
FT                   DAILDTVVKNNEGMFLLAKFNMDTLESTLSIKQLMAALKTLPQELDGTYEDAMLRITEL
FT                   KASTRETVMRFLSWVVFAEQPLQEKAIEHALAVSDGDADIDDDNIIRARTLATKCAGLV
FT                   QLDESDCLRLVHYSAENYFRQHRDRWFPAGNVTIASSCLTYLQFDVFRSGACSGPSEDI
FT                   DFESRLSKYPFLRYASINWGKHLRVAADDHLSARALALITDAGCLATIAQALWYLEDQQ
FT                   QSNSWSSKNGSALHLATHFDLDILVKDLLSQGYDPNMRDINGVTPLALAVQRDLLDILI
FT                   TLTNAGASVNMPDNGGRSPLHWAIYHNLPDVVRFLLDHKDIDVNMPAARWSHYTPLMLA
FT                   SAYGFDDYVSMLLTKPKIDVNYASPEGATALILAARHGGTGAARLLLANQEIKINYADS
FT                   SGSTALTVAAENGYYDLVEALLDAGADTEVLQEGSNGTAIMRAIDDGRTSIVQLLVDRG
FT                   ANVHHKDVFDRGLLHSAAVNRRADILRILLKHDPTLDVNMQDVHGKTTLHDIARMGDLE
FT                   TVDVLLEAGGDPTIKDIHGRTPILVAHESHHPAILEMLRAARQRMKAEGQNYKLQRTPS
FT                   GTTVDSEDYGIKRADTGLSIHGTLPLWSLVVSKQFTELKERLPESSPEDINQVEPDMGQ
FT                   AALHWAVSDSDASIVKLLIDYGADINLRNRYGRTPLSLAVIDGLWDKARLLLEAGADPD
FT                   IEDQWGWPPLWMAGPRLGILLIENGAKLPPPPTFTGGGTDEGENIEKAAGKVDLENFLR
FT                   WAAQFGSETALRRLVQAGADVWSKDPSGKTPYMIAKEYGYDELANLLVQLAPMPQVGAD
FT                   GPRPKTDERAEKTATSGMPEDKSEDGTTKVKTDDIEKPKKEEDSVLPDKGMALDGLDST
FT                   TLVPASNVNKTKPGYSTLLLGSAHGRDGVGAIVMTIMHDGRRFD"
FT   gene            complement(168614..169941)
FT                   /locus_tag="ANIA_09002"
FT                   /old_locus_tag="AN9002.4"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family (AFU_orthologue;
FT                   AFUA_2G03620)"
FT   mRNA            complement(join(168614..168765,168856..169010,
FT                   169081..169590,169655..169774,169835..169941))
FT                   /locus_tag="ANIA_09002"
FT                   /old_locus_tag="AN9002.4"
FT                   /note="transcript_id=CADANIAT00007852"
FT   CDS_pept        complement(join(168728..168765,168856..169010,
FT                   169081..169590,169655..169774,169835..169902))
FT                   /locus_tag="ANIA_09002"
FT                   /old_locus_tag="AN9002.4"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family (AFU_orthologue;
FT                   AFUA_2G03620)"
FT                   /note="transcript_id=CADANIAT00007852"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007852"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007852"
FT                   /db_xref="GOA:Q5ARS8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS8"
FT                   /protein_id="CBF84482.1"
FT                   /translation="MSRMAKDNTFQAPESAQTQNTPGLESKMQPASEATKLETSDGIKD
FT                   YKGSGKLQGKKALITGGDSGIGRSVAALYAKEGADITIVYLPVEEEDAQETKRLVEAEG
FT                   RQCLLLSGDLRDRGFCKQAVDSHVQKYGHINILVNNASQQFSCPDLAQINLDTVTDVFQ
FT                   TNIIQMFAMTKFSLPHMSKGDSIINNTSVTAFRGTGSMVDYASTKGAIVGFTRSAALQL
FT                   IPKGIRVNAVAPGSTYTPIQVDTRDAEQMQGWASSKPLGRPGQPSEVATSFVFLASSDA
FT                   SLFYGQILHPYPLGE"
FT   gene            173980..175475
FT                   /locus_tag="ANIA_09001"
FT                   /old_locus_tag="AN9001.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(173980..174280,174339..174442,174502..175475)
FT                   /locus_tag="ANIA_09001"
FT                   /old_locus_tag="AN9001.4"
FT                   /note="transcript_id=CADANIAT00007853"
FT   CDS_pept        join(174071..174280,174339..174442,174502..175267)
FT                   /locus_tag="ANIA_09001"
FT                   /old_locus_tag="AN9001.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007853"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007853"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007853"
FT                   /db_xref="GOA:Q5ARS9"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARS9"
FT                   /protein_id="CBF84484.1"
FT                   /translation="MQLLKVLPAPLFAALVASAPLAAPQISVDYGQLEQFAQDVQSFAD
FT                   STYSQFSQVSAQFDVLTGSYSGSGRESFGQLLAKLSASVYDIQRVSADIASTIDATASA
FT                   YEDAESSAIGTFFSKRDQLRARDNAAVMAEAGLMKEAGLMGEAGLMNEAGLMNKVDDSI
FT                   APVSGLQTAKDAVADMAEVDGVDDADAMSPVPTAAPSTGSVTPEQATGSGAENVTPEQA
FT                   TGSGAEGLNPQQATGSGAEGVTLEQATGSGAENVTPGQATGSGAEGVNPQQATGSGAEG
FT                   VTLEQATGSAGVDQTLGSDGTGIDENISADATGVDQTLGTADQHVPVVPEDPTAGVTFV
FT                   ANIKTAHEGTVETEDSHRP"
FT   gene            176150..177858
FT                   /locus_tag="ANIA_09000"
FT                   /old_locus_tag="AN9000.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_3G14670)"
FT   mRNA            join(176150..176343,176469..176759,176795..177025,
FT                   177075..177858)
FT                   /locus_tag="ANIA_09000"
FT                   /old_locus_tag="AN9000.4"
FT                   /note="transcript_id=CADANIAT00007854"
FT   CDS_pept        join(176150..176343,176469..176759,176795..177025,
FT                   177075..177858)
FT                   /locus_tag="ANIA_09000"
FT                   /old_locus_tag="AN9000.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_3G14670)"
FT                   /note="transcript_id=CADANIAT00007854"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007854"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007854"
FT                   /db_xref="GOA:Q5ART0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART0"
FT                   /protein_id="CBF84486.1"
FT                   /translation="MAEVEGKTGVSQQKVQFEHDELYQAYAAKGEEWHRQMTRRLMRKV
FT                   DLHLLPLLVVMYLLNFLDRNNLSQARLGTLEEDLGMSGTDFNLATSILFVGYLLMQLPS
FT                   NLLLTRVRPSLFLGIAMGIWGVISACQAATQSFAGLVVARFFLGFVEAPFFPGAVMLIL
FT                   AHGQGADDRRSSWYTRQELSYRIAWFYAGSSLANAFGGLIGAGVLGNLHMSHGISGWRW
FT                   LFIIEGSITVALSLLIPILLPNYPATTSWLDDEEKAYAQWRLINDAGEADDTGASTIKE
FT                   ALIAVFADKRIYLFILLQHASLLSQTFQYFFPTIVQTLNYSNIVTLLITAPVWIATFLV
FT                   SLVVTWTSGKTNDRSIHIICLMAVSIIGCIICTATTNLGARFFGMFLMPMGAVSAYQII
FT                   IAWVANSFPRPLVKRSAAIATANMIGNTASIYGSYMWPSSSGPRYIPGGSATASVALLV
FT                   ALMAFVIRVVHVRMNKGLEEKENEVVEDEQLDAPRGFRYIL"
FT   gene            179522..179771
FT                   /locus_tag="ANIA_11639"
FT                   /old_locus_tag="AN11639.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(179522..179564,179665..179771)
FT                   /locus_tag="ANIA_11639"
FT                   /old_locus_tag="AN11639.4"
FT                   /note="transcript_id=CADANIAT00007855"
FT   CDS_pept        join(179522..179564,179665..179771)
FT                   /locus_tag="ANIA_11639"
FT                   /old_locus_tag="AN11639.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007855"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007855"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007855"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL02"
FT                   /protein_id="CBF84488.1"
FT                   /translation="MPEYHPFDRVGSEKDPFTFILSTFSLPYHSRDLIALCKEDLTCKK
FT                   LELL"
FT   gene            180933..184362
FT                   /locus_tag="ANIA_08999"
FT                   /old_locus_tag="AN8999.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(180933..181923,181980..182188,182230..182504,
FT                   182557..182570,182615..182701,182778..183056,
FT                   183119..183199,183400..183466,183528..183600,
FT                   183901..184362)
FT                   /locus_tag="ANIA_08999"
FT                   /old_locus_tag="AN8999.4"
FT                   /note="transcript_id=CADANIAT00007856"
FT   CDS_pept        join(180933..181923,181980..182188,182230..182504,
FT                   182557..182570,182615..182701,182778..183056,
FT                   183119..183199,183400..183466,183528..183600,
FT                   183901..184047)
FT                   /locus_tag="ANIA_08999"
FT                   /old_locus_tag="AN8999.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007856"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007856"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007856"
FT                   /db_xref="GOA:Q5ART1"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART1"
FT                   /protein_id="CBF84489.1"
FT                   /translation="MAKQIQPKPSALATLIPELQWLIFNCLSFDDKVLFTEIGLFHPDL
FT                   LTSHGQTNTYDQHGRTLLHVAAEKGCVRAAQHLLCGGATPSAKMGPGARDFNTTPLILA
FT                   AQQENKELVNLLLSHGADVNDWDYSGITALHYAVIRGDGRIVRILLDKGAKQTNNYDIG
FT                   CPVHVAAASGALEILRLLVAHGADVGASKRGLSALDIALLNGNIAAARILVDAGAPLND
FT                   PVEGWGLFNPTLMVAGGPHAADAAEIVLDHSIASIDSVARQREVEEWWKPRQKGEYAEL
FT                   LQAMLVAGADPNQTFRSATPLHLAVVAGNEHAVRVLLEAGADVHARTDRALQRKEERER
FT                   VGGSTCCASQAGAFQCIWPLIFASISGVQSRSSISSVLRQPGNLCCFTPSLFARFKAHG
FT                   ENACLLFVERSDETRASAQSRGPGCQDSSTHLPAPIPIPMRRGAGSWRARRNVLRFRPM
FT                   YQGCCSKDYSSGFTPEHCDTGRISDCNATAEYGQLCAPTSSDTEVSPRIFAAMAVKRTP
FT                   TALDVASQSAMSFKRRIGYYELFNYYKGCNVIEPESLIIEPFTHINLAFVNLGDDYTLI
FT                   DEYGNIADCVLFLKFSNPGLRVNIAVGGWVFSDAPTQHLWTQMARSHEKQQTFINSVVK
FT                   YPQDYPRGCRASAQWQEVMNRLWQQSEKPLSPENFPGRMNRNDDMRLEARNREIKRTPF
FT                   TYYSRHNHPACQTRIHQWKKEKKVDEREEGDKTTNYPAAKSQSPKH"
FT   gene            complement(185324..186388)
FT                   /locus_tag="ANIA_08998"
FT                   /old_locus_tag="AN8998.4"
FT                   /product="catechol dioxygenase, putative (AFU_orthologue;
FT                   AFUA_2G02910)"
FT   mRNA            complement(join(185324..185524,185615..186059,
FT                   186141..186388))
FT                   /locus_tag="ANIA_08998"
FT                   /old_locus_tag="AN8998.4"
FT                   /note="transcript_id=CADANIAT00007857"
FT   CDS_pept        complement(join(185324..185524,185615..186059,
FT                   186141..186388))
FT                   /locus_tag="ANIA_08998"
FT                   /old_locus_tag="AN8998.4"
FT                   /product="catechol dioxygenase, putative (AFU_orthologue;
FT                   AFUA_2G02910)"
FT                   /note="transcript_id=CADANIAT00007857"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007857"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007857"
FT                   /db_xref="GOA:Q5ART2"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART2"
FT                   /protein_id="CBF84491.1"
FT                   /translation="MTPHRFDPKFTDNVVNAMGKDVDPRFRQLMASLIRHVHDFARENE
FT                   LTVDEWMAGVQLMNWAGQMSTAKRNEGQMVCDVIGLESLVDEITFKLADEATDAPTATA
FT                   ILGPFFRADTPFRSNGESIVKTAPKEKDGKGEIAYMAGQVMDLVTKKPLVGAVVEVWQA
FT                   STNGLYEQQDPEQEEFNLRGKFRTDENGRYSFYCLRPTPYPAPDDGPAGMLLKLMDRHV
FT                   FRPAHIHIIATHDGYRPLTTQIFDRQDPYLTSDAVFAVKESLIVDFIERKGDPQAGLEL
FT                   NFDVKLVPDGMKSNGA"
FT   gene            complement(188192..189516)
FT                   /locus_tag="ANIA_08997"
FT                   /old_locus_tag="AN8997.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(188192..188338,188661..189040,
FT                   189465..189516))
FT                   /locus_tag="ANIA_08997"
FT                   /old_locus_tag="AN8997.4"
FT                   /note="transcript_id=CADANIAT00007858"
FT   CDS_pept        complement(join(188192..188338,188661..189040,
FT                   189465..189516))
FT                   /locus_tag="ANIA_08997"
FT                   /old_locus_tag="AN8997.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007858"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007858"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007858"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART3"
FT                   /protein_id="CBF84493.1"
FT                   /translation="MSTAEQAVWAHVAAVVLGSNAHETLMTKDLLGQTRWQEGRYTNAK
FT                   TLHQEAVDGLIRLKGIDNEDTLTATGNLGRTKAKFYENLDEAKSLLKRASHGMSKVLGT
FT                   THVKTLIVQEDLALLAAQMEEELCEPLETVQQVLDIRTKKLPGRLNESIQYCDEAIKGL
FT                   QKINATQHPLERELRAQKEEMVAMREQEG"
FT   gene            190605..192377
FT                   /locus_tag="ANIA_08996"
FT                   /old_locus_tag="AN8996.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(190605..190787,190832..190948,190998..191344,
FT                   191398..191951,192022..192377)
FT                   /locus_tag="ANIA_08996"
FT                   /old_locus_tag="AN8996.4"
FT                   /note="transcript_id=CADANIAT00007859"
FT   CDS_pept        join(190605..190787,190832..190948,190998..191344,
FT                   191398..191951,192022..192377)
FT                   /locus_tag="ANIA_08996"
FT                   /old_locus_tag="AN8996.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007859"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007859"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007859"
FT                   /db_xref="GOA:Q5ART4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART4"
FT                   /protein_id="CBF84495.1"
FT                   /translation="MATVESKSPIDDVEKAPSEASDEERRREFLSSFTPEDDKRIMNKV
FT                   NRRFLWLIGVIYVIKTIDYTNAAAVKVLQVGEERNVLSELKMTTNEYNWVQSIYFISYI
FT                   VFEVPSNLLQKRLTPRLWQSRIMLTWGIVLACHAAVQNKHALYALRFLLGLCEAGMFPG
FT                   IAAQLCGWYRSDEMATPIMWMFGFQNTSGIIGSLITYGISYMNGLQDLSAWRWVYLLEG
FT                   LFTIAFSGVIFLVLPDWPKSERTKKWLTEREQEYVETRLSENAPKESDASFDKGEVIAA
FT                   LKDQRTYSFMISQILINFAGYALSWQLPTITTSLGFAGLPRNQLLNIPPAAASVLAIIF
FT                   SGWFLKRAYMTRPAYIMSVIIGPMLLFFILLAVLDNKVGIYIACVFGTMFYAVYFIPFW
FT                   AWRSSSLKGMTGSAFTLAFQSCVGQVGGVIGPQLFQSRFAYNGYKTPFAICAAVVGVAW
FT                   LTNGWTWWLTRNVEYDVMRVRRLRIKEEKQGRIYAGEDVQVYKERQFYDGMGRKKEQLE
FT                   V"
FT   gene            192843..193974
FT                   /locus_tag="ANIA_08995"
FT                   /old_locus_tag="AN8995.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(192843..193012,193068..193974)
FT                   /locus_tag="ANIA_08995"
FT                   /old_locus_tag="AN8995.4"
FT                   /note="transcript_id=CADANIAT00007860"
FT   CDS_pept        join(192843..193012,193068..193974)
FT                   /locus_tag="ANIA_08995"
FT                   /old_locus_tag="AN8995.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007860"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007860"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007860"
FT                   /db_xref="GOA:Q5ART5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART5"
FT                   /protein_id="CBF84497.1"
FT                   /translation="MASTSTENGPEKASATATIALNEPPAPAPAPSHPAKEGGLRGWLQ
FT                   VLSTLFILFNIWGLAFAFGSFQSFYVLDFLPSTSTSAISWTGTIQSWLLIMGGLVSGPL
FT                   FDLGYYVHLISIGSFLSVFGIMMLSLATKYYQILLSQGICAGLGFGLLYIPSLTIVSRT
FT                   FVRKRALALGIATAGAPAGGVIYTLMFEQLLPRAGFAWTVRIIGFVMLGLFIAAGVMVS
FT                   FTADTAKPSQARRPAVGKRQLFDTAALKDLPFWSYTLANFFLYLGYMSPFYYIPIYAET
FT                   KLHTSRSMGLYILIISQASSIIGRVVTTAVAHYFGAMVPWIITGIASGVLCMAWISATT
FT                   LARFILFAAFYGILLPEP"
FT   gene            complement(194447..195387)
FT                   /locus_tag="ANIA_08994"
FT                   /old_locus_tag="AN8994.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(194447..194817,194886..195387))
FT                   /locus_tag="ANIA_08994"
FT                   /old_locus_tag="AN8994.4"
FT                   /note="transcript_id=CADANIAT00007861"
FT   CDS_pept        complement(join(194447..194817,194886..195387))
FT                   /locus_tag="ANIA_08994"
FT                   /old_locus_tag="AN8994.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007861"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007861"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007861"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART6"
FT                   /protein_id="CBF84499.1"
FT                   /translation="MHYDQPPAYTETTLTAASLVGPALDRPSSSHSSTASIPSVSISLS
FT                   NTTATETSPKGGDASSSFAMLSLGDSDKLRFIRFPDHLIVIASEVITRLWPKGIQKTQN
FT                   FDESVQFKLKGNPLGYSFDGEKAAIRVTIMGLLNAFAKEGWVVLPAGKVGKMGRGDSQS
FT                   YGQGDSLVFHRQHPESRSWLCVSFDSADLLHLLNAPAELTTLLLASFGDRIEKCNKDFV
FT                   SGNFELKFKGSPWTKTGAKGAVQCRLILLDLMQCFEEHGYTMCTALDIDGGLGGTEYKS
FT                   NGEAWFWYR"
FT   gene            196975..200572
FT                   /locus_tag="ANIA_08993"
FT                   /old_locus_tag="AN8993.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(196975..198404,198774..198781,199152..199217,
FT                   199300..199327,199393..200572)
FT                   /locus_tag="ANIA_08993"
FT                   /old_locus_tag="AN8993.4"
FT                   /note="transcript_id=CADANIAT00007862"
FT   CDS_pept        join(196975..198404,198774..198781,199152..199217,
FT                   199300..199327,199393..200572)
FT                   /locus_tag="ANIA_08993"
FT                   /old_locus_tag="AN8993.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007862"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007862"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007862"
FT                   /db_xref="GOA:Q5ART7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART7"
FT                   /protein_id="CBF84500.1"
FT                   /translation="MMQIDLADDQDERQRRLQEWDSDDDPGNPRNWSTLRKTLTTTVIG
FT                   LIGFATTVNASIYSSGHEQVKRDFNVSTTVSLLPLSAYSLGLAFGPMISSPLSETFGRK
FT                   FVYLLTLPMVDLFTLGVGASQGIASLIVCRFVAGVFAAPGVSVAAATITDYTPPSRRVI
FT                   PLGIYYAIPTIGSSMGPLIGSFVVEQRGWRWTAWTPLIMAAVVHPPAIFIRESYKPILL
FT                   QRRAEKLGGEGVLPVQRQTAMQLFKEFVTSTIVRPLHMLFTEPLVGFICLYCGFQFALL
FT                   YTFIVASPRVFADVYGFSPSGQGLSFLGMVAGCICAPLVLFTVDRIVQLNPTLRIRNNN
FT                   TEGGGSPPELKLYTAMFGSLILPTGLFLFAWTAKPHIHWMAPIVAQSLTFLGSMLIYIP
FT                   CNFYMLDVYGSKYGASASGASSLTRYTLSTAFPLFVPQMYDALGVDWATSLLGFLATVM
FT                   APIPWVFFYKGPGFRARSGINIYIIPRSLKLAKENVAKGQPFGPVHWGRISGLFAGHLR
FT                   TQGIRTSPGPSSARFGSVHSNHSYSYILSPICLPINKATLSEMTAPHRRKPIPQPHGRS
FT                   HSHPTAISHPHPHSPAPAYTRPAQPRAPQQMAYHPPQSLAHGTPAPARSRSHYLPHPRS
FT                   APAQARQLSHIQTTQRHHGQQLKQHTTQISQHANTMKSQAKLNQSAQKENAQIAKSMQK
FT                   QFAAQQKTFNKHANAQQRAFDKQSAAHQKHFEKQNAALAAQYERDRAAMDHEMEQIRHA
FT                   DAQRQYEYEQYMWYKSQAQVEQDRKDWDKTVAGVVAGAALGAAAGAAAGVAWEREQWEE
FT                   QRLQAEAERQEDSSELEPSDYEYESRNEGYQTQSLGYDNGNSGYNDSGYEQQQPYTSLD
FT                   FMTQNRDGNDGDDDCCDGCCGGNGNDDDDCCC"
FT   gene            201294..202452
FT                   /locus_tag="ANIA_08992"
FT                   /old_locus_tag="AN8992.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(201294..202154,202268..202388,202433..202452)
FT                   /locus_tag="ANIA_08992"
FT                   /old_locus_tag="AN8992.4"
FT                   /note="transcript_id=CADANIAT00007863"
FT   CDS_pept        join(201294..202154,202268..202388,202433..202452)
FT                   /locus_tag="ANIA_08992"
FT                   /old_locus_tag="AN8992.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007863"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007863"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007863"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART8"
FT                   /protein_id="CBF84502.1"
FT                   /translation="MSYPTVRPSRLTVFSRDGTLIIIVPLNHEAGAGEQGGPGQGSLPA
FT                   QPPAAGFRTSADQLKRVSPLMNRVLTTLEAQTMLRSPRGLDYVLPKYDPDLVRLFLTIL
FT                   HNPQHPITPLTDLLQIAKLTQIAAFFECPSLIASHVSAWLSSRDSEPPRTYCPTLMVFV
FT                   SISLHLHFDNMFAKYTSIAIAESPGQITSMGAPISGDVLEDLNQRRNCFIGAHFDVLHN
FT                   TLNVLLKGPPGCTVDCDSRMLDALMNQMKQHGLLRPKPAAPYSGLTHRQLASTIASFKC
FT                   PAGVDMKTVLTLPPSLQNAAFIWSLRVQQADYVPFCSWTCSLQRIAGQLEWV"
FT   gene            203563..204378
FT                   /locus_tag="ANIA_08991"
FT                   /old_locus_tag="AN8991.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(203563..203773,203858..203914,204148..204169,
FT                   204294..204378)
FT                   /locus_tag="ANIA_08991"
FT                   /old_locus_tag="AN8991.4"
FT                   /note="transcript_id=CADANIAT00007864"
FT   CDS_pept        join(203563..203773,203858..203914,204148..204169,
FT                   204294..204378)
FT                   /locus_tag="ANIA_08991"
FT                   /old_locus_tag="AN8991.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007864"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007864"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007864"
FT                   /db_xref="GOA:Q5ART9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ART9"
FT                   /protein_id="CBF84504.1"
FT                   /translation="MHMPPSQKEQPGWHRAPRLLNQGFQYLWEQRVDSSPGSNGVWSLT
FT                   LDKWTFSVYEYSSDAEQFCAKGDCAGRTGGSSARIAWGTRFWSADKGLEEGSGGAVRLE
FT                   ARTDVIVAEQNSLTWYRDWR"
FT   gene            complement(205021..207020)
FT                   /locus_tag="ANIA_08990"
FT                   /old_locus_tag="AN8990.4"
FT                   /product="GABA transporter, putative (Eurofung)"
FT   mRNA            complement(join(205021..205256,205305..205885,
FT                   205948..206147,206217..207020))
FT                   /locus_tag="ANIA_08990"
FT                   /old_locus_tag="AN8990.4"
FT                   /note="transcript_id=CADANIAT00007865"
FT   CDS_pept        complement(join(205021..205256,205305..205885,
FT                   205948..206147,206217..206828))
FT                   /locus_tag="ANIA_08990"
FT                   /old_locus_tag="AN8990.4"
FT                   /product="GABA transporter, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007865"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007865"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007865"
FT                   /db_xref="GOA:Q5ARU0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU0"
FT                   /protein_id="CBF84506.1"
FT                   /translation="MSTPKDTPWAPATLNESAIETGSDKDGANAALEHLGYTPELSRNR
FT                   STWNVVFMSFILASVPYGLSTTYTYALAGGGPTNIIWGWVLVSLIILCVAASLAEITSV
FT                   FPTAGGVYYQTFVLSPIWCRRISSWVCGWAYVTGQIMITLAVNFGSAQFFIACLNVFED
FT                   ENGVGLTDSWEAWHTYVIFLAITLVSHAIPAFGNRWLPWLESFAIFWTLAGVVAIDICL
FT                   LVIAKNGRRSAKWVFGHFEPQTGWPDGWSFCIGLLQAAYATSSTGMIITMCEEVRQPAL
FT                   QVPKAMVGTIVINLIAGLIFLVPVCFVMPDLAELAALASGQPVPSIFKSAIGNSVGTFL
FT                   LLLPLIILGLICGIGCVTATSRCTWAFARDGAIPGSRWWRTVNKKLDVPLNSMMLGMVI
FT                   ELLIGLIYFGSSAAYNAFSGVGVILLTLSYACPIAVSLLLRRREDIKHGSFDLGALGLF
FT                   CNIVALAWTVLVIPLFNFPSYMSVTLETMNYACVVFVGIIVISAVWYWIWGYKNYAGPP
FT                   TDAIDPEADHPAGSSPVQVAKDIQR"
FT   gene            complement(208084..208649)
FT                   /locus_tag="ANIA_08989"
FT                   /old_locus_tag="AN8989.4"
FT                   /product="glyoxalase family protein (AFU_orthologue;
FT                   AFUA_5G14830)"
FT   mRNA            complement(join(208084..208110,208214..208356,
FT                   208448..208649))
FT                   /locus_tag="ANIA_08989"
FT                   /old_locus_tag="AN8989.4"
FT                   /note="transcript_id=CADANIAT00007866"
FT   CDS_pept        complement(join(208084..208110,208214..208356,
FT                   208448..208649))
FT                   /locus_tag="ANIA_08989"
FT                   /old_locus_tag="AN8989.4"
FT                   /product="glyoxalase family protein (AFU_orthologue;
FT                   AFUA_5G14830)"
FT                   /note="transcript_id=CADANIAT00007866"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007866"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007866"
FT                   /db_xref="GOA:Q5ARU1"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU1"
FT                   /protein_id="CBF84508.1"
FT                   /translation="MELDPTAPLPSSKIDHIGITAPTEQLESLIEFYLKALALAPLQRD
FT                   HAVSWGCWARRQGPGFLDLRDEDRKTVDAFHEAALAAGGKCNGKPGLRTEYHPNYYAAF
FT                   IIDPRGNNVEIVCHLPVEE"
FT   gene            complement(209040..210298)
FT                   /locus_tag="ANIA_08988"
FT                   /old_locus_tag="AN8988.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(209040..209128,209210..210022,
FT                   210076..210298))
FT                   /locus_tag="ANIA_08988"
FT                   /old_locus_tag="AN8988.4"
FT                   /note="transcript_id=CADANIAT00007867"
FT   CDS_pept        complement(join(209040..209128,209210..210022,
FT                   210076..210298))
FT                   /locus_tag="ANIA_08988"
FT                   /old_locus_tag="AN8988.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007867"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007867"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU2"
FT                   /protein_id="CBF84510.1"
FT                   /translation="MPKLFITGITGYIGGDAFHLLSQKHRDFEFSALVRTEAKAKYVRE
FT                   LYPNVRIVIGGLDDADKIEKEAAWADIVLHTADSSDHVGAANAIARGLVQGHSLDRPGY
FT                   WLHTGGTGILTYFDSDVHKVHGEHNDKVFNDYEGVSELTNLPAAAFHRNVDEIVLRTGV
FT                   EHADRVKTVIVCPPTIYGRGRGPVALRGRQAYELTSFVLKEKYVPIIGKGLARWNNVHI
FT                   YDLSRLFDLLVRAALDPARKDDKEIWGEKGYFLCENGEHVWGELSKLVGEQAHKLGYLK
FT                   DAPVVKEMSVDEAISSPAGFEAASWGWNSRGQAQRGREVLGWSPEEKSIEEEIPDILAA
FT                   EASRLDGQFSLTIMFPPTGETRLLIAVESSFADE"
FT   gene            complement(210491..212244)
FT                   /locus_tag="ANIA_08987"
FT                   /old_locus_tag="AN8987.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(210491..210617,210693..210780,
FT                   210882..211314,211855..212244))
FT                   /locus_tag="ANIA_08987"
FT                   /old_locus_tag="AN8987.4"
FT                   /note="transcript_id=CADANIAT00007868"
FT   CDS_pept        complement(join(210491..210617,210693..210780,
FT                   210882..211314,211855..212244))
FT                   /locus_tag="ANIA_08987"
FT                   /old_locus_tag="AN8987.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007868"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007868"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007868"
FT                   /db_xref="GOA:Q5ARU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU3"
FT                   /protein_id="CBF84512.1"
FT                   /translation="MVLAQRLLGVLLVDIGLLQLVVVVSRNRAGVYLTQYTPRVRRKLN
FT                   RNSTEMCINLRGYSRLSMGVVELTIRLRGSWRLSMWAGQHRDVDGHSLSPLTDVAVNQR
FT                   AIFQNGLRKQRSMRYCSLVLLLEGQAVIDIRSQWGGLAVKIGPEWARLQNCRPGENPVT
FT                   LSGEDHRIVMGWRYRAASGLIRRPSPAWLDSSPVSNSQQQSPGKPQQDHALMAEMMMKK
FT                   KQRVVIAKLSTRSLREEETCAAGGSRSPAPFPPVILWSATFSSLTAALCLNWPSRLAWT
FT                   SHQPQGQISGDNPEHQNDKTFEHVDDTPVDHHEERKSGSNERYVHLFLHVNTMLLPWIT
FT                   VAHQP"
FT   gene            215468..216779
FT                   /locus_tag="ANIA_08986"
FT                   /old_locus_tag="AN8986.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(215468..215878,215937..216779)
FT                   /locus_tag="ANIA_08986"
FT                   /old_locus_tag="AN8986.4"
FT                   /note="transcript_id=CADANIAT00007869"
FT   CDS_pept        join(215468..215878,215937..216779)
FT                   /locus_tag="ANIA_08986"
FT                   /old_locus_tag="AN8986.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007869"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007869"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007869"
FT                   /db_xref="GOA:Q5ARU4"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039367"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU4"
FT                   /protein_id="CBF84514.1"
FT                   /translation="MRRASRQSFLPLLARRRLSFLLILLFLLFLLHALPPVFSQRRNRR
FT                   VVGGKWLPDYDVNELPRYLHRSPYREKPDIEFEQRVREALKGIEEDALAAAGIGDDRLA
FT                   EQRIWQIRLGGGNDEHVEDSLAFTKRNSEWEYTLMTDHQANEFIATVLASIPDLKALYD
FT                   SYPYHVMRSDLLRYLVLWYYGGYYADMDVYPAKAIKECPALQPVFGDSGSANISLAVGI
FT                   EIDEPHASLQLMRDWHWIRTYGLIQYTFFAPRRFSPLLREVIIRVLSHTRQRNQQSFPF
FT                   VGPRYDEKAILEVTGPGVFTDAILDALSDALPTTHPLLAASVRADEGIGDLFSQASGQL
FT                   SRRVTWAPFHRISEPLCVDAQEAAVGKSMGGICVLPVNAWGNGQRHSGAGGFSSPLACV
FT                   NHRFGGSWKKDWWYRHFG"
FT   gene            217281..218962
FT                   /locus_tag="ANIA_08985"
FT                   /old_locus_tag="AN8985.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(217281..218362,218406..218464,218511..218962)
FT                   /locus_tag="ANIA_08985"
FT                   /old_locus_tag="AN8985.4"
FT                   /note="transcript_id=CADANIAT00007870"
FT   CDS_pept        join(217281..218362,218406..218464,218511..218962)
FT                   /locus_tag="ANIA_08985"
FT                   /old_locus_tag="AN8985.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007870"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007870"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007870"
FT                   /db_xref="GOA:Q5ARU5"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU5"
FT                   /protein_id="CBF84515.1"
FT                   /translation="MAEYTSDADVELAYTTLQTTFKSGKTKEIAWRKWQLKQIWWLVDD
FT                   NEALIQEALKKDMNRHPFETTFTECANVKGDVIEHLKNIDKWTADQKPSAGMLGLMLRP
FT                   TVRPEPLGVALIIGPWNFPFSLLVQPLIAAITAGCAALLKPSEVTSSVQQLFVDLVPKY
FT                   LDTSAVRVVTGGPAETGCLLQRKFDHIFFTGSVPVARHIAAAAAKHLTPTVLELGGQCP
FT                   AIVTSSADVDAAAKDIAWIKYLNAGQICLSVNHVFAHPSVERKLIERMAFWLDRFYKGE
FT                   KDAMTHIVNDKNYARIKQLAEKTKGKIELDGTADAETRSLPVSIVSNVEMSDPLLSEEL
FT                   FGTVCPVIKGSTDDAIKSINSLPRPLALYIFSQDQNEVEHIISSTLSGGVCVNGVLVHA
FT                   MVPNAPFGGVGDSGHGAYHGEYGFKSFTHYRTIARPAPFFFKMSEWMRPPYSVDNIKKL
FT                   AVRNSVGIQRNWSLEQEREAIKRGLLLTKSLKSARFLVYLVVLLGLADVGLDRRLGVLK
FT                   SVRDLLVEVRSLF"
FT   gene            220614..222093
FT                   /locus_tag="ANIA_08984"
FT                   /old_locus_tag="AN8984.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(220614..220760,220810..221191,221287..221404,
FT                   221590..221620,221693..221703,221733..222093)
FT                   /locus_tag="ANIA_08984"
FT                   /old_locus_tag="AN8984.4"
FT                   /note="transcript_id=CADANIAT00007871"
FT   CDS_pept        join(220614..220760,220810..221191,221287..221404,
FT                   221590..221620,221693..221703,221733..222093)
FT                   /locus_tag="ANIA_08984"
FT                   /old_locus_tag="AN8984.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007871"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007871"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007871"
FT                   /db_xref="GOA:Q5ARU6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU6"
FT                   /protein_id="CBF84517.1"
FT                   /translation="MAGDERVSITAVSWTLGTLSILLVALRLYTRLLITRCRGWDDLFV
FT                   TIALVNAIICSALTQIAVSHGLGKHEADIPNPNDRISAAKYATIAPSFSVISTVTGKIS
FT                   VVIFLLRLLTLSAKPWHRWFLHSLTLASIAWNILGIVAIIGYCRPTRKIWLPETEGSCM
FT                   SSRFQLVAGISQSAFNAFADWALALFPAILFRKVQLPLLKKVVVIAVLGSGVLDMARHH
FT                   EMVYVELRQQPKIWNEQMYLIIICASVPTMPQSLNALLHLCKTYHKYNSSSSRCNLSRP
FT                   SIREPGVLLKRMQDSSLFDAPAEHAGSQENILACNEGELNTNIGCMIDLTVAQDSDIGD
FT                   IVLVQGGTN"
FT   gene            complement(222412..224668)
FT                   /locus_tag="ANIA_08983"
FT                   /old_locus_tag="AN8983.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_2G02040)"
FT   mRNA            complement(join(222412..222447,222627..222842,
FT                   222910..223168,223227..223372,223425..223946,
FT                   224023..224385,224456..224547,224617..224668))
FT                   /locus_tag="ANIA_08983"
FT                   /old_locus_tag="AN8983.4"
FT                   /note="transcript_id=CADANIAT00007872"
FT   CDS_pept        complement(join(222412..222447,222627..222842,
FT                   222910..223168,223227..223372,223425..223946,
FT                   224023..224385,224456..224547,224617..224668))
FT                   /locus_tag="ANIA_08983"
FT                   /old_locus_tag="AN8983.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_2G02040)"
FT                   /note="transcript_id=CADANIAT00007872"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007872"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007872"
FT                   /db_xref="GOA:Q5ARU7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU7"
FT                   /protein_id="CBF84519.1"
FT                   /translation="MDDISQSEVPGTIFIVGTDATKLGEADVTTSNDIVLVPRPLETPR
FT                   DPLNWPKSKKLWTLFLATLFATVVAYGENNLGAPWTEVAEDIDVTMKDMNGGSALNYLL
FT                   LGFVNVLWIPTAMKLGRKVVYIFSMTIIMVSSVWNAYIYGVAQWYLNCLVGGIGQSAYQ
FT                   ALIQLTVFDIFFAHQRGTMLAVYVWGQQLGSILALILGGYIAEGPGWRWSCKIVAILSV
FT                   RLISVILRAAVADALQGSVVLLFIFTMDDSLFPRHALAIHQTTTVPQTQDSHQPEAEND
FT                   TKKEQSVNLNRQPTISQGRADLLPRNYLHVLAPIHRWKEDKTTWWQYFRRPFHLFAFPN
FT                   IIMAGLIYAFANTAGIVSFNTISEIMTGAPYNWSTGPTGLMFLAALVGSFIGMATGALG
FT                   DILTLRLARANGGYKEPEMRLWTLSLSFVYGAVGYFMYGWSASDGKSWVLIAVGLGGMI
FT                   AQQVSAASVATAYAMECFEGISSELVVVLAICSSCVNFAISYSVQPFIEATDYGRTFTC
FT                   FGALVLCSLAMAGAGVKWGKSWRRRCASRYWKFLDHLDYALNTA"
FT   gene            225290..226718
FT                   /locus_tag="ANIA_08982"
FT                   /old_locus_tag="AN8982.4"
FT                   /product="hypothetical fructosyl amine:oxygen
FT                   oxidoreductase (Eurofung)"
FT   mRNA            join(225290..225464,225521..226149,226206..226718)
FT                   /locus_tag="ANIA_08982"
FT                   /old_locus_tag="AN8982.4"
FT                   /note="transcript_id=CADANIAT00007873"
FT   CDS_pept        join(225290..225464,225521..226149,226206..226718)
FT                   /locus_tag="ANIA_08982"
FT                   /old_locus_tag="AN8982.4"
FT                   /product="hypothetical fructosyl amine:oxygen
FT                   oxidoreductase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007873"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007873"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007873"
FT                   /db_xref="GOA:Q5ARU8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARU8"
FT                   /protein_id="CBF84521.1"
FT                   /translation="MSQLTKDSSILIIGGGTWGCSTALQLARAGYKNVTVLERSPIPSP
FT                   SAAGNDVNKIMEEGAPSDTDTPEQYVWNRMHQITANAWKTDPVFRPFYHPTGFIMAASQ
FT                   DDAMPHVDKYISTCRDKLRLLNSAADFRATMPLGVLTGDFSGWKGFFREAGAGWVFARG
FT                   ALEAAYKEASRLGVKFVTGDEGGVKSLLYTDDQSDIVGAKTADEKEHRADRVILCAGAG
FT                   SDQLLDFEKQLRPTAWTLAHIQMTEEERKLWKDLPVLFNVNSGFFIEPDSTGQLKFVDE
FT                   HPGYCNIPTSEVLNDFPKSIPFAKHQIPLQSEHAARQFLRDTVPQIADRPFAFARICWD
FT                   ADTPDRQFLIDQHPKYKSLTVAVGGSGNGFMMMPAVGIAIKQRLEGVLEEKLKYAFRWR
FT                   PETAVHRDWRDTQDRFGGTGTVRNFQDVEVWTRVGEEII"
FT   gene            complement(227577..228763)
FT                   /locus_tag="ANIA_08981"
FT                   /old_locus_tag="AN8981.4"
FT                   /product="AlcS [Source:UniProtKB/TrEMBL;Acc:Q460G9]"
FT   mRNA            complement(join(227577..227714,227788..227963,
FT                   228031..228099,228154..228207,228279..228379,
FT                   228448..228537,228603..228763))
FT                   /locus_tag="ANIA_08981"
FT                   /old_locus_tag="AN8981.4"
FT                   /note="transcript_id=CADANIAT00007874"
FT   CDS_pept        complement(join(227577..227714,227788..227963,
FT                   228031..228099,228154..228207,228279..228379,
FT                   228448..228537,228603..228763))
FT                   /locus_tag="ANIA_08981"
FT                   /old_locus_tag="AN8981.4"
FT                   /product="AlcS [Source:UniProtKB/TrEMBL;Acc:Q460G9]"
FT                   /note="transcript_id=CADANIAT00007874"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007874"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007874"
FT                   /db_xref="GOA:Q460G9"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="InterPro:IPR030186"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q460G9"
FT                   /protein_id="CBF84523.1"
FT                   /translation="MTTEISNGEAKGHHLSTIPSSITLSAEQFEKLYLSPMMRQQPSLA
FT                   RKVGNPTPLALGGFVITTTPLSCCLMAWRGSSGNGIAFIGPIIFLGGLLLLITSILEFI
FT                   LGNTFPCVVFGTIGGFWFAFAATMIPSFNAAAPYSSSATSTTAGLTSASFMNTYAFLFI
FT                   TMAVLMLIFLLCATRTNVVYTLIFLSLLLVFLLLSAGYWRLGEGDAAVGDRCIKGAGAS
FT                   LFVASLLGFYLLIAQLFDAVGLPITLPVGDMERFWPRSQK"
FT   gene            229515..230204
FT                   /locus_tag="ANIA_08980"
FT                   /old_locus_tag="AN8980.4"
FT                   /product="AlcMPredicted protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5ARV0]"
FT   mRNA            229515..230204
FT                   /locus_tag="ANIA_08980"
FT                   /old_locus_tag="AN8980.4"
FT                   /note="transcript_id=CADANIAT00007875"
FT   CDS_pept        229515..230204
FT                   /locus_tag="ANIA_08980"
FT                   /old_locus_tag="AN8980.4"
FT                   /product="AlcMPredicted protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5ARV0]"
FT                   /note="transcript_id=CADANIAT00007875"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007875"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007875"
FT                   /db_xref="GOA:Q5ARV0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV0"
FT                   /protein_id="CBF84524.1"
FT                   /translation="MDDPLLRAWTTQYTNSPITTPRSATPGECRLRPPRDERVEKPRHP
FT                   KNPPTPPSMSMPYAVSSVPQGNMCNVDRGNGALEYINPSLLLFPQDYASQESNNYASAR
FT                   RVSDRRIGQSPYTRPNTPNVEGVSNVSSSDQRSSLSGRNGREEQSNPPVDIFEGILAKM
FT                   LAFDVVRPPSTNELGNDEPPREVEAKQPTVHHGFAISVGWSSTFFPDDIQEGSGHSRNT
FT                   VDTVGHF"
FT   gene            230913..232270
FT                   /locus_tag="ANIA_08979"
FT                   /old_locus_tag="AN8979.4"
FT                   /product="Alcohol dehydrogenase 1 (EC 1.1.1.1)(Alcohol
FT                   dehydrogenase I)(ADH I)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P08843]"
FT   mRNA            join(230913..231621,231670..232024,232092..232270)
FT                   /locus_tag="ANIA_08979"
FT                   /old_locus_tag="AN8979.4"
FT                   /note="transcript_id=CADANIAT00007876"
FT   CDS_pept        join(230971..231621,231670..232024,232092..232138)
FT                   /locus_tag="ANIA_08979"
FT                   /old_locus_tag="AN8979.4"
FT                   /product="Alcohol dehydrogenase 1 (EC 1.1.1.1)(Alcohol
FT                   dehydrogenase I)(ADH I)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P08843]"
FT                   /note="transcript_id=CADANIAT00007876"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007876"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007876"
FT                   /db_xref="GOA:P08843"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08843"
FT                   /protein_id="CBF84526.1"
FT                   /translation="MSIPTMQWAQVAEKVGGPLVYKQIPVPKPGPDQILVKIRYSGVCH
FT                   TDLHAMMGHWPIPVKMPLVGGHEGAGIVVAKGELVHEFEIGDQAGIKWLNGSCGECEFC
FT                   RQSDDPLCARAQLSGYTVDGTFQQYALGKASHASKIPAGVPLDAAAPVLCAGITVYKGL
FT                   KEAGVRPGQTVAIVGAGGGLGSLAQQYAKAMGIRVVAVDGGDEKRAMCESLGTETYVDF
FT                   TKSKDLVADVKAATPDGLGAHAVILLAVSEKPFQQATEYVRSRGTIVAIGLPPDAYLKA
FT                   PVINTVVRMITIKGSYVGNRQDGVEALDFFARGLIKAPFKTAPLKDLPKIYELMEQGRI
FT                   AGRYVLEMPE"
FT   gene            234657..237182
FT                   /locus_tag="ANIA_08978"
FT                   /old_locus_tag="AN8978.4"
FT                   /product="Regulatory protein alcR
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P21228]"
FT   mRNA            join(234657..234731,234792..237182)
FT                   /locus_tag="ANIA_08978"
FT                   /old_locus_tag="AN8978.4"
FT                   /note="transcript_id=CADANIAT00007877"
FT   CDS_pept        join(234657..234731,234792..237182)
FT                   /locus_tag="ANIA_08978"
FT                   /old_locus_tag="AN8978.4"
FT                   /product="Regulatory protein alcR
FT                   [Source:UniProtKB/Swiss-Prot;Acc:P21228]"
FT                   /note="transcript_id=CADANIAT00007877"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007877"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007877"
FT                   /db_xref="GOA:P21228"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="PDB:1F4S"
FT                   /db_xref="PDB:1F5E"
FT                   /db_xref="PDB:2ALC"
FT                   /db_xref="PDB:3ALC"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21228"
FT                   /protein_id="CBF84528.1"
FT                   /translation="MADTRRRQNHSCDPCRKGKRRCDAPENRNEANENGWVSCSNCKRW
FT                   NKDCTFNWLSSQRSKAKGAAPRARTKKARTATTTSEPSTSAATIPTPESDNHDAPPVIN
FT                   SHDALPSWTQGLLSHPGDLFDFSHSAIPANAEDAANVQSDAPFPWDLAIPGDFSMGQQL
FT                   EKPLSPLSFQAVLLPPHSPNTDDLIRELEEQTTDPDSVTDTNSVQQVAQDGSLWSDRQS
FT                   PLLPENSLCMASDSTARRYARSTMTKNLMRIYHDSMENALSCWLTEHNCPYSDQISYLP
FT                   PKQRAEWGPNWSNRMCIRVCRLDRVSTSLRGRALSAEEDKAAARALHLAIVAFASQWTQ
FT                   HAQRGAGLNVPADIAADERSIRRNAWNEARHALQHTTGIPSFRVIFANIIFSLTQSVLD
FT                   DDEQHGMGARLDKLLENDGAPVFLETANRQLYTFRHKFARMQRRGKAFNRLPGGSVAST
FT                   FAGIFETPTPSSESPQLDPVVASEEHRSTLSLMFWLGIMFDTLSAAMYQRPLVVSDEDS
FT                   QISSASPPRRGAETPINLDCWEPPRQVPSNQEKSDVWGDLFLRTSDSLPDHESHTQISQ
FT                   PAARWPCTYEQAAAALSSATPVKVLLYRRVTQLQTLLYRGASPARLEAAIQRTLYVYNH
FT                   WTAKYQPFMQDCVANHELLPSRIQSWYVILDGHWHLAAMLLADVLESIDRDSYSDINHI
FT                   DLVTKLRLDNALAVSALARSSLRGQELDPGKASPMYRHFHDSLTEVAFLVEPWTVVLIH
FT                   SFAKAAYILLDCLDLDGQGNALAGYLQLRQNCNYCIRALQFLGRKSDMAALVAKDLERG
FT                   LNGKVDSFL"
FT   gene            237568..238051
FT                   /locus_tag="ANIA_11638"
FT                   /old_locus_tag="AN11638.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(237568..237618,237766..237773,238048..238051)
FT                   /locus_tag="ANIA_11638"
FT                   /old_locus_tag="AN11638.4"
FT                   /note="transcript_id=CADANIAT00007878"
FT   CDS_pept        join(237568..237618,237766..237773,238048..238051)
FT                   /locus_tag="ANIA_11638"
FT                   /old_locus_tag="AN11638.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007878"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007878"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007878"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL75"
FT                   /protein_id="CBF84529.1"
FT                   /translation="MYILQNTVEGAQGTWPSLLR"
FT   gene            238444..239561
FT                   /locus_tag="ANIA_08977"
FT                   /old_locus_tag="AN8977.4"
FT                   /product="AkePPutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5ARV3]"
FT   mRNA            join(238444..239195,239252..239561)
FT                   /locus_tag="ANIA_08977"
FT                   /old_locus_tag="AN8977.4"
FT                   /note="transcript_id=CADANIAT00007879"
FT   CDS_pept        join(238444..239195,239252..239561)
FT                   /locus_tag="ANIA_08977"
FT                   /old_locus_tag="AN8977.4"
FT                   /product="AkePPutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5ARV3]"
FT                   /note="transcript_id=CADANIAT00007879"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007879"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007879"
FT                   /db_xref="GOA:Q5ARV3"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV3"
FT                   /protein_id="CBF84531.1"
FT                   /translation="MLFKNASFLFPLVLPLGALASSGPGNGTSGFMTFQPGFKAILGEH
FT                   PKLELLHENRTYPFAHEAPVYIPDTGDLFIVGNYQTPTGGQAIQISRMVPQKNGSYVRE
FT                   IIHPDIPMANGAINYNGGILFCDQGTKERPSSLIFMNATAPYETKVLLDSFYGRHFNSL
FT                   NDLDVHSDGSIWFTDPTYGYDQGFSMKPDLPNQVYRFNPKTGDVRVVADQIGQPNGIAF
FT                   SPDESIVYVTDTDAVWGNGDNDSTRPATIYAFDVKYYSGSPFLMNRRVFAYTDNGIPDG
FT                   VKTDTEGNVYAGCGDGVHVWSPAGVLLGKIQLPGTSANLAFAKPGEMFALNEYRLWKVT
FT                   LSQNVQGTILNEL"
FT   gene            240294..240999
FT                   /locus_tag="ANIA_08976"
FT                   /old_locus_tag="AN8976.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(240294..240409,240458..240503,240535..240563,
FT                   240600..240712,240764..240999)
FT                   /locus_tag="ANIA_08976"
FT                   /old_locus_tag="AN8976.4"
FT                   /note="transcript_id=CADANIAT00007880"
FT   CDS_pept        join(240294..240409,240458..240503,240535..240563,
FT                   240600..240712,240764..240999)
FT                   /locus_tag="ANIA_08976"
FT                   /old_locus_tag="AN8976.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007880"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007880"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007880"
FT                   /db_xref="GOA:Q5ARV4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV4"
FT                   /protein_id="CBF84533.1"
FT                   /translation="MTYNSGQETPATHTAPRCVREPASVPVQLVEGAWGLVVRPDLPMP
FT                   DAVIFYIHSNLLLSCLLSGAFILNIWGLILVWATLRSWESYGFTEESGDRKTHDSGLVS
FT                   RQPQFIIQYPQGSLKFVSDEPNMHVAIMTFKCLTFKEYASPTELLPVRRTYRPIVESPE
FT                   AGQIPQYQQPRPQNLG"
FT   gap             241085..241184
FT                   /estimated_length=unknown
FT   misc_feature    241185..282429
FT                   /note="contig 1.167 728..41972(-1)"
FT   gene            242428..243379
FT                   /locus_tag="ANIA_08975"
FT                   /old_locus_tag="AN8975.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            242428..243379
FT                   /locus_tag="ANIA_08975"
FT                   /old_locus_tag="AN8975.4"
FT                   /note="transcript_id=CADANIAT00007881"
FT   CDS_pept        242435..243289
FT                   /locus_tag="ANIA_08975"
FT                   /old_locus_tag="AN8975.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007881"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007881"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007881"
FT                   /db_xref="GOA:Q5ARV5"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV5"
FT                   /protein_id="CBF84535.1"
FT                   /translation="MDQTYNPTPSAPVIRLMVLETDKPHPDTHSERGTFGKIVHEHFAT
FT                   AGRAHKPPVGVETDQVFVVSEQGGRIPSLEEFDSFDGLLITGSLYDAHGDDEWILQLLE
FT                   LLKTLWIKRADFRFLGVCFGHQLLARLLGGSIGPAPSQDWELGHCRIALTPVGQRLFRT
FT                   RGDDNHVYLHQMHQDQVKIAPTAASAGPDMLPQDTEIAVWGHTDHTPVQGLYIPNRLFT
FT                   TQAHLAFDEDMVKRQIQIRVEKGAISDLEHADRAAETADLEHDGVEVAKAILRLFMDDE
FT                   EGQ"
FT   gene            complement(244782..246075)
FT                   /locus_tag="ANIA_08974"
FT                   /old_locus_tag="AN8974.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(244782..245118,245171..245297,
FT                   245715..245926,246011..246075))
FT                   /locus_tag="ANIA_08974"
FT                   /old_locus_tag="AN8974.4"
FT                   /note="transcript_id=CADANIAT00007882"
FT   CDS_pept        complement(join(244848..245118,245171..245297,
FT                   245715..245926,246011..246075))
FT                   /locus_tag="ANIA_08974"
FT                   /old_locus_tag="AN8974.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007882"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007882"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007882"
FT                   /db_xref="GOA:Q5ARV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV6"
FT                   /protein_id="CBF84537.1"
FT                   /translation="MSNRNPVTSTESPGSLSADKRFFDEANAAFQNDGGWYNTFVPDTA
FT                   MITRAEQGSRYQGPNLEEDEGDLAAEADAAMDANPAFGSYLDEQVEGVSDRAPSTAHLE
FT                   ILDNRSRPDSKTLAMSTNNPPEEAKEGSYGFPAWDTFESQKDGYALDRRAHLDEVERGP
FT                   AVRHKNVGERDYNRASAEGQPDTQFNKSARFSPPSLKNGEGLEETWTDADLEEFRRAAG
FT                   KR"
FT   gene            complement(246676..248673)
FT                   /locus_tag="ANIA_08973"
FT                   /old_locus_tag="AN8973.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(246676..248389,248438..248673))
FT                   /locus_tag="ANIA_08973"
FT                   /old_locus_tag="AN8973.4"
FT                   /note="transcript_id=CADANIAT00007883"
FT   CDS_pept        complement(join(246676..248389,248438..248673))
FT                   /locus_tag="ANIA_08973"
FT                   /old_locus_tag="AN8973.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007883"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007883"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007883"
FT                   /db_xref="GOA:Q5ARV7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV7"
FT                   /protein_id="CBF84539.1"
FT                   /translation="MAKQAKLHRSDQRPESYTSLNSSSATVKPQLYVFSSVIVRAWNAT
FT                   HKTSIGMTIKAPASARSPVGYGPLKSRRGCKTCKARRVKCGEEKPFCLRCTSTGRHCEY
FT                   AGTTYGTFSSASSATTSAIETTLARSPSPTSTRAWRERRAFAYYSQHAAPILGGLDVEF
FT                   WSTIVPRICHSEPAVWDAIISISSLFESYKPSNPVHKYRDALGWYSRSVSAVRQQIERG
FT                   GADVFVGLISCVLFICIEALQGGTQEALRLYSQGTHLALALREQIASGVVPATKGSLLE
FT                   ETIVPIFARLSVLANSESKAAVNVLLRGTDRLLMPGFIFPSLKAAREAIFVLMAETQLF
FT                   QEACEKHHDTTNEYNVPDHMISQQMAILSRLRTWHGAFTALTTSLRHRETPLSPQQTKT
FT                   IALLYTHHEMLYIITSTCVSRFKTTTDTCLPNFQTIVEQSRIALDASNRPDGTQPPFTF
FT                   DIGVGFPLWFAVLRCAEPLTRREAITLLKRAPQVQGFYARTFGVNFAQAVVDVEEAFAK
FT                   SMAVSIEMDIGMAAVAATTAPKTLSQSPSVICLGSPCNSGRVSINSTSRSVSSSSSPPP
FT                   TPANLKIPEEARIKPYGIFLPRNGIPPGTNEEDVAKWNLSPNQPFLQYSRNLIDPVTGV
FT                   WRVVHEVIPITIDT"
FT   gene            250130..253165
FT                   /locus_tag="ANIA_08972"
FT                   /old_locus_tag="AN8972.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(250130..250699,250915..251006,251368..251834,
FT                   251901..252262,252311..252460,252509..252813,
FT                   252880..253165)
FT                   /locus_tag="ANIA_08972"
FT                   /old_locus_tag="AN8972.4"
FT                   /note="transcript_id=CADANIAT00007884"
FT   CDS_pept        join(250130..250699,250915..251006,251368..251834,
FT                   251901..252262,252311..252460,252509..252813,
FT                   252880..253165)
FT                   /locus_tag="ANIA_08972"
FT                   /old_locus_tag="AN8972.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007884"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007884"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007884"
FT                   /db_xref="GOA:Q5ARV8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV8"
FT                   /protein_id="CBF84541.1"
FT                   /translation="MQSPEPQPCHLPSVTIKPAPSTSPAPIQFGEFPAHSDARTGLSKM
FT                   HDGGTYSNRPEPLAPTLGLGVDSQIQAATLCSVSSTFLCLSPGRSCSHSQILKTTVSAV
FT                   GQLGKLDDSCGMYLSREDGRMVAGVWHKESPSPFPNMAQSVLARSQPRRTWPAATVLTG
FT                   LKESLFDVGRGHDWVPRGLAPAPASGNRYLLARSSGGPPRAVLDLSASSVFVNDYYSEL
FT                   FGYDQGVTGGLLELPSFYKYFPEITADMCPEDENLSSCRSQRSTNQGIAVAAYNLGCFL
FT                   GAILTVFIGNAIGRRRTIFCGCVTMTTGAILQCTAYSLPHWIVGRIVTGIGNGMNTSTV
FT                   PTWQSESAKAHDRGKLVMIEGMLITGGICLSYWINYGFAFLPDHEVSWRFPIAFQIIFA
FT                   VTIFISIMNLPESPRWLVMKGRDDEAVEILELLNEKPRDDPYIQNELLSIKETVMEMNK
FT                   GSFRSLFKMSEYREFHRVALAYVNQMFQQISGINLITYYAPNIYTDIGLGGGNTAKLMA
FT                   AANGTEYLLAAFIPIFIIEKVGRRPLMLFGAAGMSISMAILAGTHYRRETYDDTKAGVA
FT                   QAVFLFVFNTFFAIGWLGMTWLYPAEIVPLRIRAPTNALSTSANWIFNFMVVMITPVAF
FT                   ENIKHNTYTIFAVINAFMFPVVYFCFPETRYRSLEEMDAIFKKSDGIWSAVQHSIKEPY
FT                   RYDKHGQLKPEYLEEAIRRESVRHVEGKFESEDSTNESQEAKGTETRLE"
FT   gene            258411..259943
FT                   /locus_tag="ANIA_08971"
FT                   /old_locus_tag="AN8971.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_5G13725)"
FT   mRNA            join(258411..258957,259029..259146,259215..259781,
FT                   259904..259943)
FT                   /locus_tag="ANIA_08971"
FT                   /old_locus_tag="AN8971.4"
FT                   /note="transcript_id=CADANIAT00007885"
FT   CDS_pept        join(258411..258957,259029..259146,259215..259781,
FT                   259904..259943)
FT                   /locus_tag="ANIA_08971"
FT                   /old_locus_tag="AN8971.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_5G13725)"
FT                   /note="transcript_id=CADANIAT00007885"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007885"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007885"
FT                   /db_xref="GOA:Q5ARV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARV9"
FT                   /protein_id="CBF84542.1"
FT                   /translation="MLESEPGLVVDHGWVLYAASWPLFGICFLIISLRLWVRAHMVRSL
FT                   GWDDAFMILAFLCAAINTILVTISVQYGTGRHASNLTEYQQSQSIKYQVLSAGFHVMST
FT                   NWGKVSVALFLIRIISEVKNHKLGMYALIIVMTIINTGAVITIFAQCQPTAAIWDHSLA
FT                   GPQACWPPDTQKKYSFFQAAASALTDLILAIYPLFTIKDLQMPTKVKLGLGFVLSLGLV
FT                   AMVAAIIKATHLPDMASYEDYTWDTINLTIWVSLEQYLIILAACIPALTPLFNIIVRRA
FT                   SNRSKSKSKSMPNDLLKGDSVTVQSLSRKHKHGSRSRGRSRDFALTLDSNSSQHQQYNP
FT                   FARVGREYVEYPLTWTTTTMHTATDLHHPADGSDSETPISGFHEEPEMPTGILRTTDFR
FT                   LEAVSNSRNSAVRWQIAKPILQDN"
FT   gene            260335..261297
FT                   /locus_tag="ANIA_08970"
FT                   /old_locus_tag="AN8970.4"
FT                   /product="oxidoreductase CipA-like, putative
FT                   (AFU_orthologue; AFUA_1G12460)"
FT   mRNA            join(260335..260367,260437..261297)
FT                   /locus_tag="ANIA_08970"
FT                   /old_locus_tag="AN8970.4"
FT                   /note="transcript_id=CADANIAT00007886"
FT   CDS_pept        join(260335..260367,260437..261297)
FT                   /locus_tag="ANIA_08970"
FT                   /old_locus_tag="AN8970.4"
FT                   /product="oxidoreductase CipA-like, putative
FT                   (AFU_orthologue; AFUA_1G12460)"
FT                   /note="transcript_id=CADANIAT00007886"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007886"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007886"
FT                   /db_xref="GOA:Q5ARW0"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW0"
FT                   /protein_id="CBF84544.1"
FT                   /translation="MTIFRRVALIGRGSLGTVLLDELLNSNFTVTVLTRSASSASSLPP
FT                   GADIKQVDYSSAESLKTALAGHDIVISTLSPSAIPLQKQVIDAAIAVGVKRFIPAEYGA
FT                   MTSDPVGRKLPFHKDAIEIHEFLRETVASGLIEYTVFGVGVLTELLFTTTLVVDLEHRE
FT                   VKLFDGGIHSFSTSRLETVARAVVASLHKPDETRNRVIRVHDAVLTQRQVLDMAKGWTP
FT                   TLEWREVYVDAQAEVDRGLKQLEKEFSPALVPGVFAAALMSGRYGAEYKEVDNELLGLG
FT                   FMDKREINDFGKKFTK"
FT   gene            262325..263196
FT                   /locus_tag="ANIA_08969"
FT                   /old_locus_tag="AN8969.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(262325..262493,262549..263196)
FT                   /locus_tag="ANIA_08969"
FT                   /old_locus_tag="AN8969.4"
FT                   /note="transcript_id=CADANIAT00007887"
FT   CDS_pept        join(262359..262493,262549..263064)
FT                   /locus_tag="ANIA_08969"
FT                   /old_locus_tag="AN8969.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007887"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007887"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007887"
FT                   /db_xref="GOA:Q5ARW1"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR008270"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW1"
FT                   /protein_id="CBF84546.1"
FT                   /translation="MKFISVLALPGLAYAAVQGFDISHYQETVDYQGAYDSGARFVMIK
FT                   ATEGTSYTDPKFSTHYSGATSAGLIRGGYHFAQPGSSSGADQASYFIEHGGGWSGDGQT
FT                   LPGMLDLEAGCYGLSTSAMSSWIKDFGETYKAATGRYPMIYTTTSWWQECTGNDSGFGE
FT                   YPLVVARWGSSVGTLPASWSTHSFWQNADTYEFGGDSEVWNGSEDSLKTFASK"
FT   gene            263269..264360
FT                   /locus_tag="ANIA_08968"
FT                   /old_locus_tag="AN8968.4"
FT                   /product="isoflavone reductase family protein
FT                   (AFU_orthologue; AFUA_1G12510)"
FT   mRNA            join(263269..263494,263571..263934,264012..264360)
FT                   /locus_tag="ANIA_08968"
FT                   /old_locus_tag="AN8968.4"
FT                   /note="transcript_id=CADANIAT00007888"
FT   CDS_pept        join(263269..263494,263571..263934,264012..264360)
FT                   /locus_tag="ANIA_08968"
FT                   /old_locus_tag="AN8968.4"
FT                   /product="isoflavone reductase family protein
FT                   (AFU_orthologue; AFUA_1G12510)"
FT                   /note="transcript_id=CADANIAT00007888"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007888"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007888"
FT                   /db_xref="GOA:C8VL85"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL85"
FT                   /protein_id="CBF84548.1"
FT                   /translation="MTKSNLLIFGATGAIGSYITAAITDARDEFGRIGIFTSQSTLTKK
FT                   TKEINALREKAVDILVGDVTSKDEVLKAFDGFDTVVSALGRGVIAQQVHLVQWADESPQ
FT                   IKRFLPSEYGTDIEYSLASANEKPHQQKLKVRAAIRETKNLEYAFVVTGPYADVPFYLG
FT                   ASKNPRGGSFDVKNKKAVLLGDGNGRISLVACADVGKFVVHTLTHWDKARGRALKLNSF
FT                   TTTPNDILAEFEKQTGNKWSVEYTSLKQLKQYEKEAWEKGEPDATTLTLRRIWTEGGTL
FT                   YERRDNEDIGAENTTTLEEAVNGAIKTQLGQ"
FT   gene            complement(264455..265974)
FT                   /locus_tag="ANIA_08967"
FT                   /old_locus_tag="AN8967.4"
FT                   /product="FAD binding domain protein (AFU_orthologue;
FT                   AFUA_6G14300)"
FT   mRNA            complement(264455..265974)
FT                   /locus_tag="ANIA_08967"
FT                   /old_locus_tag="AN8967.4"
FT                   /note="transcript_id=CADANIAT00007889"
FT   CDS_pept        complement(264455..265948)
FT                   /locus_tag="ANIA_08967"
FT                   /old_locus_tag="AN8967.4"
FT                   /product="FAD binding domain protein (AFU_orthologue;
FT                   AFUA_6G14300)"
FT                   /note="transcript_id=CADANIAT00007889"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007889"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007889"
FT                   /db_xref="GOA:Q5ARW3"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR040165"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW3"
FT                   /protein_id="CBF84550.1"
FT                   /translation="MGLEQHKTAVTRIASAIRGFYERKQPFRIAHGSTNSTRPIRRKHE
FT                   VDISDLRNVLRVDPVTRTALVEPNVPMDRLVEATLKHGLVPPVVMEFPGITAGGGFAGT
FT                   AGESSSFRYGFFDRTINYVEMVLADGSIVKVSENENRDLFRGAAGAVGSLGVTTLMELQ
FT                   LVEAKKFVKATYLPQRSVRDSITNVHAATLNDANDYVDGIIYGPDHGVVVAGEMTNEMP
FT                   DSAKIQTFSKAWDPWYYLHVKAKTRGNSPVTDYIPLAEYLFRYDRGGFWVGRAAFHYFH
FT                   FPFSRVTRWWLDDFLHTRMLYKALHASGESSRFVIQDLALPYANAEKFINYTSNKLGIW
FT                   PLWLCPLKQSPAPTFHPHSSVQSPGFTEDQMLNIGVWGFGPKDPEAFVTANRELEHRLR
FT                   ELGGMKWFYAHTYYGEDEFWSMYDRKWYDELREKYNATTLPSVYDKIKIDVEADRKERH
FT                   ESWSRKVRSIWPLGGLWGIKKAIESKEYHIHRNSTWKWK"
FT   gene            complement(268531..270831)
FT                   /locus_tag="ANIA_08966"
FT                   /old_locus_tag="AN8966.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(268531..268632,268738..269073,
FT                   269124..270831))
FT                   /locus_tag="ANIA_08966"
FT                   /old_locus_tag="AN8966.4"
FT                   /note="transcript_id=CADANIAT00007890"
FT   CDS_pept        complement(join(268531..268632,268738..269073,
FT                   269124..270713))
FT                   /locus_tag="ANIA_08966"
FT                   /old_locus_tag="AN8966.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007890"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007890"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007890"
FT                   /db_xref="GOA:C8VL87"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL87"
FT                   /protein_id="CBF84552.1"
FT                   /translation="MVLAQYLKRAVAWLAPPPKQSEDGRDQWPSRAAFLLAAMGGCAGQ
FT                   GNLIRYPSVVYNNYGLQWFIPYFLAIFFVAIPALILEISIGQAYRGGTVIAFNNINRRL
FT                   KGVGIGPILVSFIVTQYFTVNLAWIMNYFRNSFRSPLPWEGRIEEFYMGDVIHNVDPVG
FT                   GELSTDGKHVLSYTEYPGVRLLGETVGWSAFIWFLIWVSIFRGVGLTGRVVYWTMGLPI
FT                   VTTIIFVGRSLSLENASEGVKLLWATWRGGQLASGTVWQTAVGQVFFSTGIGFGYFTSY
FT                   ASYNAKHSNAVMDALLICGSNVLFENFAAFAVFGVVGYLHRWPEDGVRLGAFVVGFLTL
FT                   PEAVLHMPGSNFWAILLFFTLVVLGFSSAFVMLDAVATLVVDSGLKVSRPIIVTVLTLI
FT                   SFLMCLPYCTEFGFYLLDGIDRWINNICLIFVVWSEVVSASTVYRWQDVVDQTGLPAFI
FT                   TYNFAYFGGQVIGVSVAHGTENPGIGAGAGFGVYVVFSILSALLAKTPIQPAPSFWGRN
FT                   SLLSRFWYLAAYSGNQIRRDLNAIIGGEKNWKIPSVWPVLLRYVCAPVLAIIFSFAYPE
FT                   FHTLRYDPLMITGFILAHILLLIILLGLVMPRYYDVFIPPNRIDEGGRLRADLANDRII
FT                   PGGSDDGKCDNCASAPRQSGHEVAPIFLVEHLAPTYETCL"
FT   gene            272267..273514
FT                   /locus_tag="ANIA_11156"
FT                   /old_locus_tag="AN11156.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(272267..272303,272444..273514)
FT                   /locus_tag="ANIA_11156"
FT                   /old_locus_tag="AN11156.4"
FT                   /note="transcript_id=CADANIAT00007891"
FT   CDS_pept        join(272267..272303,272444..273468)
FT                   /locus_tag="ANIA_11156"
FT                   /old_locus_tag="AN11156.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007891"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007891"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007891"
FT                   /db_xref="GOA:C8VL88"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL88"
FT                   /protein_id="CBF84554.1"
FT                   /translation="MNILPRHAIATREQIFSASSPIPSGLLPQLKLPEGRNNAKNSLPT
FT                   RARHECPHIQVSDWYLPFASSIYCNPFSRAQFIIILLYSTNPPHRTASFRRTLPHSYVF
FT                   DFISGPFPSSPAPGIKAIYPDSPTYTWFREPTPAGLRAAHRYVAEYIQKHGPYDAVMGF
FT                   SQGCSLIASMALYHSYDRLSEQGQNGIRGDLPFKAAIFICGGIPLYALQDMGIPVSEEA
FT                   ETISKITGQLLNTTATKLSTFASNTSLIKRGVGLWDNNVTSNTLVHDPSVRPPRNDLFG
FT                   LDFTSFPSWAKIDIPTVHVYGGKDPRWPAGIQLAEFCADRVEFDHEGGHDIPRGSVVSE
FT                   RIGGMIQDLLRRV"
FT   gene            273684..274495
FT                   /locus_tag="ANIA_11157"
FT                   /old_locus_tag="AN11157.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(273684..273794,273854..274495)
FT                   /locus_tag="ANIA_11157"
FT                   /old_locus_tag="AN11157.4"
FT                   /note="transcript_id=CADANIAT00007892"
FT   CDS_pept        join(273684..273794,273854..274495)
FT                   /locus_tag="ANIA_11157"
FT                   /old_locus_tag="AN11157.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007892"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007892"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007892"
FT                   /db_xref="GOA:C8VL89"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL89"
FT                   /protein_id="CBF84555.1"
FT                   /translation="MPQNAKNYTDPELREQVKNEVQQGDKGGKPGQWSARKAQMTASEY
FT                   KARGGDYTTSKDEKKSEQKHLDKWTNEEWQTKEGSGTAKQDDGTRKRYLPKKAWEELDE
FT                   REKKATEQKKLEGSKAGKQFVANTGEAKRKRGEVSREGEKKGSRNGGKDKKGGQVDRKK
FT                   EKEGKMKQEPEENGENGENEEEEVENTENDEDYERDGEDLDGENEESGDNSGSEDEDEE
FT                   QNQQADEKETETDTPEGEQPEKKRQKQD"
FT   gene            complement(276386..278418)
FT                   /locus_tag="ANIA_08964"
FT                   /old_locus_tag="AN8964.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(276386..276429,276816..277246,
FT                   277298..277748,277813..277917,277973..278130,
FT                   278195..278418))
FT                   /locus_tag="ANIA_08964"
FT                   /old_locus_tag="AN8964.4"
FT                   /note="transcript_id=CADANIAT00007893"
FT   CDS_pept        complement(join(276386..276429,276816..277246,
FT                   277298..277748,277813..277917,277973..278130,
FT                   278195..278418))
FT                   /locus_tag="ANIA_08964"
FT                   /old_locus_tag="AN8964.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007893"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007893"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007893"
FT                   /db_xref="GOA:Q5ARW6"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW6"
FT                   /protein_id="CBF84557.1"
FT                   /translation="MDTREKALANLHAAGLSDILYLPSSDVYSARVESYWSLTAQLKPW
FT                   AIVRPRNTEEVSKAVKAIVATPDVKFAIRSGGHMQWPGANNIVNGITIDLGLMNSTTYD
FT                   PETGIASIQPGGTWAKSYQELEKQGRMVAGGREGKVGIGGLLTGGGKTFYTCRNGFACD
FT                   QVVNYELVLADGSISNANSTTNPDLFRALKGGGNNFGVVTRFDMTTFSAVDVWDCTITY
FT                   PKKATLQLSEAIVDLTKNLAAYPDDHILAMWTYLPKTEEHFVMVNMMNLEGVKEARTLE
FT                   KFLGIPEQMNRVDTTVSVATKLTSFVVPSGKYDTWYTTTFKADPQIILKSASVFESLVS
FT                   ALKNQVPYSNFYTQIVLQPLPVSFGAHSTARGGNMMGLDQMKVDCVLLVWAVEVDTPEL
FT                   NANVAGPTLKSAIEKIETYARSVKGDVGFRYLNYCDKEQDALGSYGEENVRHMKEVAVF
FT                   SEKVAEDVVRLS"
FT   gene            279667..280147
FT                   /locus_tag="ANIA_08963"
FT                   /old_locus_tag="AN8963.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(279667..279851,279919..280147)
FT                   /locus_tag="ANIA_08963"
FT                   /old_locus_tag="AN8963.4"
FT                   /note="transcript_id=CADANIAT00007894"
FT   CDS_pept        join(279667..279851,279919..280147)
FT                   /locus_tag="ANIA_08963"
FT                   /old_locus_tag="AN8963.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007894"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007894"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007894"
FT                   /db_xref="GOA:Q5ARW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW7"
FT                   /protein_id="CBF84559.1"
FT                   /translation="MAPAAAKAERLPRPATDYERWLGDDEQHLDSVRQYDLDQGQKDYT
FT                   NDGVITVAEDSSPPEIVDSDDLGSSPLSSDESSQPRHHYTRPTVPDIVALYAAIIIAVL
FT                   LVLKLHGSLRRPQWRRSEEKKRQGSPLGRDTND"
FT   misc_feature    282430..323292
FT                   /note="contig 1.166 664..41526(-1)"
FT   gene            282491..283180
FT                   /locus_tag="ANIA_08962"
FT                   /old_locus_tag="AN8962.4"
FT                   /product="sodium ion/proton exchanger, putative (Eurofung)"
FT   mRNA            join(282491..282697,282752..283180)
FT                   /locus_tag="ANIA_08962"
FT                   /old_locus_tag="AN8962.4"
FT                   /note="transcript_id=CADANIAT00007895"
FT   CDS_pept        join(282491..282697,282752..283180)
FT                   /locus_tag="ANIA_08962"
FT                   /old_locus_tag="AN8962.4"
FT                   /product="sodium ion/proton exchanger, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007895"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007895"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007895"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW8"
FT                   /protein_id="CBF84561.1"
FT                   /translation="MTREEGEREEDKSPTFVHTFERYLMDVQKYLMEPLFFASIGFAIP
FT                   FVQLWTGKRIWRGIVFTLLMVFAKFIVGVWVPLWQALTRSKHGKPRRPPNPPNQSGRQR
FT                   DEEAEMEPEDGTNEKPAREGTKVIWLSGLLLGSAMVARGEIGLLKEIGYNETSYVSEDG
FT                   FITGVWAILLNTIIGPVAVGVLVKLYGKRIGEGAWGVQETPQLGRAAG"
FT   gene            284103..286727
FT                   /locus_tag="ANIA_08961"
FT                   /old_locus_tag="AN8961.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            284103..286727
FT                   /locus_tag="ANIA_08961"
FT                   /old_locus_tag="AN8961.4"
FT                   /note="transcript_id=CADANIAT00007896"
FT   CDS_pept        284103..286727
FT                   /locus_tag="ANIA_08961"
FT                   /old_locus_tag="AN8961.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007896"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007896"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007896"
FT                   /db_xref="GOA:Q5ARW9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW9"
FT                   /protein_id="CBF84563.1"
FT                   /translation="MIKPEPTRTKNQAPRFYRQYIDENDSLSAAPSPVSSLLPPHLRTP
FT                   SLPSSRNEAKDATGRAQPRRSLDIASKALGIKSLTLNSTDAVTQTTAPLLDARPTLTLH
FT                   LPNGRVLPPLSPTASNFSPRVRSSSLGQTGSQHVGQASGTGHYRSASHTFSSPTTPIAI
FT                   LHPPRPPYCNASSGPLLFRNPVPSPVITIREPSPPPSESRSAVQTQTQSRKNSTDLGET
FT                   ATARLEQVPGGAAAFSGRVEKSVSAPDALASGDPLLRQSGSRPSLEDNTYSHDHTPDIA
FT                   GRREVRQRETNAPNPCQETEEPMLDNISDKAPLSPPAHRSSFDSSNNQRSRGRSMELTR
FT                   TKHVRRPRHRASTQPLQMADPMFISISGKEFSSQGNGGSSRSSLETSSRDRSLTLPGSL
FT                   PQQPNDNTSTNSLQTTVRGSVPDTRSVAVTRLTSLNSHPPSSVIEREHTRSQSLDVNHH
FT                   SGPPAVPRHIYASLPLPRIRLPSIHSKADASSAQATDSEATISHSAGPASSLPTGPRTP
FT                   THAVFPHPQPQPQPQSEAMFTSRASSLPVTTPPAFSSPAPNSHSALQSLSPHLEAHQPT
FT                   TRLSLSKFTTQSLTTLRAVASASKIHSSSTSLSTPRSKSNSSSSSNSTASASTTSVLTP
FT                   QSPPFRPPSPTDTSNLPLATLTQHMKTQLGQARHLLATLSHHLPPAENIWIHDTVSDAE
FT                   GTVREILMLTEPLRVDREVNNGKLGLKTQLKWAVRGSWKAKDMRARLNLCYSSLVAILM
FT                   RLQDYEAEYAESVAEHAAAKTETMTSDDRNPMTSTNVHVEGPTTSELESLHKYSAMQME
FT                   GLSLESVVDEHTGIETRSAGPQSPISTISREESIEPAPEKLDNELVDMLSWRWSQGREK
FT                   TTQ"
FT   gene            287840..287875
FT                   /locus_tag="ANIA_11637"
FT                   /old_locus_tag="AN11637.4"
FT                   /product="hypothetical protein"
FT   mRNA            287840..287875
FT                   /locus_tag="ANIA_11637"
FT                   /old_locus_tag="AN11637.4"
FT                   /note="transcript_id=CADANIAT00007897"
FT   CDS_pept        287840..287875
FT                   /locus_tag="ANIA_11637"
FT                   /old_locus_tag="AN11637.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007897"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL94"
FT                   /protein_id="CBF84565.1"
FT                   /translation="MTVHIGFIRWV"
FT   gene            289633..290589
FT                   /locus_tag="ANIA_08960"
FT                   /old_locus_tag="AN8960.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(289633..289918,289973..290589)
FT                   /locus_tag="ANIA_08960"
FT                   /old_locus_tag="AN8960.4"
FT                   /note="transcript_id=CADANIAT00007898"
FT   CDS_pept        join(289633..289918,289973..290589)
FT                   /locus_tag="ANIA_08960"
FT                   /old_locus_tag="AN8960.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007898"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007898"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007898"
FT                   /db_xref="GOA:Q5ARX0"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX0"
FT                   /protein_id="CBF84567.1"
FT                   /translation="MAATAQSQSEEVAVEIKANATVHNREIGTDESVLFEDTRTPHAPQ
FT                   APSTMNIAIRPNAPQDLPVLLSRVSKLGASYAQNEDEDIRAEYLDAGPPSRSLPATAEN
FT                   AFNVRRAHYAAIETCVDLGVFVSLSKDDTPKTVAELAKATHADPLLLCMLLPQRVLLFS
FT                   PIWHADKPARLLKHLSTMGVIIETSEDTYLCNGFSTSLSNKRYSDAYPCMFARYLPLYS
FT                   SFQQSPLIPSLGPTASHTASPACPRFSREPTTPTQAMVAIPRSKTDNASASTSSNSPRN
FT                   TSPTAQSSITTGQPTVRPT"
FT   gene            complement(291627..292264)
FT                   /locus_tag="ANIA_08959"
FT                   /old_locus_tag="AN8959.4"
FT                   /product="benzodiazepine receptor family protein
FT                   (AFU_orthologue; AFUA_3G01430)"
FT   mRNA            complement(join(291627..292066,292162..292264))
FT                   /locus_tag="ANIA_08959"
FT                   /old_locus_tag="AN8959.4"
FT                   /note="transcript_id=CADANIAT00007899"
FT   CDS_pept        complement(join(291627..292066,292162..292264))
FT                   /locus_tag="ANIA_08959"
FT                   /old_locus_tag="AN8959.4"
FT                   /product="benzodiazepine receptor family protein
FT                   (AFU_orthologue; AFUA_3G01430)"
FT                   /note="transcript_id=CADANIAT00007899"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007899"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007899"
FT                   /db_xref="GOA:Q5ARX1"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX1"
FT                   /protein_id="CBF84569.1"
FT                   /translation="MPWSFVLPQAIFASPLLATLTPVATGSTIGYLVNRYGTKPKYHAL
FT                   KQPPASPPSWLFPPVWTLLYGLTGYASYHFTVNTLEPDTTITQTLYTAQLFLNHLWMPL
FT                   FFAARKPILAAGDIVLLGGTVATLMRELWGSDRVSFWLFAPYAAWLGYATYLNFGTGIL
FT                   NNWRIPDVPEERKRRNE"
FT   gene            complement(292710..293584)
FT                   /locus_tag="ANIA_08958"
FT                   /old_locus_tag="AN8958.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(292710..293443,293521..293584))
FT                   /locus_tag="ANIA_08958"
FT                   /old_locus_tag="AN8958.4"
FT                   /note="transcript_id=CADANIAT00007900"
FT   CDS_pept        complement(join(292710..293443,293521..293584))
FT                   /locus_tag="ANIA_08958"
FT                   /old_locus_tag="AN8958.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007900"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007900"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007900"
FT                   /db_xref="GOA:Q5ARX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX2"
FT                   /protein_id="CBF84571.1"
FT                   /translation="MSSLLQAKPHLTAALSFLAFGASACRNIIESSEGAPGPPQRTDKS
FT                   ALLSEWPGSNGIKRETQKTHWVTSLVALQVDVPVAQLVRCGISEVGDAYDLARNLFSAF
FT                   LDARARGLEAWFLDKDVPQLSFTPWSLLFGRSHSAGAFMLGHWSSARRIQLDQPILHSE
FT                   TANPICEFRPSKAMITASNINAETDAAGTVLYWKFPRRSVDQVDKAASYGIPWRLMEGA
FT                   FQEFIVEKITSETTKVTYVTVGCGNMYPGGQRERTSKGAVVVV"
FT   gene            complement(293944..299258)
FT                   /locus_tag="ANIA_08957"
FT                   /old_locus_tag="AN8957.4"
FT                   /product="ABC transporter (Eurofung)"
FT   mRNA            complement(join(293944..293972,294216..296043,
FT                   296098..298617,298685..298965,299081..299258))
FT                   /locus_tag="ANIA_08957"
FT                   /old_locus_tag="AN8957.4"
FT                   /note="transcript_id=CADANIAT00007901"
FT   CDS_pept        complement(join(293944..293972,294216..296043,
FT                   296098..298617,298685..298965,299081..299258))
FT                   /locus_tag="ANIA_08957"
FT                   /old_locus_tag="AN8957.4"
FT                   /product="ABC transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007901"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007901"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007901"
FT                   /db_xref="GOA:Q5ARX3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX3"
FT                   /protein_id="CBF84572.1"
FT                   /translation="MYDVTLFTGKGLEFISGNFASLAPDGNKLLSLHLPTLVPRHANCG
FT                   SSNGSNSQLSAIDVGYTASRRGTIRLPLEDEYDALLDSAGHEYIDEDGEATEHSVFEFE
FT                   KAEKWQAWSIATLSVLGFAVSLAQAVVVTCAGARGRHFMAISWVGMVGWMAMCIQPVSL
FT                   LTERSCVKRYWLGISSFWASLVCILGIATQTIILWGNGHTVTINSASTILLSTQIAISS
FT                   LRATVSILIPRRPNVYFEGQVVDQELTVSAYNRFTYGWTTDLLNFASKNRSLNIDDLPK
FT                   LPFTARAETVHFKLQQFQAGRKLWVALIKRHVRALIVQGFLSLVVCVLGFGPQVALYEI
FT                   LKSLEERAVLQTDSTVVWMWVAGLGLLLALSSSIESWLWWLIYSDLWIPIYEGLSGLIF
FT                   AKSMRCKNVNSPKTRAAQEHGGWEDEGEEDGEGEEQEQNCQSIINLAAVDAKRIADFVT
FT                   FSYLIPSCVLRLAIAGGFLVRLIGWPSLLAGIGGAVLLAPLNSWLTKRYARAQEEFMKS
FT                   SDKRTSTVTEVLQGIRQIKFGALEQQWQDRIKEKRETELDLLWKTSVYTTGMVSVWIMG
FT                   PLLLSAISLTVYALTRGELSPSVAFTALSIFSSLESSLASLPDLFSKAMEAKISADRID
FT                   TYLSSAEKMSNTSDVERITFKDATVAWPSEDENDWETDTDRFALRHLTLEFPVKGLSMI
FT                   VGKSGSGKSLLLASILGECDILAGSVKVPRAPPPSQRFDHLALRENWIIDTAIAYVAQS
FT                   PWMENASIKENILFGLPYDRQRYRQTIFASGLEKDMTMLPDGDLTDIGANGINLSGGQR
FT                   WRVSFARALYSRAGILIMDDIFSALDAETGRHVYEHALTGELGHNRTRILATHHVGLCL
FT                   PRTDYCVLLENGFVTHAGTVAELNATGELTNLMGKAEISRERAEPPLRELPKPKRSSAA
FT                   STGRRSSAFSARTIPKFNQEEKRETGAISMKVYISYLNRGGKVWWWILAFLAYAAFMAL
FT                   LVGRSWWVSIWTGDSTRKGEPRASGHDLMFYLTIYIAISMAACLIGTLRCLALALAFIS
FT                   SSRALFNDLLGTILRAPLRWLDTVPLGRILNRFTSDIYLLDWRLGYDIGHVLYKLLELV
FT                   GILVAGVAVSPLLLFLACVLLALCMRLCSVYLAGVREIKRLESTAKSPVMEKFGSSLSG
FT                   LSTIRAFNKAETYIADMHTLITRHAQASWYLWLFNRWLGFWMALVGALFSTLTASLLVY
FT                   MPGVSAALAGFAMSFALQYNYAVAMGLRFYANVEIDMNATERVLEYANIETESQSGYTP
FT                   PASWPTKGRIEVEDLEVSYAPDLPPVLNGVSFVVDNNQRIGVVGRTGAGKSSLTLALFR
FT                   FLEARRGRIMMDGLDIGHVKLSELRSRLAIIPQDPVLFSGTIRSNLDPFGEHSDLELFN
FT                   ALERVHLLRFEDTSTLASSSASASCSGSEAYPPSDGSRSPTTTAGTSPTDPMSASITLT
FT                   ASSTSTSKAKETGFFASLSSPVTTNGGNLSHGQRQLLCLARAILTRPKIMVLDEATSAV
FT                   DMETDALIQQSIRTEFGRSDSSLLVIAHRLSTIADFDKILVLDAGRVVESGAPRELLKT
FT                   EGGMFRALVERSGEREVVEKIILASLSQNCMK"
FT   gene            302131..304002
FT                   /locus_tag="ANIA_08956"
FT                   /old_locus_tag="AN8956.4"
FT                   /product="phosphate-repressible phosphate permease,
FT                   putative (AFU_orthologue; AFUA_8G01850)"
FT   mRNA            302131..304002
FT                   /locus_tag="ANIA_08956"
FT                   /old_locus_tag="AN8956.4"
FT                   /note="transcript_id=CADANIAT00007902"
FT   CDS_pept        302182..303897
FT                   /locus_tag="ANIA_08956"
FT                   /old_locus_tag="AN8956.4"
FT                   /product="phosphate-repressible phosphate permease,
FT                   putative (AFU_orthologue; AFUA_8G01850)"
FT                   /note="transcript_id=CADANIAT00007902"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007902"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007902"
FT                   /db_xref="GOA:Q5ARX4"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX4"
FT                   /protein_id="CBF84574.1"
FT                   /translation="MPHPLTAKYDWILAITSMAFVFSAASNGANDVANAYATSVAARTL
FT                   KMWHVGILAAITEFVGAVALGNRVTDTIKSGIITPDRFIGNPGTYMLAMGCAEVGSAAW
FT                   LTTATFLGWPVSTTQSIIGALVGVGFATQADITWEWTSGSVSQTAASWGVAPGIACGFS
FT                   AIIFGTLKYAVLEREDPFKWGLRLIPWYIALTGGILALFITIEAPTAPSLEEFGAGKAV
FT                   GIILGCFFGCLFVGYVFFMPYFHRRLVRRDARVRFYHIPLGPLLWTENPPLYFPREGEW
FT                   AITNHYEDAYGEVRAGGQQTITAAVAGSVLPPADGKEARDTDIERQPDSLASSPEIAPK
FT                   KRIIEPEERFLDPVRDLSWGNPRKWLGYIKYAFLQGVTRDVITHDSQLLRDIHARARRY
FT                   DDRVEHMWTYCQVVSAMMMSIAHGSNDVANAVGPWAGSYHTFNSGSVETEASTPVWFLV
FT                   IAGLLLGGGFWFYGYHIMRALGNKITQMSPTRGFATELGAATTVLLASRLGLPVSTTQC
FT                   LTGAAIGVALMNYDLAAVNWRQIAFIFSGWVLTLPCAGLIAGLLCVMALNAPHF"
FT   gene            complement(305462..307205)
FT                   /locus_tag="ANIA_08955"
FT                   /old_locus_tag="AN8955.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(305462..305891,305951..306293,
FT                   306383..306567,306627..306847,306895..306982,
FT                   307051..307205))
FT                   /locus_tag="ANIA_08955"
FT                   /old_locus_tag="AN8955.4"
FT                   /note="transcript_id=CADANIAT00007903"
FT   CDS_pept        complement(join(305462..305891,305951..306293,
FT                   306383..306567,306627..306847,306895..306982,
FT                   307051..307205))
FT                   /locus_tag="ANIA_08955"
FT                   /old_locus_tag="AN8955.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007903"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007903"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007903"
FT                   /db_xref="GOA:Q5ARX5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX5"
FT                   /protein_id="CBF84576.1"
FT                   /translation="MEDKKVVLDSGSSEELEQGFSSNGNGYDTVATKKLIRKIDFVLIP
FT                   WLALLYLLSFLDRTNIGNARLAGLETDLNMSGLDYNVALAIFFPFYVAAEIPSNIMMKR
FT                   SRPSLWIPSIMIAWAVVCSLMGLVQNYAGLLVARAALGIAEGGLFPGVTFYITMWYKRH
FT                   ECGLRMAIFFSAATAAGAFGGLLARGIGEMDGIGGKGGWAWIFIIEGILTFVIAKFLTS
FT                   AEKAEVQRRLEEDRSSLADEYNMKFFWDAIKDWKIWVHMFVTVGVYTPLYSFSLFLPTI
FT                   VSSLGYENEEAQLMTVPPYVVACVFCIGGGFLADRQGQRGIYMIGFNIVAIIGFIMLIS
FT                   SDNNGVKYAGTFFAASGIYPNVPQGVAWNGNNIGGSFKRSVGIAMHVGCGNLGGVLSSF
FT                   IYRSQDKPHYRVGHGTLIGCLTMSTVLCTIMTIYLRRENARRDREYKPPAEYSEAERAA
FT                   EREKGDDASFFRYTI"
FT   gene            309088..309414
FT                   /locus_tag="ANIA_11636"
FT                   /old_locus_tag="AN11636.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(309088..309130,309374..309414)
FT                   /locus_tag="ANIA_11636"
FT                   /old_locus_tag="AN11636.4"
FT                   /note="transcript_id=CADANIAT00007904"
FT   CDS_pept        join(309088..309130,309374..309414)
FT                   /locus_tag="ANIA_11636"
FT                   /old_locus_tag="AN11636.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007904"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007904"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007904"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLA1"
FT                   /protein_id="CBF84578.1"
FT                   /translation="MMGSGLRVAKRAAVAQPRQLFEKLHFQ"
FT   gene            complement(309909..312216)
FT                   /locus_tag="ANIA_08954"
FT                   /old_locus_tag="AN8954.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(309909..310473,311092..311521,
FT                   311587..311625,311808..312216))
FT                   /locus_tag="ANIA_08954"
FT                   /old_locus_tag="AN8954.4"
FT                   /note="transcript_id=CADANIAT00007905"
FT   CDS_pept        complement(join(309909..310473,311092..311521,
FT                   311587..311625,311808..312216))
FT                   /locus_tag="ANIA_08954"
FT                   /old_locus_tag="AN8954.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007905"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007905"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007905"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX6"
FT                   /protein_id="CBF84580.1"
FT                   /translation="MSDRKLILVMGILALRALPLSRVRRIPDGIARNSSLTWRMIALSS
FT                   SGRYDVRVLTRNTASEQARKMVVLPQVTLQQGFQETRQISTLPSPAYTAPGRLYARGKS
FT                   ELIYGIRAYEIARHHGVKHYVFANIDYTLRKAGKEDGSFAWENPAADGKIPLIALDDVG
FT                   VYSLWLFDNPSQSAGLNLEVATDQVSFAEIATTFTKVTRKKGIHKRLSLDEYLDEAELY
FT                   PGAYANWAVASDVPRDESFMTWRENFTAWWGYWSEGKGATRDMALMDRIHPSRIPSLEA
FT                   WMRMKGYDGRPRLHPPYPIIMASFLVDGRFPPVPLPPSKDIKSEERSTAIDFVNRHNLI
FT                   FQEFNYDKVTATFLPDAIVYHSHGTIRGHAEIKQFLENVYGFFIPGIGRSATNHVVDRD
FT                   ENGGVVVRYQETLIRYGWGEGEPDADVVAGRDIVRADGLPAIWWFGQVVDRLRIAANGW
FT                   RILERYLGGSFRNQSLDLTNKV"
FT   gene            complement(313049..316309)
FT                   /locus_tag="ANIA_08953"
FT                   /old_locus_tag="AN8953.4"
FT                   /product="Alpha-glucosidase BPutative uncharacterized
FT                   protein Precursor ; [Source:UniProtKB/TrEMBL;Acc:Q9C1S7]"
FT   mRNA            complement(join(313049..313922,313981..314114,
FT                   314172..314307,314380..316309))
FT                   /locus_tag="ANIA_08953"
FT                   /old_locus_tag="AN8953.4"
FT                   /note="transcript_id=CADANIAT00007906"
FT   CDS_pept        complement(join(313255..313922,313981..314114,
FT                   314172..314307,314380..316309))
FT                   /locus_tag="ANIA_08953"
FT                   /old_locus_tag="AN8953.4"
FT                   /product="Alpha-glucosidase BPutative uncharacterized
FT                   protein Precursor ; [Source:UniProtKB/TrEMBL;Acc:Q9C1S7]"
FT                   /note="transcript_id=CADANIAT00007906"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007906"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007906"
FT                   /db_xref="GOA:G5EB11"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR031727"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB11"
FT                   /protein_id="CBF84581.1"
FT                   /translation="MRFQQLLPWAAALTGCVVAQSQAGVDPLDRPGNDLYVKDLSNCTG
FT                   YKVTKHWKTRSGFYADLALAGPACNVYGIDLPKLKLEVEYQTDERLHVKILDTNNTVYQ
FT                   VPDSVFPRPGFGQWCSPKNSKLKFDFKPDPFSFTVSRTDTGEVLFDTTGTKLVFENQYL
FT                   YLKTHLPQNPHLYGLGEHSDSFMLNTTNYTRTIYTRDAYGTPQGQNLYGAHPIYFDHRQ
FT                   DGTHGVFLLNSNGMDIYIDNEGGQFLEYNIIGGVFDFYFIAGPSPQDVARQYAEIVQPP
FT                   LMVPYWGLGFHQCRYGYQDVYEVAAVTANYSVHDIPLETIWTDIDYMDRRRIFTLDPER
FT                   FPPELVKDLVDTLHARDQHYIVMVDPAVYYSEPNPALDAGLKYDAFMKELNGTHYQGVV
FT                   WAGPSYFPDWFHPNAQEYWTEQFLNFFDGVNGPDIDALWIDMNEPANFYNRPYPGNNTT
FT                   PEEFAEANDNPPEPPAVRDGPDAPIPGFPDSLQPNFASGQTNEKRAVVTVERRARSQSH
FT                   RQLGAGRWRSAVRHWPRDPKAGWQHGRKSGSGCGPHECRGLPNRELIRPPYMIQNGAGP
FT                   TLADNTADTDIVQSGGYVQYDTHSLYGAMMSTHSHNAMRARRPDDRALVITRSTFAGSG
FT                   KDVSHWLGDNISDWLSYRLSISQILQFASLYQIPVVGPDVCGFGGNVTETLCARWATLG
FT                   SFYTFFRNHAEIFANPQEFYRWPIVAEAARNGIAIRYQLLDYIYTAIYKQTQTGTPSLN
FT                   PLFFNYPFDQNTYGIDLQFFYGPGILVSPVTEENSTSVSYYLPDDIFYEWGTGKPVRGH
FT                   GEYVSAEVDVTHITVHYKGGLVYPQRIESANTTTALRQKGFNIVIAPGLDGSAHGELYL
FT                   DDGLSQVQDKVSEIDFSYVDGVFEMKGSFEYDPGVGIERITILGVGAKPEVAAEDAEVE
FT                   YDEENQKLVLHVDVPLTRKSSIKIA"
FT   gene            complement(319280..321183)
FT                   /locus_tag="ANIA_08952"
FT                   /old_locus_tag="AN8952.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            complement(join(319280..319489,319553..319681,
FT                   319747..319848,319946..320707,320782..321183))
FT                   /locus_tag="ANIA_08952"
FT                   /old_locus_tag="AN8952.4"
FT                   /note="transcript_id=CADANIAT00007907"
FT   CDS_pept        complement(join(319280..319489,319553..319681,
FT                   319747..319848,319946..320707,320782..321183))
FT                   /locus_tag="ANIA_08952"
FT                   /old_locus_tag="AN8952.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007907"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007907"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007907"
FT                   /db_xref="GOA:Q5ARX8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX8"
FT                   /protein_id="CBF84583.1"
FT                   /translation="MSSPWKVMDPNLADMHQIASFLGLHRVALFLIAAVIVRVLYRRYW
FT                   SPIRDVPGPFWASFSSLWRVYHVVKGHTEQQILKLHKEHGIAHPLLLRWRLEEKITSGT
FT                   IGDFVRIAENEISVAHPDAVKQLLHANLAKGTFYSVFSLPDYRYVNQMSELDPTRHIQK
FT                   TRNLSAGFSLSNITKTEPYIDRCLKVLSRQLDGLAASDAPVHFQDWFSFFAFDVLGEVT
FT                   FSKSFGFLQEGLDIRNAIANTGSLVYYISIMGNYVWFHNLTLGNPLVSRLGLQPNSHIF
FT                   DTCLLAIDSRKNNPELRHDMMQRWLDMRASHPERMSEEDIFGAAVANVGAGAETISSTA
FT                   QAVIYYLLKNPQYLATVRKELDEAQAKGELSDVIQYGEATKLPFLQACLKEAYRFHPGV
FT                   CHNLPRISPKGGMTIAGRYFPEGVILSVHPWVIHRNADIFGADCDTYNPTRWLQGDTKR
FT                   MDYFLIHWGAGYNQCPGRNLAQFELSKVLATVLRDYDIKLMNPKSEWRFETRFLAVPYG
FT                   WPCQIQRRKRGMVQVAA"
FT   gene            322496..323824
FT                   /locus_tag="ANIA_08951"
FT                   /old_locus_tag="AN8951.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(322496..322669,322741..323121,323158..323228,
FT                   323377..323824)
FT                   /locus_tag="ANIA_08951"
FT                   /old_locus_tag="AN8951.4"
FT                   /note="transcript_id=CADANIAT00007908"
FT   CDS_pept        join(322496..322669,322741..323121,323158..323228,
FT                   323377..323824)
FT                   /locus_tag="ANIA_08951"
FT                   /old_locus_tag="AN8951.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007908"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007908"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007908"
FT                   /db_xref="GOA:Q5ARX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX9"
FT                   /protein_id="CBF84585.1"
FT                   /translation="MASEPSAAYLAEDRSQPALIGIVVVTALSAVVVIVRLYARRVLVR
FT                   GLGWDDLFIVLAQLVSWATMALCSQILRYGSGRHLVALLKTPETLVRMYKWLVTTQMVY
FT                   MFNLWLCRVSGLTFYARLNPMPRFILYLRLSFAFVTAVWAAQSLIIALQCIPLEALWDN
FT                   SITDKKCMGSAMVFISTGALTIIVMGLQAKTARKLALLGILCFGVLTSILRMVSMIVSV
FT                   QHEDDATWYFSPVVAWTCAEISAAIIALSLPALRAIFGFLKEHHSTRGKSNSYPNTGSG
FT                   SKGIGLDSLSKSATKQPKVFHGSGVYDNTVDIGVGRSPSQEVLWNGYGDRSYGNRGNGS
FT                   PREIMITETVDVEVGRG"
FT   misc_feature    323293..332704
FT                   /note="contig 1.178 2908..12319(-1)"
FT   gene            327758..329422
FT                   /locus_tag="ANIA_09432"
FT                   /old_locus_tag="AN9432.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(327758..327859,327908..327979,328030..328170,
FT                   328210..328270,328317..328358,328415..328459,
FT                   328510..328517,328663..328750,328791..328880,
FT                   329035..329073,329124..329204,329257..329316,
FT                   329370..329422)
FT                   /locus_tag="ANIA_09432"
FT                   /old_locus_tag="AN9432.4"
FT                   /note="transcript_id=CADANIAT00007909"
FT   CDS_pept        join(327758..327859,327908..327979,328030..328170,
FT                   328210..328270,328317..328358,328415..328459,
FT                   328510..328517,328663..328750,328791..328880,
FT                   329035..329073,329124..329204,329257..329316,
FT                   329370..329422)
FT                   /locus_tag="ANIA_09432"
FT                   /old_locus_tag="AN9432.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007909"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007909"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQJ8"
FT                   /protein_id="CBF84587.1"
FT                   /translation="MPSIRDNDLRKSPEYCHYLEAVKDGELTLPDFKIDDNGVPDIHPY
FT                   EVYCRVKGCLKRTVPSANRNILVKHLKDKNSHGMEFTLHNGPPTMKELMEAKGKSYLDY
FT                   LACLKALFSQPRLLPRSASELPPSPRTTILRVSRIPTRVKLEMIRTMARALQVIRREGS
FT                   KAAKSAGEKGTIPCKTCRNAKGKVSAPCGSKPYCEFWRFFSSIDEAKGASMQPHMDNAK
FT                   ETSNEESVLNKENEHENEEEKAAEPEEVQGDGRHVSEHLAITPFAQLNSGEDNSIATNL
FT                   DLRDFGLNLESI"
FT   gene            complement(329786..333279)
FT                   /locus_tag="ANIA_09431"
FT                   /old_locus_tag="AN9431.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(329786..329814,329963..330312,
FT                   330359..330542,330591..330712,330767..330870,
FT                   330919..330968,331017..331094,331285..331461,
FT                   331522..331702,331769..331861,332566..332659,
FT                   332719..332954,333039..333077,333232..333279))
FT                   /locus_tag="ANIA_09431"
FT                   /old_locus_tag="AN9431.4"
FT                   /note="transcript_id=CADANIAT00007910"
FT   CDS_pept        complement(join(329786..329814,329963..330312,
FT                   330359..330542,330591..330712,330767..330870,
FT                   330919..330968,331017..331094,331285..331461,
FT                   331522..331702,331769..331861,332566..332659,
FT                   332719..332954,333039..333077,333232..333279))
FT                   /locus_tag="ANIA_09431"
FT                   /old_locus_tag="AN9431.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007910"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD93"
FT                   /protein_id="CBF84589.1"
FT                   /translation="MSTTPQIPGAIDVPEQNGYTYIVPLDPNRTQYHARQLERYDAQSP
FT                   YIRGRVTRIQYQCSGVRICSYLHPNLRNMHHYKVTEDDWNYIRQERQLIEETEMDPKKQ
FT                   KAISHFFGVLRVFKRHQACRPQQVGCAPKMVLGEAALIYREKLAFYPDGQDLNALQLEC
FT                   DRNEYLKHYVREIYHEGDITIIICILQDQAKLFQSLRSFEVDMSFKRVREGRFNEVIFA
FT                   VFLEDHGKVITLLRAFMNQQTGRAYYFLFKKVFEMIHDLSGHPVQFFHLHGTGIETIVV
FT                   DMDEGQRDVLFKAMISLLHAPTRAQYMDILEQLLEDPTPGVATWAEHKLHPHFNQTRMH
FT                   TNAGEQTHQKSYAFSGKHLPILKAVTSAYFLDVRDMHQYSVRIHYNITHSYRPDDEISR
FT                   ITENLIRDQRKRRRNQEIEEEENIEGVLPRRARPSRSFSSSGSPRPRRSRSSTRGRSYT
FT                   RGVSRSSTPQRSPSLAQIASQNYRDQQASHEQHILDLRERQARLDRYEVETRLMQQRLL
FT                   QPTSPQLVGVNPVQYPPLPGYLPSSSQLVNPGPVYVPQMTGALPYVPSQAPFVPSTETS
FT                   HQLVYQDSQARSFSTVSC"
FT   misc_feature    332705..446765
FT                   /note="contig 1.165 538..114598(-1)"
FT   gene            complement(335803..336544)
FT                   /locus_tag="ANIA_08950"
FT                   /old_locus_tag="AN8950.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(335803..335849,336154..336544))
FT                   /locus_tag="ANIA_08950"
FT                   /old_locus_tag="AN8950.4"
FT                   /note="transcript_id=CADANIAT00007911"
FT   CDS_pept        complement(join(335803..335849,336154..336544))
FT                   /locus_tag="ANIA_08950"
FT                   /old_locus_tag="AN8950.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007911"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007911"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007911"
FT                   /db_xref="GOA:Q5ARY0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY0"
FT                   /protein_id="CBF84591.1"
FT                   /translation="MAHHDPLHTAPTRRNLPIEVSYSIGPCNSSMDHNVSQLERKPDRN
FT                   DGFQRYLEATGATIYQSWHPPHTASPYPVQSDGQFHIPNSQSQNLGFPASTSSFMQPSV
FT                   AQADYHYPMNAHAPSTVMSDLPLAREKWFNRPPLLYPFQFT"
FT   gene            336946..340589
FT                   /locus_tag="ANIA_08949"
FT                   /old_locus_tag="AN8949.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(336946..337921,338491..339184,339596..339630,
FT                   339803..339992,340058..340145,340236..340589)
FT                   /locus_tag="ANIA_08949"
FT                   /old_locus_tag="AN8949.4"
FT                   /note="transcript_id=CADANIAT00007912"
FT   CDS_pept        join(336946..337921,338491..339184,339596..339630,
FT                   339803..339992,340058..340145,340236..340589)
FT                   /locus_tag="ANIA_08949"
FT                   /old_locus_tag="AN8949.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007912"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007912"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007912"
FT                   /db_xref="GOA:Q5ARY1"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY1"
FT                   /protein_id="CBF84592.1"
FT                   /translation="MSTTSTPRHRPISFVGKWLDTIEERPAPQSTSYPRRSPIPSASSN
FT                   LTGSTLVWPRARQDTGITQDTRVVVVKSPRPKKSKKDAFCAIFRSWKATLTTRTTSHET
FT                   FPATVRENPELAIAELSSHLSANFAVLIETALRNSPSKALSARRICKEIMRADNWYRAH
FT                   ENLGWQESVARELSLSPSFQPVIECREGRVRNKGVKWQLTAVDVSLAPATAPWRPPQDS
FT                   VPYPLELSTEVEATERQTEPSRAENSDTPQPRRPSAGLPALAALASASLLSSALPLHPE
FT                   EDTIPKDEALVSGFSKRLFFTAPGPSRSPANISFNDAPPPSHQSDTPTVPPPLRPPPPS
FT                   LDIPESLPVQVDSSARPSPASSTALSADPLATADASSVQVSTPSSCAQQLYDSPLPITA
FT                   AVRVLKHNIHCIEKRLSLVENTTIQLLQKWEMPSGRGPNLIVPAHSLGSSIYSRCNPSN
FT                   GSMLSPGNYNPSFSQSNNSLSNCPPLGSSTAVTTRTPSEKAPSEEFPSPDFDVLLSFEN
FT                   PDNPRAGATNADDDGGLVEDRFMPDLDLEAWNEEHNGALGVLEKERLGTDNPTILEYSE
FT                   GSGPYFDETAANPWRLSSSNGAKQIQTTPNLSLNFYRPLQTTKRTRLQPTTWRMTSRIK
FT                   AVDINYYVLWYENILDTKAPNNQLDWVRDGRLVVSVWSTVEGQNAIVEAAIDNNLDMVQ
FT                   YPFSKGPDIDEVGIKGPAGDESYNDMGIPLHQAATDGYTEMALFLADAGANTHLKDPMG
FT                   RTAEDLALEKDHTEILTLYAGKRVP"
FT   gene            341446..342193
FT                   /locus_tag="ANIA_08948"
FT                   /old_locus_tag="AN8948.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(341446..341463,341734..341798,341839..342193)
FT                   /locus_tag="ANIA_08948"
FT                   /old_locus_tag="AN8948.4"
FT                   /note="transcript_id=CADANIAT00007913"
FT   CDS_pept        join(341446..341463,341734..341798,341839..342193)
FT                   /locus_tag="ANIA_08948"
FT                   /old_locus_tag="AN8948.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007913"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007913"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007913"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY2"
FT                   /protein_id="CBF84594.1"
FT                   /translation="MRIPAVLAEYRLDLPRARNQAPGLQRLRVRIAVIDPMCTWMYPTD
FT                   ITVHLGSTRLAVYYAPGVSLGRGFALGGMIADSGDLLGCVSASCAGGWFEVRIGEGEKL
FT                   VTLISKFKEEITNSRLNALRLYSNFHLALVGSPRMRLGNKS"
FT   gene            complement(342399..344386)
FT                   /locus_tag="ANIA_08947"
FT                   /old_locus_tag="AN8947.4"
FT                   /product="Putative exo-beta-1,3-glucanase (GH5-family);
FT                   member of the ScExg1-family (Eurofung)"
FT   mRNA            complement(join(342399..342482,342580..342614,
FT                   342677..343466,343506..343848,343884..344386))
FT                   /locus_tag="ANIA_08947"
FT                   /old_locus_tag="AN8947.4"
FT                   /note="transcript_id=CADANIAT00007914"
FT   CDS_pept        complement(join(342399..342482,342580..342614,
FT                   342677..343466,343506..343848,343884..344386))
FT                   /locus_tag="ANIA_08947"
FT                   /old_locus_tag="AN8947.4"
FT                   /product="Putative exo-beta-1,3-glucanase (GH5-family);
FT                   member of the ScExg1-family (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007914"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007914"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007914"
FT                   /db_xref="GOA:Q5ARY3"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY3"
FT                   /protein_id="CBF84596.1"
FT                   /translation="MHLDLAPVIAAASVGLATAGAVPRRAESIKTCADELWTGEVLHLS
FT                   LNIIERPIIVDVELQHNAVVTVDKTILIECTNAPARLYTTVYATTTSTITKTIYTATII
FT                   STTGLPAQTQAQSTTADVDTTHNGGVPTEVNTRSMTSVNPSSSNCFRHIRRPRRRPRRR
FT                   WLCGRHLHFRSPVTSTLYASGTNTAVTYTAVTPSSTPKSSHKFGDFTDWTTFKANGVNL
FT                   GGWLEQEKVFNQYWWNQYAPEAEDEWTFCETLGSECGPVLEERYANFVTTADIDRLAAV
FT                   GIKVPGSQLHSGNQKEYLRKIAVYAIERYNMRIIVGLHSLPGGVDSLDIGENVGNDGWF
FT                   FNSKNLAHSYQAVEENLSFFVQTGYPWAFTISSLNEASDNPTQSAPPKTLTANGTAWIV
FT                   KYTQGVLTRIAAVDKRFPLMLQDCFLSEEHWSPYFPPGTNLVVDQHVYYFAAPGVYSQW
FT                   VSGAICGQASILPGGGKFPVFVGEWALQKLYSNAFERRQELFEMQRYAWTKYVSDGAFW
FT                   NIKHNSSAVVDGQVTQRDNWSYERLLDAGGLLLLTLLNISKNETLLAATQYARPVQDGM
FT                   RDVFMTKC"
FT   gene            complement(347274..349291)
FT                   /locus_tag="ANIA_11152"
FT                   /old_locus_tag="AN11152.4"
FT                   /product="1,3-beta-glucanosyltransferase, putative
FT                   (AFU_orthologue; AFUA_8G02130)"
FT   mRNA            complement(join(347274..348161,348231..348995,
FT                   349039..349064,349111..349148,349193..349291))
FT                   /locus_tag="ANIA_11152"
FT                   /old_locus_tag="AN11152.4"
FT                   /note="transcript_id=CADANIAT00007915"
FT   CDS_pept        complement(join(347497..348161,348231..348995,
FT                   349039..349064,349111..349148,349193..349273))
FT                   /locus_tag="ANIA_11152"
FT                   /old_locus_tag="AN11152.4"
FT                   /product="1,3-beta-glucanosyltransferase, putative
FT                   (AFU_orthologue; AFUA_8G02130)"
FT                   /note="transcript_id=CADANIAT00007915"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007915"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007915"
FT                   /db_xref="GOA:C8VLB2"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLB2"
FT                   /protein_id="CBF84598.1"
FT                   /translation="MKFALAAAAASALFGQVMADVDPIIIKGSKFFYSSNNTQFYIRGV
FT                   AYQQDYTTNSTSSSDSSYKDPLADETACKRDIPILQDLNTNTIRVYAIDPTKNHTTCMN
FT                   MLADAGIYVIADLSDPSESIDRNDPRWETALYTRYTNVIDAMAGFSNTLGFFAGNEVSN
FT                   TVQTTDASAFVKAAVRDMKAYIKAQNYRSGLGVGYATNDDKSIRVQLADYFNCESEEDS
FT                   IDFWGYNIYSWCGDSTYTESGYKDRTEEFANYSVPVFFAEYGCNEVTPRKFTEIEALFG
FT                   DKMNGVWSGGIVYMYFQEANDYGLVSVVDSTSVSTMADYKYYSSQINAVSPSGTNKASY
FT                   TPTNTALQSCPAVTSGSWLAKATPLPPTPNTDLCSCMDKTNACVVDSSVDSDDYADLFS
FT                   IVCGLTECAGVSANGTTGSYGAYGMCQSKQQLNWALNKYYSEQGSVASACDFDGSATTT
FT                   ATTAATGSCSSMMSQAGTDGTGTVTATATGSGSSATETESSGANALNVGVSAGAGGFVV
FT                   AVLGYLL"
FT   gene            complement(349713..349936)
FT                   /locus_tag="ANIA_11155"
FT                   /old_locus_tag="AN11155.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(349713..349801,349846..349936))
FT                   /locus_tag="ANIA_11155"
FT                   /old_locus_tag="AN11155.4"
FT                   /note="transcript_id=CADANIAT00007916"
FT   CDS_pept        complement(join(349713..349801,349846..349936))
FT                   /locus_tag="ANIA_11155"
FT                   /old_locus_tag="AN11155.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007916"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007916"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007916"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLB3"
FT                   /protein_id="CBF84600.1"
FT                   /translation="MPRSLASSSSSQSDKTKTSQTSLSGKSDELAPGEAPVSLSGMQHL
FT                   DRHGKVISTFSIEY"
FT   gene            353307..354924
FT                   /locus_tag="ANIA_08945"
FT                   /old_locus_tag="AN8945.4"
FT                   /product="methyltransferase LaeA-like, putative
FT                   (AFU_orthologue; AFUA_8G01930)"
FT   mRNA            join(353307..353485,353544..353578,353644..353701,
FT                   353797..353841,353900..353935,353996..354114,
FT                   354175..354200,354253..354283,354336..354924)
FT                   /locus_tag="ANIA_08945"
FT                   /old_locus_tag="AN8945.4"
FT                   /note="transcript_id=CADANIAT00007917"
FT   CDS_pept        join(353432..353485,353544..353578,353644..353701,
FT                   353797..353841,353900..353935,353996..354114,
FT                   354175..354200,354253..354283,354336..354924)
FT                   /locus_tag="ANIA_08945"
FT                   /old_locus_tag="AN8945.4"
FT                   /product="methyltransferase LaeA-like, putative
FT                   (AFU_orthologue; AFUA_8G01930)"
FT                   /note="transcript_id=CADANIAT00007917"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007917"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007917"
FT                   /db_xref="GOA:C8VLB4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLB4"
FT                   /protein_id="CBF84602.1"
FT                   /translation="MADTEHGEFEPQQLIEPDTFDDQDSTYQSSLGDASYTTSITSSAM
FT                   NYTYNGRRYHSYHEGEYVLPNDEQEQDRLDLSHHIYRMLLKGELHRAPVKNPARVLDIG
FT                   TGTGIWAIDFADEHPETEVIGNDLSPIQPSWVPPNCRFEVDDFEQIWSYSQPFDFIHGR
FT                   ELEGAIRDHDHVFSEAFKSLKPGGWFEISSFDVNSYSDDGTHLRAKCMQEVVKNLHLSS
FT                   KKFGKDMNTTHTWRERLEKAGFINVTEEMYKLPQSPWAKDPKMKELGRYHQVNMFEAIP
FT                   PYCYALFTRVLGWQRPEIEALVAGIRQELKDMSLHLYTKVHVVYGQKPE"
FT   gene            complement(355631..357277)
FT                   /locus_tag="ANIA_08944"
FT                   /old_locus_tag="AN8944.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(355631..355772,356092..356250,
FT                   356322..356407,356580..356775,356834..357011,
FT                   357124..357277))
FT                   /locus_tag="ANIA_08944"
FT                   /old_locus_tag="AN8944.4"
FT                   /note="transcript_id=CADANIAT00007918"
FT   CDS_pept        complement(join(355631..355772,356092..356250,
FT                   356322..356407,356580..356775,356834..357011,
FT                   357124..357277))
FT                   /locus_tag="ANIA_08944"
FT                   /old_locus_tag="AN8944.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007918"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007918"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007918"
FT                   /db_xref="GOA:Q5ARY6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY6"
FT                   /protein_id="CBF84604.1"
FT                   /translation="MPTYPHSRTTETPQIACQAHYGLIGSVAQALNHYTVRPRCKEIVS
FT                   FNHTFPADLGDGSSPFDARNIDNAGDAEIRKHQACPHRRLFRLLEACGEWQPRFGSKVQ
FT                   STHGMSEAGFFAVPDPNEPVQDANMGIFVPNVEAKFLDESSDVLSLNEEGVYICTPFVR
FT                   KGYLDEPTHTAQAARPVTRSEIETAVSRHPGVRDVAVIPVVLPGSECPAPRAYIVKTYG
FT                   SSLLIEELISCMATKYLPRMQLTGGAAFVDAIEQIWVHGWGHRIEVQIPSLLQIEASII
FT                   PIVVIGVFYVRSERRCWCGLSEI"
FT   gene            complement(359037..360609)
FT                   /locus_tag="ANIA_08943"
FT                   /old_locus_tag="AN8943.4"
FT                   /product="integral membrane protein, putative
FT                   (AFU_orthologue; AFUA_6G11560)"
FT   mRNA            complement(join(359037..359575,359637..359701,
FT                   359770..360167,360248..360352,360408..360609))
FT                   /locus_tag="ANIA_08943"
FT                   /old_locus_tag="AN8943.4"
FT                   /note="transcript_id=CADANIAT00007919"
FT   CDS_pept        complement(join(359067..359575,359637..359701,
FT                   359770..360167,360248..360352,360408..360584))
FT                   /locus_tag="ANIA_08943"
FT                   /old_locus_tag="AN8943.4"
FT                   /product="integral membrane protein, putative
FT                   (AFU_orthologue; AFUA_6G11560)"
FT                   /note="transcript_id=CADANIAT00007919"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007919"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007919"
FT                   /db_xref="GOA:Q5ARY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY7"
FT                   /protein_id="CBF84606.1"
FT                   /translation="MSSGLNSDDSDGHVRELAVRSVAASFLSIATIAVSLRCYVRGWLI
FT                   KGFGWDDWAMVVAMAFYIMFSACMIGGSIYGTGHRFAALEPQNRVTAMRYWWLCEIAYC
FT                   FSSVGCKISVCIFLMRITIKRIHIWILYIVMALTVLTGLVFMFIMLLQCKPLEYFWTRT
FT                   AFDPDVKGYCIDIQIVIAMTYVYSAFAALCDFTVGTLPIFLVSKLQMRKKTKLAVVGIL
FT                   SMACIASSAVIVRIPFVKTFADPDFLYATIEIAIWSNIEIGLGITAGSLATLRPLLRHW
FT                   MGSTNDPSYPLGTPSPFPGRSGSRLPGASGRDRAYPLGSMDDSNRLRPDKLALTVTTVQ
FT                   TQHDPEDRWPVLPDGNSSEERLTNEHQRNGKGNGNRTPTRSSAERNVMGSGFGGIHQVI
FT                   EVTQTSTDLRSTSVKEHV"
FT   gene            364679..365533
FT                   /locus_tag="ANIA_08942"
FT                   /old_locus_tag="AN8942.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(364679..365405,365445..365533)
FT                   /locus_tag="ANIA_08942"
FT                   /old_locus_tag="AN8942.4"
FT                   /note="transcript_id=CADANIAT00007920"
FT   CDS_pept        join(364679..365405,365445..365533)
FT                   /locus_tag="ANIA_08942"
FT                   /old_locus_tag="AN8942.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007920"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007920"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007920"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY8"
FT                   /protein_id="CBF84608.1"
FT                   /translation="MATPPASITFYDIAMRTPSLSCSPNPSKTRLALNFASVPYKTTFV
FT                   PLPSIPSVRQSLGVPAGRQFADGSDFYTLPVIVDEVTGSKIGDSFDIAIYLHERYADAN
FT                   GGKGELFPILKNGEKLDFRTPNTAMLVPLSAMSEVARQDKYLEYATFNTHVDAAFTLHV
FT                   LLTVHGLPFPPDTAEATRAEFCKRAGVPSWDAFTVSGEAREKLKESLKETLAELAKLFV
FT                   RNEDGPFILGGKPCYADFIVDEWEEVRGWHGGVFGRVFDALSVYMEVKE"
FT   gene            complement(367224..370103)
FT                   /locus_tag="ANIA_08941"
FT                   /old_locus_tag="AN8941.4"
FT                   /product="P-type ATPase, putative (Eurofung)"
FT   mRNA            complement(join(367224..367742,367869..368081,
FT                   368198..368557,368610..368850,368907..368977,
FT                   369040..369176,369223..369454,369553..369758,
FT                   370049..370103))
FT                   /locus_tag="ANIA_08941"
FT                   /old_locus_tag="AN8941.4"
FT                   /note="transcript_id=CADANIAT00007921"
FT   CDS_pept        complement(join(367224..367742,367869..368081,
FT                   368198..368557,368610..368850,368907..368977,
FT                   369040..369176,369223..369454,369553..369758,
FT                   370049..370103))
FT                   /locus_tag="ANIA_08941"
FT                   /old_locus_tag="AN8941.4"
FT                   /product="P-type ATPase, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007921"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007921"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007921"
FT                   /db_xref="GOA:Q5ARY9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY9"
FT                   /protein_id="CBF84609.1"
FT                   /translation="MEHDDRKTRIRIEEEGIHRLAELDYHLLSVDDLQHRFSTSAKGLQ
FT                   NEQIPQLISKYGKTSHLLHHQDYSKQLWVTFSEDSAVSFLEVAAFNGWQDWSSSQVRVS
FT                   NTTTLPDQCIAIGNGNRNSLSAADLVPGDIIQVKKGNKLPADVRFIQVSADAKFDRSIL
FT                   SGESEPVPGTVDSTNNNFLETNNIGLQGTYCVSGAALGLVVGTGDQTEILRFVLIIVGF
FT                   VVAFVLIIVIVWAVYLHKNHPDFINVPTLIVSCVSVGIAFIPEGLPIAISLGLHIAAGI
FT                   MKKNKILCKSLTTVETLGAVSVICSDKTGTLTKNEMYVTDCFSGGEEYPSEQESERMIH
FT                   GRNPGELPNKSISLICTVGGLCNAAVFDTTTLGRPIHAVKIFGDPTDQAILRLAQTLGP
FT                   VQSFILSGRSCLRYLSTASTSTWPVFHIYQPTRSGNWQSVMLFLSDRDTIENIRDRLSA
FT                   QGKRVILLAQNSIPSAWTNQALDERVVLQATTDSLTFVGLVALVDPPQIGCRYWLILLG
FT                   HRRLQLTAQAIAVQCGIIRTPPELIHDIKLLDHYNSAAVRTFDAIVVSGPGLAVLLNED
FT                   WDKLCTYDEIVSARTSPEQKLCIVKEFQARNNNVAMTGDGVNDAPSLKAADVGVALGSG
FT                   SDIAIEAADIVLLDSFAAIVEAVKYGRLVYGNVSSILTESSY"
FT   gene            371651..373759
FT                   /locus_tag="ANIA_08940"
FT                   /old_locus_tag="AN8940.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            371651..373759
FT                   /locus_tag="ANIA_08940"
FT                   /old_locus_tag="AN8940.4"
FT                   /note="transcript_id=CADANIAT00007922"
FT   CDS_pept        371651..373759
FT                   /locus_tag="ANIA_08940"
FT                   /old_locus_tag="AN8940.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007922"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007922"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007922"
FT                   /db_xref="GOA:Q5ARZ0"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ0"
FT                   /protein_id="CBF84611.1"
FT                   /translation="MANQESSTLVGCLFDVSGSMRKLLKTGQPDGRAVDRFHAVLGAAL
FT                   DIARKEQQSDPRAKMFVGAFGLDRQDGYPPTVDLCGIVEALLEENDQDDRSGHDSLIEI
FT                   ANQNNLAHITEYIRNKLTDSVARIVHACLRRCPERIHEFKDAIPSAAEIRKSQTMKNGA
FT                   TFGGGAVAIGVGSLVCGPLGGLLGAALTAGGAMSADAYADEVVDSSEGLMLARRICREW
FT                   FRDFADFIPRPVSDVVRLLQLLQQRSTRARQWLSVEEFVYGDTPMREALSRSLSVFQAN
FT                   SDCDQRVLVLMSDGHATDGDPGEIATELHSEGVAVASVYLTSDTDIAQRRLYDKPAYSW
FT                   DKGQRTLFNIASKVSASNHPIPVLMSVGWQIPCSGEVALYVCVCTEPAVEEFCSLLVSA
FT                   HLASTDALLDVIGRLQLDDYIQDELAITCKNPSDQGSSATCYAHAIAAVIHMALLRIER
FT                   KEPCPTIKEIRDRILHEFPPGDHGRVAEEVLNQAVQWYRLRYRAVDEMRARQAVLQRRP
FT                   VLTTFRLSEKGWAKFSQYFSQPQTRRSMLTEANMRPYRQGPDGGGHAVVLYACDPRSLS
FT                   FLNSWGSDWGTNGGFRVQSPAVLEIDEPDCLSPVHFYDVFWYESDLTPSERAAYDAKAE
FT                   EKLRAYTTYHPSLLELEAMCPLCQRISLISDFTGNAREAKCPRCLFSFVPQPGSLLQVL
FT                   YARAGLGT"
FT   gene            375270..376475
FT                   /locus_tag="ANIA_08939"
FT                   /old_locus_tag="AN8939.4"
FT                   /product="PHD finger protein (AFU_orthologue;
FT                   AFUA_6G13765)"
FT   mRNA            join(375270..375462,375543..376475)
FT                   /locus_tag="ANIA_08939"
FT                   /old_locus_tag="AN8939.4"
FT                   /note="transcript_id=CADANIAT00007923"
FT   CDS_pept        join(375270..375462,375543..376420)
FT                   /locus_tag="ANIA_08939"
FT                   /old_locus_tag="AN8939.4"
FT                   /product="PHD finger protein (AFU_orthologue;
FT                   AFUA_6G13765)"
FT                   /note="transcript_id=CADANIAT00007923"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007923"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007923"
FT                   /db_xref="GOA:Q5ARZ1"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ1"
FT                   /protein_id="CBF84613.1"
FT                   /translation="MPSRKGQPRTLAKATGAERRQRTRRSLPVIPATPQAEPETWERTV
FT                   AEIAQEPMDLHVKKYREWKRNGSPHDTACRVCGATGNSDLKPGRLINCHTCRVAFHFIC
FT                   VPDGSEWATREGLYCPICVKRGWDMSPPGLSPPTSPVPAPAPIERPKGVAPIESAVTAA
FT                   VPREGPNTDSTNGPKPPQAASEGASFGNSSERIPQSPAVTARAESMRHDEDNNSDPEAP
FT                   QPKRQRTSRFVTLPSDVDASLGVIYRELESVASLKLQIQELQYKDRQSAQMIKLRDNSI
FT                   AILRRDLEKYRADDSELARLRDSAARFDQVKREMEELKRKNEMLGAELRKSREETATAQ
FT                   SLVNDWKGKLAQLLNA"
FT   gene            377249..379271
FT                   /locus_tag="ANIA_08938"
FT                   /old_locus_tag="AN8938.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(377249..377346,377410..379079,379135..379271)
FT                   /locus_tag="ANIA_08938"
FT                   /old_locus_tag="AN8938.4"
FT                   /note="transcript_id=CADANIAT00007924"
FT   CDS_pept        join(377249..377346,377410..379079,379135..379271)
FT                   /locus_tag="ANIA_08938"
FT                   /old_locus_tag="AN8938.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007924"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007924"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007924"
FT                   /db_xref="GOA:Q5ARZ2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ2"
FT                   /protein_id="CBF84615.1"
FT                   /translation="MDAKKSRKSTNGSNARPRVRPSRGRGLRTSTGCLTCRERRVKCDD
FT                   GKPTCARCTKAGRVCRYRQPQTPGLAGSGVTGQRRVEQPRVEAAPTPAAAPTPYFQVQL
FT                   NGHDDGVDRGNLSDQGLSVTSLEAQTLPFTLGEISTPFEWYDLLARDAISNIQRLGEPR
FT                   NFPQITLSRRQSPAPECIEPPLGVLEYQSEPWNSNYRIELSAVDLIFFRYYIEIVGPIL
FT                   DLFDPARHFTNVVPHLGLRNTGLLKSILAVGAKHMSLGYAHTQGDDVTTGVNASSPASL
FT                   AGVANAASAPAPAHMATHYYYETLQYLSQTLLYPSYADSRELLATSTMISTYEMFDADA
FT                   DSDSTSSGDWERHLRGSFWIQRSQDNDGESVDGLRRAVWWAWLRQDLWAAFRAGRPTLT
FT                   IWRAKKKLEELDSDELATRIIYICAKCVEYAASGKAPNQDQDPRARIEQGDRLLSALED
FT                   WHRVLPASFQPVAVAAMDSASGNVRASSMMPSTSPADWTSWAGDRTGMQEPTTSFFPPI
FT                   WIHPPNHAGAMQMYHFAKAVVLLNQPTMGGLNAYVERQKQLSESVQMVCRIANACQEHE
FT                   SAIAFVNVQALFGVGQFVQSPPMQVELLRILENMLRISKIPANGLVAELKRVWQEASG"
FT   gene            complement(379530..380160)
FT                   /locus_tag="ANIA_08937"
FT                   /old_locus_tag="AN8937.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(379530..379554,379593..379636,
FT                   379666..380160))
FT                   /locus_tag="ANIA_08937"
FT                   /old_locus_tag="AN8937.4"
FT                   /note="transcript_id=CADANIAT00007925"
FT   CDS_pept        complement(join(379530..379554,379593..379636,
FT                   379666..380160))
FT                   /locus_tag="ANIA_08937"
FT                   /old_locus_tag="AN8937.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007925"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007925"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007925"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ3"
FT                   /protein_id="CBF84617.1"
FT                   /translation="MPQENGTNNGTPAFLSTQPGPNHDWRITLKDKVIVITGANRGIGL
FT                   AIAEVCLANEAAAVYSLDLFEPGEEFTAVQKKSANPSRLQYIHCDVTSEESISSAIDAV
FT                   VSASGAVHGFVANAGMTKHQPALDFTRAEIDKLFNLNVFGAYFCATAVARKFIELGIKG
FT                   SITQPRSAERTLWRYEGGRTMVFA"
FT   gene            380593..382323
FT                   /locus_tag="ANIA_08936"
FT                   /old_locus_tag="AN8936.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(380593..380851,380897..381480,381526..381615,
FT                   381685..382104,382279..382323)
FT                   /locus_tag="ANIA_08936"
FT                   /old_locus_tag="AN8936.4"
FT                   /note="transcript_id=CADANIAT00007926"
FT   CDS_pept        join(380593..380851,380897..381480,381526..381615,
FT                   381685..382104,382279..382323)
FT                   /locus_tag="ANIA_08936"
FT                   /old_locus_tag="AN8936.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007926"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007926"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007926"
FT                   /db_xref="GOA:Q5ARZ4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ4"
FT                   /protein_id="CBF84619.1"
FT                   /translation="MDAKDLDEYHNGESNHIEASQEIFWTEEEEEKLVRKIDLFLLPNI
FT                   WIMYLLSYMDRTNIGNAKVAGMSDDLGLTSSQYSIVLVVFFIGYVVFEPPSNMILVRSR
FT                   PSLYLPAIMCLWGILTCVMSVVQHYHHLIVLRVFIGIVEAGFAPGILLIISSWYKRKEQ
FT                   SRRFAVFISAAILSGAFGGLIAGGITDGLEGVHGIRGWRWLFIVEGAATAGWAIISKFL
FT                   LLDYPGTSKRLTEREKAIAAARLQEGVIARGADERIGKLQGFCMACKDWRTWGFTIGYM
FT                   VIVGSSTLTYFYPTLVSGLGYTGRMAQYMTVPIYAVAFACTMITSVISDKLPTYRGLII
FT                   ASWLTVSMVTSIIVCAVYDFTTRYALLVIMAAGLWVSNATSLSFASSSFGSMDPEVRAQ
FT                   SLALMNALGNLAQIYGAYLFPSDDEPKYLMGFGVISGMLGVGVATYILMFALCRETVFA
FT                   ISDYLVR"
FT   gene            complement(383271..385680)
FT                   /locus_tag="ANIA_08935"
FT                   /old_locus_tag="AN8935.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(383271..384292,384362..384712,
FT                   384765..385247,385315..385424,385487..385680))
FT                   /locus_tag="ANIA_08935"
FT                   /old_locus_tag="AN8935.4"
FT                   /note="transcript_id=CADANIAT00007927"
FT   CDS_pept        complement(join(383271..384292,384362..384712,
FT                   384765..385247,385315..385424,385487..385680))
FT                   /locus_tag="ANIA_08935"
FT                   /old_locus_tag="AN8935.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007927"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007927"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007927"
FT                   /db_xref="GOA:Q5ARZ5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ5"
FT                   /protein_id="CBF84621.1"
FT                   /translation="MAPGLELLPKTTALPTKAANAINNAVYGRDSDVKFESAEKHQRVL
FT                   NVFRAFIADLVQQYGDGHPGAPMGMAAIGIALWKYVMKYSPTNCNYFNRDRFVLSNGHA
FT                   CLWQYLFMHLVGVKSMTLEQLKSYHSTDSSSLCPGHPEIENEGVEVTTGPLGQGVANAV
FT                   GLAMATKNLAATYNKPGYEVVNNMTWCMVGDACLQEGVGLEALSLAGHWRLNNLCVIFD
FT                   NNNVTCDGTADVANTEDINTKMRATGFKVIDVYDGDSDVVAITNALLAARSSTKPTFIN
FT                   IRTTIGVGSKQAGTADAHGAALGVDEVAKIKRAFGLNPEEHFHIPQDVYDFFSDLPSRG
FT                   KTHEAEWHAAVAAYREAEPVLASEFDLRVAGKMPADWTKYKLGQNVKNFLVGTADLTPS
FT                   VNVAYKNKVDFQSPDLKTACGMSGNYAGRYIHYGIREHAMCAISNGLAAFNKGTFIPIT
FT                   STYLVFHLYAAAAVRMAALQGLHQIHIATHDSIGVGENGPTHQPIAVPALYRAMPNILF
FT                   IRPCDAEETVGAYIAAIQHDTTPSVLALSRQNLTQYPAHSSREGVQKGAYVFVEEENFD
FT                   VTLLSVGSEMAYTMAAREILAAEHGIKARVVSFPCARLFELQSREYKHSVLKPRAGKPA
FT                   VAIEAYPSVGWERYADAAIAQNQFGKSLPCKEVYEHFGFSGKIIADKVKGLVDEVRRDG
FT                   VEVLRGDFRDLNGGPSVGVEHPNVP"
FT   gene            387229..388527
FT                   /locus_tag="ANIA_08934"
FT                   /old_locus_tag="AN8934.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            387229..388527
FT                   /locus_tag="ANIA_08934"
FT                   /old_locus_tag="AN8934.4"
FT                   /note="transcript_id=CADANIAT00007928"
FT   CDS_pept        387229..388527
FT                   /locus_tag="ANIA_08934"
FT                   /old_locus_tag="AN8934.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007928"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007928"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007928"
FT                   /db_xref="GOA:Q5ARZ6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ6"
FT                   /protein_id="CBF84623.1"
FT                   /translation="MDSAEKDLEGGSSSFCIDQSTTTTSPVSEKSVPPPPDHGLRAWLQ
FT                   VLCMHLVFLNTWGVSNGFSIFNQLYTKTLPESSSTISWIGSIQISLLFFFGVFAGRATD
FT                   AGYFRLMYMAGAFFQVFGFFMLSLCKDYWQIFLAQGICMGISNGLTFGPGLAVTSSYFS
FT                   RNRGLAVGIAAAGATTGGMIYPVLIHQLLDIHSLSFGWTVRIAAFVMLITQISGLLFFH
FT                   PRLPPRPSGPFLDSAAFKEKPFVFFALSMFLNLWGLYFAFFYMGTFARDRLAVRDTQNF
FT                   ILIQNGVGVLGRILPTRLADRVTGKFNILIPLNFTAAVVVYAWIAVHTVAGLYVFTVIY
FT                   GLAGGAAQSLFPATATTMITDVRKTGTRIGMILSFVGIATLTGPAIDGALIQAMQGEYT
FT                   GAQVFSGTCIVLRAGSALAARVAKTGWKLRVVV"
FT   gene            389081..390627
FT                   /locus_tag="ANIA_08933"
FT                   /old_locus_tag="AN8933.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(389081..389919,390104..390153,390240..390364,
FT                   390520..390627)
FT                   /locus_tag="ANIA_08933"
FT                   /old_locus_tag="AN8933.4"
FT                   /note="transcript_id=CADANIAT00007929"
FT   CDS_pept        join(389081..389919,390104..390153,390240..390364,
FT                   390520..390627)
FT                   /locus_tag="ANIA_08933"
FT                   /old_locus_tag="AN8933.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007929"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007929"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007929"
FT                   /db_xref="GOA:Q5ARZ7"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ7"
FT                   /protein_id="CBF84624.1"
FT                   /translation="MPSNLPLDIARTLAEHISVEPVGPETFQARFNPERQGNTASYSYG
FT                   GCALGVGVQAACQTAPDGYNLYSVTGSFLAPVLTDSKITCSVRRLRDTRTFATRQVEIS
FT                   QVQNATTRLCVIMLADFHKKEKDSLLEYSSPPDHIYSKPESCLTPQETGQKKVEQGTIS
FT                   IESLSLYNTLFGLIARFFEARQAPEGISAHNLHGMVKEQPQPPHQARLPLTAKTSADWF
FT                   RCRTPLSAKSDHYAGLAWMLDAYLTFTPLAHSGMFLDDAAACATLDFAIRFFCDEFDLI
FT                   TVRVYLLPDRALNRTEYIGDLCLMVYRSNRVSNLRATFGGYMRGDRHTPKASPVEQKND
FT                   PGAEVQGIPETYENALAYYAAAIEIRYSSHAIL"
FT   gene            complement(391147..392405)
FT                   /locus_tag="ANIA_08932"
FT                   /old_locus_tag="AN8932.4"
FT                   /product="TIM-barrel enzyme family protein (AFU_orthologue;
FT                   AFUA_1G10110)"
FT   mRNA            complement(join(391147..392218,392274..392405))
FT                   /locus_tag="ANIA_08932"
FT                   /old_locus_tag="AN8932.4"
FT                   /note="transcript_id=CADANIAT00007930"
FT   CDS_pept        complement(join(391467..392218,392274..392361))
FT                   /locus_tag="ANIA_08932"
FT                   /old_locus_tag="AN8932.4"
FT                   /product="TIM-barrel enzyme family protein (AFU_orthologue;
FT                   AFUA_1G10110)"
FT                   /note="transcript_id=CADANIAT00007930"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007930"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007930"
FT                   /db_xref="GOA:C8VLH6"
FT                   /db_xref="InterPro:IPR009215"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLH6"
FT                   /protein_id="CBF84626.1"
FT                   /translation="MAPPTSRPEILSRLRAQIQAGKPIVGAGAGIGLSAKSVEAGGGDL
FT                   IIIYNSGRFRMAGHGSLAGLMPYSNANEVVVEMASEVLPVVKHTPVIAGVCGTDPLRDI
FT                   PRFLSQLKGMGFAGVQNFPTVGLIDGQFRANLEETGMGYDKEVEMVRAASELGLLTTPY
FT                   VFNVGEAEAMAKAGADILVAHMGLTTSGTIGAKTGKTLEQCVDEIQAIRDVAVKINPDV
FT                   ILLCHGGPIARPEDARFILGRVAGLHGFYGASSMERLPVEVAIKDTTAEFKKIALRH"
FT   gene            392626..393954
FT                   /locus_tag="ANIA_08931"
FT                   /old_locus_tag="AN8931.4"
FT                   /product="UPF0261 domain protein (AFU_orthologue;
FT                   AFUA_1G10120)"
FT   mRNA            392626..393954
FT                   /locus_tag="ANIA_08931"
FT                   /old_locus_tag="AN8931.4"
FT                   /note="transcript_id=CADANIAT00007931"
FT   CDS_pept        392626..393954
FT                   /locus_tag="ANIA_08931"
FT                   /old_locus_tag="AN8931.4"
FT                   /product="UPF0261 domain protein (AFU_orthologue;
FT                   AFUA_1G10120)"
FT                   /note="transcript_id=CADANIAT00007931"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007931"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007931"
FT                   /db_xref="GOA:Q5ARZ9"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ9"
FT                   /protein_id="CBF84628.1"
FT                   /translation="MHLILLGTLDTKRSEVLYLHSQLHQTASRLNTPLSITLIDCGVRS
FT                   EIDSDPAITVSHTDLITKYPYASDLDSPSPTKDLFVLPRGEAISIITACATKCVSELLQ
FT                   TQDVHGIIGVGGSGGTSLISAVMRSAAKIGLPKLIVSTVASGNTGPIVGETDLTLMYSV
FT                   VDIAGSNRLLKDVLENAAGAMVGMASAYKARLEASISATPAQSEKSRLRVGVTMFGVTT
FT                   PCVDTIRSHLETNYAVEVYVFHATGHGGKAMERLVEEGHLDAMLDLTTTEICDLIAGGE
FT                   MACDRRRLETSLKKGIPTIISVGATDMVNFGPIETVPPKYQGRKLFVHNPSVTLMRTSR
FT                   EECEAVGRFIVEKVNGCVREGKAGLVEVVIPKGGVSKISTTGGVFEDKQADEALANVLM
FT                   VGLEGKVRVVQDPRDVNDRGFAVDIAERLMTLVAAAGEKREKV"
FT   gene            complement(394213..396750)
FT                   /locus_tag="ANIA_08930"
FT                   /old_locus_tag="AN8930.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(394213..394217,394263..395581,
FT                   395627..396567,396637..396750))
FT                   /locus_tag="ANIA_08930"
FT                   /old_locus_tag="AN8930.4"
FT                   /note="transcript_id=CADANIAT00007932"
FT   CDS_pept        complement(join(394213..394217,394263..395581,
FT                   395627..396567,396637..396750))
FT                   /locus_tag="ANIA_08930"
FT                   /old_locus_tag="AN8930.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007932"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007932"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007932"
FT                   /db_xref="GOA:Q5AS00"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS00"
FT                   /protein_id="CBF84630.1"
FT                   /translation="MSFRFVAPIHPREPSSSALPKRTKRSAACTACKARRSRCGGGFPC
FT                   DRCLESGSECVFAGLDRRRKCAQRRMEQELDTVQRQLDEIVEAFDNRDYEKLGKIIDRV
FT                   KELRAGYGEGRRDQEITGNRATSDGLQSDPRALGDTRRCSSPSSSSPSSVGSLDEVDTL
FT                   TEDPNRTEESRAAGYIGKESEIAWMQKLETEACKMEGGQDKMTEESIASMSYHVDNLYL
FT                   TDPAPVDPRLLPPQPWAESLVKIYFGSIAPSFPLLNRTLFMSQFEAAYSGSAYPTSKWL
FT                   AVLNLVFAISAKYYQLAEPVAGRDVDDRIFLSRALSLRSPHHLVLDHADLHQVQIDLLL
FT                   AIYYLASGQVNRSWRVNGSAARSALCLGLNLRAFSEHIDPVSKETRTRIWWAIFSLEHL
FT                   LSSMTGRVPCLDHRAMSLYPPVPYDEDDFDHPELKTILGMTEQREKRLHYTIYATNEEL
FT                   AKLTAWLRSIEPNGSLFFFHLVDLSIITHAAVMAIYSLQSTRESHSGLGQSEIPRYQSM
FT                   LQSWVSNLHPAFAFTDKDMEPSLSRDSRAQVSLALSYYSSQIILSRPCLTRPDLKEGTN
FT                   IRFPRSRFGNNTARTCIHSALSLISVLPDEPDTTWMLKKSPWWCILHYIMQALTVLLIQ
FT                   ISVGFVPDDVGKGRKKKGHEAEESNQDRSEGIAPEAVWNASKKALRWLHFMADLDPSWH
FT                   RAHEISEGFLRRIAKAKDLNMDFLPGIRQESQMSGFDYRGPGHEMGGGGSARKQSSSSG
FT                   LLHEEPMNWGPDCTMSEGDYGQEHQQHPFVLDPTLFSVV"
FT   gene            397530..398938
FT                   /locus_tag="ANIA_11151"
FT                   /old_locus_tag="AN11151.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(397530..398256,398328..398938)
FT                   /locus_tag="ANIA_11151"
FT                   /old_locus_tag="AN11151.4"
FT                   /note="transcript_id=CADANIAT00007933"
FT   CDS_pept        join(397530..398256,398328..398938)
FT                   /locus_tag="ANIA_11151"
FT                   /old_locus_tag="AN11151.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007933"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007933"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007933"
FT                   /db_xref="GOA:C8VLH9"
FT                   /db_xref="InterPro:IPR012901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLH9"
FT                   /protein_id="CBF84632.1"
FT                   /translation="MIFLWLLLLAYRVTAKLFEAPNPWEEASQVIVSNVTLDSNPVSNS
FT                   SVPSIDHNTRQNTEYVRLQSRLDRTSGTWGASHPRHRLLMALYGFSRYKERSSAEVKRW
FT                   RDLYKHVPKSQKQLVERVIGYTRKLNTVEHLYDHNDVLAGDIVRFGMEFYGIEQTELDV
FT                   FIQDMEKEKKGADRTSVVQAMKHFVRDWSDEGLFEREGAFRCILDSISGIERGGEERPV
FT                   SVLVPGAGAGRLGYEIDALGGFEVTINEWSAYMNLIHRYVVQINAPESLVYHPYIDWWS
FT                   HHATTSDMQRGVSFPDSIPRPSSKASIVMIEGDFTTIFEDADSSTYDIIVTLFFIDTAR
FT                   NLLNYLETIYRLLKPGGRWINLGPLLYGTGPWLQLSLDEIVKLSEALGFEFEVDVSDQA
FT                   GIVCGTLTQGEGLGGKVRSMYVPYGQNKRGLSRNAYDAQFWRARKR"
FT   gene            399381..401163
FT                   /locus_tag="ANIA_11153"
FT                   /old_locus_tag="AN11153.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(399381..399557,399620..399728,399789..399938,
FT                   399994..400670,400732..400883,400965..401163)
FT                   /locus_tag="ANIA_11153"
FT                   /old_locus_tag="AN11153.4"
FT                   /note="transcript_id=CADANIAT00007934"
FT   CDS_pept        join(399381..399557,399620..399728,399789..399938,
FT                   399994..400670,400732..400883,400965..401163)
FT                   /locus_tag="ANIA_11153"
FT                   /old_locus_tag="AN11153.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007934"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007934"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007934"
FT                   /db_xref="GOA:C8VLI0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLI0"
FT                   /protein_id="CBF84634.1"
FT                   /translation="MDSKEQDNNLNHDNPTLNDIFEEHEPTSDTSLLRRIDVRILPIMF
FT                   LAYFLQFLDKVCLNYANVMGIQDELSMSGNDFSWLATAFFIAYAVAEVPQGYLLQKYPV
FT                   TKVLAANIFIWGVMLCCSAAVQNYAGLLALRVLLGTAEAVIAPALTIYTSMWYTPAEAS
FT                   PRFGLWYCGLGTGQILGGLISFGAQHASSSQSFSGWRIMFLVIGFANIAVSLLVLVVLP
FT                   VSPETASFLSPDAKTRIFHRLKSAVTGGLGNKTFHAPSVLTTLGDPQTWLLCLLTILVT
FT                   IPSGLIVTFSSILIKGFGYTSKESALLNMPSGVVSILSILLSTYAVAKGYSRWLAIDLL
FT                   LVPTLLGSCLMSFLPKSNQAGLLVGIYMVNTTVAPLILIFAWTGANFKGYTGKVTGCAF
FT                   ISAAFSIANIIGPQTFQARDAPEYLPAKVTIVVANAAAIAVSTALRLLYGSRNREAERL
FT                   GALVSAKSWMEKRVVRQVEEEETGFRYIY"
FT   gene            401520..402135
FT                   /locus_tag="ANIA_11154"
FT                   /old_locus_tag="AN11154.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(401520..401841,401924..402135)
FT                   /locus_tag="ANIA_11154"
FT                   /old_locus_tag="AN11154.4"
FT                   /note="transcript_id=CADANIAT00007935"
FT   CDS_pept        join(401558..401841,401924..401978)
FT                   /locus_tag="ANIA_11154"
FT                   /old_locus_tag="AN11154.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007935"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007935"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007935"
FT                   /db_xref="GOA:C8VLI1"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLI1"
FT                   /protein_id="CBF84636.1"
FT                   /translation="MAALQKFKLVFHVPPSSLEPVQKAIFAAGAGRYPGPGNYTECCWV
FT                   TSGTGQFRPGDAANPAIGKVGELEKIEELRVETLCVGVDVARKAVEALKKAHPYEEPSY
FT                   GVIRLEDF"
FT   gene            405122..409760
FT                   /locus_tag="ANIA_08928"
FT                   /old_locus_tag="AN8928.4"
FT                   /product="ATP-binding cassette multidrug transporter
FT                   [Source:UniProtKB/TrEMBL;Acc:P78576]"
FT   mRNA            join(405122..405722,405788..405846,405908..408243,
FT                   408299..408953,409011..409760)
FT                   /locus_tag="ANIA_08928"
FT                   /old_locus_tag="AN8928.4"
FT                   /note="transcript_id=CADANIAT00007936"
FT   CDS_pept        join(405122..405722,405788..405846,405908..408243,
FT                   408299..408953,409011..409760)
FT                   /locus_tag="ANIA_08928"
FT                   /old_locus_tag="AN8928.4"
FT                   /product="ATP-binding cassette multidrug transporter
FT                   [Source:UniProtKB/TrEMBL;Acc:P78576]"
FT                   /note="transcript_id=CADANIAT00007936"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007936"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007936"
FT                   /db_xref="GOA:Q5AS02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029481"
FT                   /db_xref="InterPro:IPR034001"
FT                   /db_xref="InterPro:IPR034003"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS02"
FT                   /protein_id="CBF84638.1"
FT                   /translation="MGVPDELPPGSSETDTIVSSSQPTNRSPMDLISEAESLNLRRIAT
FT                   NQSKAQCRPGSAAVPSHDNPPNDDLEDATLDPNSASFSLEKWLRAAVSDASQHGLSTPS
FT                   GGILFRNLTVSGSGSALQLQPTVGSVLTAPLRFASLLRHRRIEPRRILHGFDGVMKTGE
FT                   LLLVLGRPGAGCSTFLKTVCGETNGLHIDADSVLHYNGVSQQRMMKEFKGEVVYNQEVD
FT                   KHFPHLTVRQTLEFAAAARTPAHRFQNMSRDEFASYAASVVMAIFGLSHTHNTKVGNDF
FT                   VRGVSGGERKRVSIAEMALAMTPFAAWDNSSRGLDSATALKFVQALRLSADLAGAAHAV
FT                   AIYQASQSIYEVFDKVTVLYEGRMIFFGPTGTAKEYFERMGWVCPARQTTGDFLTSITN
FT                   PLERKARAGMEDVVPKTPKDFEIYWRQSPEYKTLLGEMTEFETQHPTGNDEQASAELRA
FT                   RKENSQSRNSRAASPYILSIPMQIKLNTKRAYQRIWNDMSSTMSTVVGQIVIALITGSV
FT                   FYDSPNTTAGFQSKGGTLFYAVLLNALTAMSEITSLYSQRPIVEKQASYAFYHPATEAI
FT                   AGVVSDVPVKFLLAVAFNVIMYFLANLRREPAQFFIYFLMSFTVMFVMSAVFRTMAAVT
FT                   KNAAQAMGLAGVLMLALVVYTGYVLPVPSMHPWFEWIHYLNPIYYAFEAMIANEFHGRD
FT                   FDCIAFVPSYADLDGDSFSCSSLGSVAGERMVSGDSYINFNYTYTYSHVWRNFGVLLAF
FT                   LIGFMAIYFLASELNSSTTSTAEALVFRRGHVPEYMRPGYTRPTDEEKAVTQSDIKPSS
FT                   PSPTNTDLPLPPQRDIFTWKDISYDIEIKGEPRRLLDDVSGWVKPGTLTALMGVSGAGK
FT                   TTLLDVLAHRTTMGVITGDMFVNGKGLDASFQRKTGYVQQQDLHLETATVRESLRFSAL
FT                   LRQPASVSIREKHDYVESVIEMLGMGDFAEAVVGTPGEGLNVEQRKLLTIGVELAAKPK
FT                   LLLFLDEPTSGLDSQSSWAICTFLRKLADSGQAVLCTIHQPSAILFQEFDQLLFLAKGG
FT                   KTVYFGPIGPNSRTLLDYFESNGARKCDEAENPAEYMIEVVNAEVNDRGTDWFDVWKGS
FT                   KECQAVKEEIERIHEKKRGTAGAIEETDDGSTKSEFAMPFWFQLYVVTVRVFQQYWRMP
FT                   EYIISKGALAIVAGLFIGFSFYDAKTSLAGLQTLVFSLFMVCALFAPLVNQIMPLFITQ
FT                   RSLYEVRERPSKAYSWKAFLIANILVEIPYQVLMGILTFVCYYYPVVGSSQGPDREGLV
FT                   LLFCIQFYVYASTFAHMCIAAMPNAETASPIVILLFSMCLTFCGVMQPPDALPGFWIFM
FT                   YRVSPFTYWVAGMATTQVHGREVVCGENELSIFDPPTNQTCGQYMERYISVAGGQVLNP
FT                   SATAGCEYCSLTVADEYLAASQIYWSDRWRNFGLIWVYIGFNIFVATAVYYLFRVKKWN
FT                   GRRKK"
FT   gene            410978..412045
FT                   /locus_tag="ANIA_08927"
FT                   /old_locus_tag="AN8927.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            410978..412045
FT                   /locus_tag="ANIA_08927"
FT                   /old_locus_tag="AN8927.4"
FT                   /note="transcript_id=CADANIAT00007937"
FT   CDS_pept        410978..412045
FT                   /locus_tag="ANIA_08927"
FT                   /old_locus_tag="AN8927.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007937"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007937"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007937"
FT                   /db_xref="GOA:Q5AS03"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS03"
FT                   /protein_id="CBF84640.1"
FT                   /translation="MTKSNFITAAVLAFAATVSAQCGSGTPDAIVDGSEGAYTATVEGS
FT                   EVYSGSDFYTAITSALDGISSGQRLSILASGSIGTNVVSIPSGRIFEGCGTIDVQANSG
FT                   RGNIRSLNTENVQIPYLTLTGSPYFGLHFYGVSGLSLGQITMNLSGGLGIRFERDEAAN
FT                   SDVSMDVINITGAGSHAVETWNIDGLTINQVIARDVGECGLLLQTTTNARIGTVDGDNV
FT                   AAGTGYATFRMANANGRLSDGSYDTNVYVENVIARGGGRGIFCVSESGGVEIGNVDISD
FT                   TENNAILIENCYGVSILGGSVNGGGDVRIAARDEFENTRDVSISLEVNGANVVENPCGE
FT                   NITWDITGDATLNVC"
FT   gene            413362..413608
FT                   /locus_tag="ANIA_11635"
FT                   /old_locus_tag="AN11635.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(413362..413374,413544..413608)
FT                   /locus_tag="ANIA_11635"
FT                   /old_locus_tag="AN11635.4"
FT                   /note="transcript_id=CADANIAT00007938"
FT   CDS_pept        join(413362..413374,413544..413608)
FT                   /locus_tag="ANIA_11635"
FT                   /old_locus_tag="AN11635.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007938"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007938"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007938"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLI4"
FT                   /protein_id="CBF84642.1"
FT                   /translation="MYKLDPSSYSKADEKHNPRISLRKD"
FT   gene            414345..415248
FT                   /locus_tag="ANIA_08926"
FT                   /old_locus_tag="AN8926.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(414345..414429,414521..414568,414967..415089,
FT                   415165..415210,415245..415248)
FT                   /locus_tag="ANIA_08926"
FT                   /old_locus_tag="AN8926.4"
FT                   /note="transcript_id=CADANIAT00007939"
FT   CDS_pept        join(414345..414429,414521..414568,414967..415089,
FT                   415165..415210,415245..415248)
FT                   /locus_tag="ANIA_08926"
FT                   /old_locus_tag="AN8926.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007939"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007939"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007939"
FT                   /db_xref="GOA:Q5AS04"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS04"
FT                   /protein_id="CBF84644.1"
FT                   /translation="MPFTAHPNTTSSSNDWSEKDVFAMKVMRKSYGIVVALVVSRILGG
FT                   AGHLGGFQRARKVAGGEDEKGQRGIWRLLGLFYSDKRLGDGSAGEEPDKTIGVLEG"
FT   gene            417218..417924
FT                   /locus_tag="ANIA_08925"
FT                   /old_locus_tag="AN8925.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(417218..417441,417540..417732,417829..417924)
FT                   /locus_tag="ANIA_08925"
FT                   /old_locus_tag="AN8925.4"
FT                   /note="transcript_id=CADANIAT00007940"
FT   CDS_pept        join(417218..417441,417540..417732,417829..417924)
FT                   /locus_tag="ANIA_08925"
FT                   /old_locus_tag="AN8925.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007940"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007940"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007940"
FT                   /db_xref="GOA:Q5AS05"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS05"
FT                   /protein_id="CBF84645.1"
FT                   /translation="MEDNALESAVPSAEGCRTAYEKGSASGQAFIGVLSGFPYTCFQFQ
FT                   QALLHQPYFPDDLDLELTYDNISVSGSSICASADLGQSLHNWFKNERTHLTVLVFPWSY
FT                   IFSARWAGLMPKATLAYTDSKAYDSDKPEEDDSAMINFDLPGQYLFRQTSTFPIAKTTI
FT                   RPQIQPY"
FT   gene            complement(419762..421371)
FT                   /locus_tag="ANIA_08924"
FT                   /old_locus_tag="AN8924.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(419762..420882,420950..421371))
FT                   /locus_tag="ANIA_08924"
FT                   /old_locus_tag="AN8924.4"
FT                   /note="transcript_id=CADANIAT00007941"
FT   CDS_pept        complement(join(419825..420882,420950..421166))
FT                   /locus_tag="ANIA_08924"
FT                   /old_locus_tag="AN8924.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007941"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007941"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007941"
FT                   /db_xref="GOA:C8VLI7"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLI7"
FT                   /protein_id="CBF84647.1"
FT                   /translation="MAPTLPLPPLQRLQNLASRTFDPGATADSFREEWSNPSNYAFTIL
FT                   LLIGGDLIHRALAQLVGGPIAPVAFSFGWVSYATSAVCSALGEYRLMPDADTGCSLING
FT                   KNGYVRGNNSWVLGRMMRDYDYWMHPAIREKTQNLIDARWKFDQAREDEKYPDSGIKVP
FT                   RPSQAGLVVSVYKPSKTLQAGVPGKDLLYWSGILCTVLQLGIASIPAGINGDWGVLMIT
FT                   GAATVLCYGTGALTQWKVEKWACRRLDNRNKKNFVLTRGNGAQHAIAIVSDGVGLDLED
FT                   LATGFSMIDYPTITVVAQLLTIVLGIAWVALLITASGIDTGSWYLIAVGGIGMLQNIFV
FT                   AGWKRTPAAYGVPLEFVEVVGEVKVMGTLMELERRYEKLGKSLLGTFFPGDLRDNEVKQ
FT                   WEEIKEEWKRKKERGEGAGDDRKGK"
FT   gene            complement(421784..424246)
FT                   /locus_tag="ANIA_08923"
FT                   /old_locus_tag="AN8923.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(421784..423080,423162..424246))
FT                   /locus_tag="ANIA_08923"
FT                   /old_locus_tag="AN8923.4"
FT                   /note="transcript_id=CADANIAT00007942"
FT   CDS_pept        complement(join(421784..423080,423162..424246))
FT                   /locus_tag="ANIA_08923"
FT                   /old_locus_tag="AN8923.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007942"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007942"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007942"
FT                   /db_xref="GOA:Q5AS07"
FT                   /db_xref="InterPro:IPR010730"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS07"
FT                   /protein_id="CBF84649.1"
FT                   /translation="MEHLPLHAGKKHFIVAPYEAPESDWFDISRESFLSFPSARHWTEA
FT                   QLHGGDETTKDAHLDPDGFHRKGSPQKVEQFFQTWLFFGLAIDVLRFGGVRASVEDFLK
FT                   PATQTHAKARIVNTSRLPGMLVDWEKGIKARGRLMKDWDTLNEMFERAGSILDRFCRLP
FT                   NPEEDNSLLQQERPRLWPVRDEIATTLIAMACTLRRTAYNVCSKEISGLVDGVSPWPKT
FT                   ARSGILMRRLETKWCVADMMTTLTQLPIDGHYYLAASAGLEPDELDHHSKCVRAHCRYE
FT                   YDANMYRTRHVTDDGCREEVRYGGHLGPERGQRDWVDAMTKIIDKDAIPIALWNKGMKK
FT                   LWSVEYHLTGRRRPDFVAISHVWTDGKGNPDANSLPECQLDRIQRLVEGVTWEGRYRIP
FT                   ESDYESDGVGFWMDTLCIPANDKARKDKAITTMRRVYSEAKAVLVLDDWLQEIRSDAPP
FT                   LDLITRIFQSNWIKRLWTHQEGFLPKALWFQFKDRAVEINELREGFGAYESSLQRQGIH
FT                   LGFPRGAEMRLVGQYSVLQRMFGLTSATEKWRLYFPLAAAMSERKTSRLADETICLATI
FT                   VDIPFADLQEIPAKPDIDSGGKRMALFLEKLGKFSTGVIFNNYPRLDQRGYRWAPRSLL
FT                   NFRTAKITSAGAEPGFDIASFNPNRRPGLLAQYHGFLVNFGLGKPFAGVERGCAIQCAG
FT                   SADSGQDLDGKWFLVQLPRNNSNVEWQTWQTYAVILSEIPKQRATAPAVVASLQERQED
FT                   GIHVVIHQNIASVWMTQEPPEGVSTVRTALLRKRTKWLVG"
FT   gene            425175..425495
FT                   /locus_tag="ANIA_11634"
FT                   /old_locus_tag="AN11634.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(425175..425217,425290..425495)
FT                   /locus_tag="ANIA_11634"
FT                   /old_locus_tag="AN11634.4"
FT                   /note="transcript_id=CADANIAT00007943"
FT   CDS_pept        join(425175..425217,425290..425495)
FT                   /locus_tag="ANIA_11634"
FT                   /old_locus_tag="AN11634.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007943"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007943"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007943"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLI9"
FT                   /protein_id="CBF84651.1"
FT                   /translation="MAVQATATAVEDGHFSPWYGTVRSALVDSFNNSPLTSNVVSPSIS
FT                   IALPSVMFHGDMLRPSLCVSAVTKMLSDDDRHTHKGC"
FT   gene            complement(425618..426237)
FT                   /locus_tag="ANIA_08922"
FT                   /old_locus_tag="AN8922.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(425618..425835,425888..425949,
FT                   426005..426237))
FT                   /locus_tag="ANIA_08922"
FT                   /old_locus_tag="AN8922.4"
FT                   /note="transcript_id=CADANIAT00007944"
FT   CDS_pept        complement(join(425618..425835,425888..425949,
FT                   426005..426237))
FT                   /locus_tag="ANIA_08922"
FT                   /old_locus_tag="AN8922.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007944"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007944"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007944"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS08"
FT                   /protein_id="CBF84653.1"
FT                   /translation="MMPRTSFRVTTLFLAIFCPLTASAAVSGWRKDVTIDAPVTRSSDE
FT                   LRTLWKRRRGDSSGSDSDSDSGSSSGGYGYDDSTSLVKHTAKDICTFTLCGIGKKQASK
FT                   AAIPQGSGTPLSWDNSSGSWISLDFLWSPVSMIPPTSPTSASNPKYFSTSPTTQTWAPS
FT                   HFTFSGA"
FT   gene            complement(427417..429653)
FT                   /locus_tag="ANIA_08921"
FT                   /old_locus_tag="AN8921.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(427417..427441,427523..427549,
FT                   427623..427672,427890..429042,429103..429653))
FT                   /locus_tag="ANIA_08921"
FT                   /old_locus_tag="AN8921.4"
FT                   /note="transcript_id=CADANIAT00007945"
FT   CDS_pept        complement(join(427417..427441,427523..427549,
FT                   427623..427672,427890..429042,429103..429653))
FT                   /locus_tag="ANIA_08921"
FT                   /old_locus_tag="AN8921.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007945"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007945"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007945"
FT                   /db_xref="GOA:Q5AS09"
FT                   /db_xref="InterPro:IPR000033"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS09"
FT                   /protein_id="CBF84655.1"
FT                   /translation="MTRPIVVLGAGVLGRRIAAVLIAGGHTVHIRDPSTQALSDAASFI
FT                   DAHLHEFTAITPTPHPVPGTYKAFAEISSAVAGAWLVIEAVPEKLSLKIDTFAEVDRHA
FT                   PADCVIASNSSSFKSSLMVEKVGEQRKERVLNVHFTMPPQIRTVELMTNGQTRPELFES
FT                   LSKMLKGCGMIPVTARKESTGFIFNRLWAAIKREIMLILAEDVSTPEEIDLLWTNMFQL
FT                   PTSSPPCQLMDKIGLDTVAFIEDNYIQERGLDGSMTVDWLRKSYIDQGRLGLKSEKGGL
FT                   YGPSAAAAPAAATKAAQSLYILDVGLGSNNKVDQIPTAGKILYFDQSTGNMSPIVTGQS
FT                   LPDGVDVSKSTGRLFWTNMGRATSTRDGSVHSAKLDGSDMQTLLPTGSVHTPKQLVVDD
FT                   MNRKIYFCDREGMGVHRCNFDGSGHEVLIQTGSLDCAEHRSDLTRWCVGIAVDTPHRYI
FT                   YWTQKGPSKAGRGRIFRAGLEIPAGQTAENRTDIELLLDGLPEPIDLDLEVKSQKLYWT
FT                   DRGEHPIGCSLNCVDLSGSTQLEKLKSNKEILARHFNEPIGLRVAGDGTVYLIKKCVIL
FT                   QGSASLYKQDSDITHRSRNYLSSMA"
FT   gene            complement(430268..431867)
FT                   /locus_tag="ANIA_08920"
FT                   /old_locus_tag="AN8920.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(430268..430270,430351..430513,
FT                   430556..431529,431583..431743,431792..431867))
FT                   /locus_tag="ANIA_08920"
FT                   /old_locus_tag="AN8920.4"
FT                   /note="transcript_id=CADANIAT00007946"
FT   CDS_pept        complement(join(430268..430270,430351..430513,
FT                   430556..431529,431583..431743,431792..431867))
FT                   /locus_tag="ANIA_08920"
FT                   /old_locus_tag="AN8920.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007946"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007946"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007946"
FT                   /db_xref="GOA:Q5AS10"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS10"
FT                   /protein_id="CBF84656.1"
FT                   /translation="MPSYTLEQVKAHCTPDDIWIILHNKVYEVTKYLEDHPGGSAVLIE
FT                   VAGADATEAFEEIGHSDEAREQLEPYYIGDLPDQEQAESVEIYRPTFEQVSQSAVINTK
FT                   KTSKSFSSLLSVLVKLGLTGAVGAATIAVFQKNWTPRQLLHALPALTTPIPLPRISGSG
FT                   GSQFWSGVGIATITQLSLSFGLGVWVSTKLDVQQEFTHYPPRRPASSARLIRLPSTTRA
FT                   LAPRSPVLDPRQWRSFPLTSKKEVAPNVYRLVFALPKADDILGLPTGQHVALRATVDGK
FT                   TVQRSYTPISNNTDRGHIELLIKVYPKGLLTNHLAQMEVGETIEMRGPKGAMKYSAQYA
FT                   YRIGMIAGGTGITPMYQLIRAICEDESDNTQVSLLYANNGEADILLREELESFAGRFPH
FT                   KFKMEGFVNGEMIAKHIGSPADDAKVLLCGPPPMVEAMKKTLAGMGWDMPGAIANGTDQ
FT                   "
FT   gene            432184..433905
FT                   /locus_tag="ANIA_08919"
FT                   /old_locus_tag="AN8919.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            join(432184..432328,432401..433905)
FT                   /locus_tag="ANIA_08919"
FT                   /old_locus_tag="AN8919.4"
FT                   /note="transcript_id=CADANIAT00007947"
FT   CDS_pept        join(432184..432328,432401..433905)
FT                   /locus_tag="ANIA_08919"
FT                   /old_locus_tag="AN8919.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007947"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007947"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007947"
FT                   /db_xref="GOA:Q5AS11"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS11"
FT                   /protein_id="CBF84658.1"
FT                   /translation="MRPPTVQCQFYLIGDEPSSAQSVTVDTRWKFEDLQRAVGLVFHVA
FT                   QPLGTLSTVDEVLTLANSSSAIGILVDGKPVQSPQGPPGLPLVGSFYEIFPDHLGNHYR
FT                   LFRKYGPVIKTTNMGKTIYLTDSPQVAASCFAESIYMTKKITEDHPLWGVKDNTAIFIG
FT                   DTETENWRLAHKYLPPAMGPKAVRHYTGLMQNCARKALPVFDELDARDESWNVYQYMVK
FT                   LASQTIGSFSLGKDFGHFASIDSPLHPIVTNIASLLSLNKKITARGEWYRLLPFGDPAR
FT                   LRSVQHTIYTLLQEAIDEVAARSASKDAPMSDAALSASCVVDYLLHAVDEKGEHFPTGL
FT                   ILANMLIVTGAGFTTTSALLSWLIYCLVTYEGTQDRLYSELVEYGIVGPSGEPNKTTWT
FT                   PDLAHSLPYLNNFVKETQRLHNASFQPGRTTKTDVVLPGGYRIPENSVIVPALYAIHTN
FT                   PSIWHDPFRFNPDRWDSDEVKNLHRCAYVPFATGPRGCIGFNFALLEVKIILAELVSRY
FT                   EFVRDGVESIEYDPEFQLIRPLNFYVRAKRRS"
FT   gene            complement(433979..436101)
FT                   /locus_tag="ANIA_08918"
FT                   /old_locus_tag="AN8918.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(433979..433984,434022..434734,
FT                   434784..434918,434984..435207,435263..435721,
FT                   435782..436101))
FT                   /locus_tag="ANIA_08918"
FT                   /old_locus_tag="AN8918.4"
FT                   /note="transcript_id=CADANIAT00010527"
FT   CDS_pept        complement(join(433979..433984,434022..434734,
FT                   434784..434918,434984..435207,435263..435721,
FT                   435782..436101))
FT                   /locus_tag="ANIA_08918"
FT                   /old_locus_tag="AN8918.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00010527"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00010527"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00010527"
FT                   /db_xref="GOA:C8VLJ4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLJ4"
FT                   /protein_id="CBF84660.1"
FT                   /translation="MPEPHYPYDTTVVSELLKQKRKARGIKACFPCRHRKVRCDGHVPC
FT                   ASCIKRGHSELCRVPTSSTSAAGFMQGQGQGNNKSTSVLSRPESLSSPQDDPADEQQDA
FT                   AAAQSPVCDSPSIQYRAQPNLASLLSRMEEIEQQIVSLQKDLRATISIPLAGRLSSVDQ
FT                   PSIGHSAAQAGPQGKSPGRHVVEEATGATIFLGSHSDAPLALGCRETSASGLGSRMLDE
FT                   VTMAQFVPRAYPFTSLWGPDATVEEVCETLPEEADLIRYWQAYQSTAYPFYPVLVDVEG
FT                   FGLSVFEFLNTRASQNATEPNPSWLALLFAVLACGAQFTHDPVQERDLRSKVFTCSSFH
FT                   CLRMSNFFYHTDLDQIQAMALICHCLRNNLDTNTAWILMGTTMRLAQSIGLHEISPTLP
FT                   PKEQLRQSRLWWTLIWQDTFLSFTYDRPPSSSTAECCTIPRISESPGLSFQECVFKICQ
FT                   IISNQSQLKGEHSALDYKTELESVLNEASLFLTNKVHCRSLQDHLERLALSIHVGYAIC
FT                   RMSQIHLDSMPENSSSAVAADSQRQAMQVVENFLELHRLCGTVCRSWAFVHNAVSCAIT
FT                   MHNLAYVTGDGLADSNTLAHRLMKLLESEARASEWYDADTNL"
FT   gene            complement(436160..437594)
FT                   /locus_tag="ANIA_12277"
FT                   /old_locus_tag="AN11685.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(436160..436295,436459..437594))
FT                   /locus_tag="ANIA_12277"
FT                   /old_locus_tag="AN11685.4"
FT                   /note="transcript_id=CADANIAT00010530"
FT   CDS_pept        complement(join(436160..436295,436459..437594))
FT                   /locus_tag="ANIA_12277"
FT                   /old_locus_tag="AN11685.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00010530"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00010530"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00010530"
FT                   /db_xref="GOA:C8VLJ5"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLJ5"
FT                   /protein_id="CBF84662.1"
FT                   /translation="MPLLFSFFLFVYLYISSSLFFDIVHFCLHQWSSSRYEALRWLSRC
FT                   HQFHHLYYNRSLNFNSRYRWQNSWFALPLEAACLCIGGLLGWFFLMLLPVIEQKHVLRT
FT                   PLIAILAVHIIRTSVVIYMSGQDSNHVVYKTVPKDPSWLFVGPQFHALHHVHPDRYMGS
FT                   VVKVFDWLAGTAYSLRNKSVVITGGSGALGSAIIRRLRSEGVRNVYSLKFGEHWTHGDF
FT                   NRVGPIFDHLEPDILILAHGTKGEDAMDANCNSTIRLIQLYLEQRAGRTPASATKTLPE
FT                   VWYIGSEVELHPAFGGAEMYRYLDSKRAFLPYARALYDDSGVVYRHIVPAAFQSRMGRA
FT                   IVSADWAAGVMMWWIRRGARYVPVTYTGFAYSNFFKFFCSRNTIDGVPVDSARVRPDRS
FT                   GIGVGRQRHGASSSSDVCRINPAL"
FT   gene            441682..442767
FT                   /locus_tag="ANIA_08917"
FT                   /old_locus_tag="AN8917.4"
FT                   /product="DUF636 domain protein (AFU_orthologue;
FT                   AFUA_2G12650)"
FT   mRNA            441682..442767
FT                   /locus_tag="ANIA_08917"
FT                   /old_locus_tag="AN8917.4"
FT                   /note="transcript_id=CADANIAT00007948"
FT   CDS_pept        441682..442767
FT                   /locus_tag="ANIA_08917"
FT                   /old_locus_tag="AN8917.4"
FT                   /product="DUF636 domain protein (AFU_orthologue;
FT                   AFUA_2G12650)"
FT                   /note="transcript_id=CADANIAT00007948"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007948"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007948"
FT                   /db_xref="GOA:Q5AS13"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS13"
FT                   /protein_id="CBF84664.1"
FT                   /translation="MSTKTLTIRCHCRSTHFALTVEPTSLPLRAHLCHCTLCRTTHGTT
FT                   ASYHAPLPEGVKPSFIAPSSWDNLTAYTPPGSGAKLYFCSTCGCQVGGTNVLGIWDTVV
FT                   SIIEGGNEEDAIWVIDEHIYTEKGSTGDGGIAELLPRIGERELRVWNPDIKGTEFPTAG
FT                   SGAAGRSASHNRQDDKLLAQCNCGGVSFTISRPREDFMNSPLSKGWIHPSFRTKWLALL
FT                   DVCDDCRLLTGAHVTTWLFVPIDHITPSLPDDLVIGTMKRYESTPGTVSRTFCGTCGAT
FT                   VFCYYDKRGGIVDIATGILRAPEGVMLGDWAVWRTAKLGFKDDGRRYDKLFTEGLEKGA
FT                   KEWGRRVHGEVIDFQGGPATD"
FT   gene            complement(443748..445998)
FT                   /locus_tag="ANIA_08916"
FT                   /old_locus_tag="AN8916.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(443748..444698,444934..445722,
FT                   445777..445802,445974..445998))
FT                   /locus_tag="ANIA_08916"
FT                   /old_locus_tag="AN8916.4"
FT                   /note="transcript_id=CADANIAT00010528"
FT   CDS_pept        complement(join(443748..444698,444934..445722,
FT                   445777..445802,445974..445998))
FT                   /locus_tag="ANIA_08916"
FT                   /old_locus_tag="AN8916.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00010528"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00010528"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00010528"
FT                   /db_xref="GOA:C8VLJ7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLJ7"
FT                   /protein_id="CBF84666.1"
FT                   /translation="MDEYLLDHSGRLRCKQRRIKCDETHPHCNQCTRRAYECPGYQRPL
FT                   KWSSKYEVAANNDTAAREDARSKHTINAQTPDLEVDTISSILSPSVSVPGLTPQHLAMA
FT                   TGLAEQDVSLYTAGSDASFPDFGFNNISSPQYEQTSSSFFDSVKFSDVFNTNLGEWADL
FT                   TVSLPLPLEDQDARISRHYFFKVCRINPCFDSGANPMRVQIHDQMAFSGLIYHCVVSMS
FT                   AAHEGSIDSTALTYRSKAVTCLKSELTRLKGGTDSERPLGSTDLSSALLGCILLGMTDS
FT                   LDVIAYLNAFCEKDISTGTQIHPSPWAGVCTPLFVYLAKAGTLARQRSLAKNLSNLTAG
FT                   PSATSIQTQLIADPTGQARQTETALLEYEIPAEDRIGETADHLSPISHLQKMAQIYRLA
FT                   TLLEIYRNFPSLLRTESNTTPESTTQRQERERPLENSSGKDKLLTMATAILTLIMGLPR
FT                   TSGVNCVMTIPLIIAGSTLQPVTPTFTGARKAGRESGKRDKYQPETEAATAWNTLASEI
FT                   LSISTQEETGLYWRDLVRERLRAVHSYVGLASVLRALDILENVWARADFQAIAANWNAE
FT                   LEFVQWTEVMVGEKLETVLG"
FT   misc_feature    446766..461863
FT                   /note="contig 1.176 634..15731(-1)"
FT   gene            complement(449886..453723)
FT                   /locus_tag="ANIA_09426"
FT                   /old_locus_tag="AN9426.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(449886..452659,452709..453723))
FT                   /locus_tag="ANIA_09426"
FT                   /old_locus_tag="AN9426.4"
FT                   /note="transcript_id=CADANIAT00007949"
FT   CDS_pept        complement(join(449886..452659,452709..453723))
FT                   /locus_tag="ANIA_09426"
FT                   /old_locus_tag="AN9426.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007949"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007949"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007949"
FT                   /db_xref="GOA:Q5AQK4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQK4"
FT                   /protein_id="CBF84668.1"
FT                   /translation="MRPKSRSDFTVAVICALPLEADAVEALFDEHYDRLGEYYGKQPGD
FT                   ANAYLNGRIGNHNVVLCYMPGIGKESAASVASSLQVSYTEIKLALVVGICGGAPSPPVY
FT                   QEIFLGDVMISDSVIEYDFGRQYPGGFQQKSAVKDILGRPSQEIRALLNGLRAENARNE
FT                   FQSQIREHLHVLQQRGAKWHRPYIKDILFNASYLHKHYSDAPAGCSCLRSNSPDEICEM
FT                   ALEEDCDSLGCDKKQAVRCRKTLENIQPSVYVGPIASADTVMKSGQYRDELVRKEKVIG
FT                   FEMEGAGVWDNLPCIIIKGVCDYADSHKSKSWQAYAAATGASAAKAFLKYWMSANRKGA
FT                   NRSRNRHLVIPFGRNSRFVGRQDEIHKLESLIFMPDGPRKLAITGLGGVGKTQVALELA
FT                   YRMRDREADCSIFWVPCTSYEVAEQALLSIAQRVEIQDTQPEKLKERLKTYFGQEDKNW
FT                   LLIFDNADDMDMWTKGSNDTPPLKDFLPLNNQGHIIFTTRNRELAVDLASPYVMQVPEL
FT                   DRKTGMEFLEKSLCKDLLHDSHAMIRLLEQLTFLPLAISQATAYINKKGLKVSDYLTLL
FT                   EEQETDVVELLSKDFGDDQRYTDVQNPVAKTWLISFKQIQKLDQLAVEYLLLMACINPR
FT                   NIPQAFLPPRSKLQMSDALGLLNAFFFITIQPENGYISLHRLVHLATRNWMRKEGWFPL
FT                   WITKTTDRLSSIFPHNDHANRQVWREYLPHALSLLRETEFHKHQEQYVDYIEKVGTCLD
FT                   SDGRYNEAEKLQAQVIEARKKVLGPEHPSTLTSVHNLASTYRNQGRWSEAEELQEQVIK
FT                   TWKQVLGLKHPFTLTSMGNLALIYWNRGRWKEAEELLAQVMENRKQVLGLVHPDTLASV
FT                   HNLAATYLDRGRWKEAEELFVQLVETRKQVVGLEHPDTLTSMHNLASTYRNQGRWKEAE
FT                   ELLTHILEAWKRVMGSEHPSTLTSMHNLASIFWCQGRWKEAEELLTEVIETRKRVLGPE
FT                   HPDTLSSLHNLASRYLDIGHWKEAEGLLAQVMETRKQVLGPAHPSTLTCMHNLASAYQN
FT                   QGRLEEAEELQVRVMEAWKQVVGSKHPSTLTSMDNLATTYRKQGRWNEAEELQVQVMET
FT                   WTQVLGPEHPDTLISMANLASLYYNQGQWNKAEKLQVQVMETRKQVLGPEHPHTLTSML
FT                   NLAFTFKNLGNNLDALRLIKGYAGLCNKVLGSNHPQAILSLSTLNEWESEAEQLTKGQK
FT                   QQTLADTSSSLALPQSYAGEQGASELKTAGGKRRRLS"
FT   gene            456488..456861
FT                   /locus_tag="ANIA_11664"
FT                   /old_locus_tag="AN11664.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(456488..456492,456810..456861)
FT                   /locus_tag="ANIA_11664"
FT                   /old_locus_tag="AN11664.4"
FT                   /note="transcript_id=CADANIAT00007950"
FT   CDS_pept        join(456488..456492,456810..456861)
FT                   /locus_tag="ANIA_11664"
FT                   /old_locus_tag="AN11664.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007950"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLJ9"
FT                   /protein_id="CBF84670.1"
FT                   /translation="MSLVIVSSLSSLRKAIFL"
FT   gene            complement(458173..459295)
FT                   /locus_tag="ANIA_09425"
FT                   /old_locus_tag="AN9425.4"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase
FT                   (AFU_orthologue; AFUA_1G11530)"
FT   mRNA            complement(join(458173..458327,458381..458497,
FT                   458556..458778,458849..458961,459003..459148,
FT                   459228..459295))
FT                   /locus_tag="ANIA_09425"
FT                   /old_locus_tag="AN9425.4"
FT                   /note="transcript_id=CADANIAT00007951"
FT   CDS_pept        complement(join(458173..458327,458381..458497,
FT                   458556..458778,458849..458961,459003..459148,
FT                   459228..459295))
FT                   /locus_tag="ANIA_09425"
FT                   /old_locus_tag="AN9425.4"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase
FT                   (AFU_orthologue; AFUA_1G11530)"
FT                   /note="transcript_id=CADANIAT00007951"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007951"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007951"
FT                   /db_xref="GOA:Q5AQK5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQK5"
FT                   /protein_id="CBF84672.1"
FT                   /translation="MALNTALNTALQTSKTAYGFWLTLPGAGVAKTILRSTAQHANRFS
FT                   WVLVDAEHGLISDKDYYEVDSYANPRSSEGASPIIRVPWGEEWLIKRALDAGAHGILTP
FT                   MCHSEEDAAKIVRYCKYPPQGSRGYGPMFALHSFPEVPAAQYDAGADKNTAVFVQIESK
FT                   GGLESVEKIAAVEGLDGILIGPFDLAKQIGVQRGGDEHEAAIQRILKAAKSARKKAAIF
FT                   CTDGADAQNRAQQGFDMVSIVTDVGVLGSGMLRELNVASGKAEGGKPRDGY"
FT   misc_feature    461864..612117
FT                   /note="contig 1.164 1..150254(-1)"
FT   gene            complement(462097..464166)
FT                   /locus_tag="ANIA_08915"
FT                   /old_locus_tag="AN8915.4"
FT                   /product="hypothetical peptide transporter (Eurofung)"
FT   mRNA            complement(join(462097..462525,462590..463189,
FT                   463249..463508,463585..464112,464163..464166))
FT                   /locus_tag="ANIA_08915"
FT                   /old_locus_tag="AN8915.4"
FT                   /note="transcript_id=CADANIAT00007952"
FT   CDS_pept        complement(join(462097..462525,462590..463189,
FT                   463249..463508,463585..464112,464163..464166))
FT                   /locus_tag="ANIA_08915"
FT                   /old_locus_tag="AN8915.4"
FT                   /product="hypothetical peptide transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007952"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007952"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007952"
FT                   /db_xref="GOA:Q5AS15"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS15"
FT                   /protein_id="CBF84674.1"
FT                   /translation="MEPVLNEKTGAPAVEDVVAVSDYEEPTEEELKTLRRIPGALPTVA
FT                   YLICIVEFCERASYLGVSGLISNFVNRPLPAGGNGYGAPARGTQDTAGALGMGTVKANA
FT                   VSQSFSMLAYLLPMFFGYLSDAHTGRFKMILYGVAVFGVAHVLMVGATAPKLLANGGAK
FT                   APYFISLYMLSVGASMFKPNVSPLLLDQMPRDKAKIKVLPSGERVIVDPEATSERTMLW
FT                   FYLLINIGGFMQTATSYAEKYVGWWLAFILPLFLYIPLPLLLIWLRKRLVLFPPGGSDL
FT                   PNVVRVLKICLSRGGIFRIGRHGFWDAAKPSVIAAKGQNIRTQWNDQFVEDVRRTFQAT
FT                   GIFCFFPIQYINDNGLGSAASFLSTMLKTDGVPNDLISNFNPLSIIFFAPILNYGLYPL
FT                   LRRWKIHYGPVARMATGLFISSIGGIGYTVLNYYAYKLGPCGKWGSSDTCVDENGNTRV
FT                   APITIWWIAIPYAIGGISELFINVPAYGIAYSRAPKNMRGLVSAINLLNTAVAYAIGLA
FT                   CSAVIKDPYLTWDFGGPSIVGFVLTVIFYFMFRHIDKEEYFLTEMAENENETTAQPKES
FT                   ALSENGDKTLSPVEKVADNEPEKIGVSLKQ"
FT   gene            complement(466493..466897)
FT                   /locus_tag="ANIA_08914"
FT                   /old_locus_tag="AN8914.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(466493..466704,466759..466897))
FT                   /locus_tag="ANIA_08914"
FT                   /old_locus_tag="AN8914.4"
FT                   /note="transcript_id=CADANIAT00007953"
FT   CDS_pept        complement(join(466493..466704,466759..466897))
FT                   /locus_tag="ANIA_08914"
FT                   /old_locus_tag="AN8914.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007953"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007953"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007953"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS16"
FT                   /protein_id="CBF84675.1"
FT                   /translation="MPSCAVAHAIGNVRKPGIALLFAPEQPMVKEHDVKKWHVVYQNRF
FT                   DCWEGPLRIQGTSAFREMEAYNLERRISMYDQAEWVADLNVLKSLGQSLICECVVSMVN
FT                   IAVMIHPCQRAK"
FT   gene            470132..470799
FT                   /locus_tag="ANIA_08913"
FT                   /old_locus_tag="AN8913.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(470132..470250,470325..470799)
FT                   /locus_tag="ANIA_08913"
FT                   /old_locus_tag="AN8913.4"
FT                   /note="transcript_id=CADANIAT00007954"
FT   CDS_pept        join(470132..470250,470325..470799)
FT                   /locus_tag="ANIA_08913"
FT                   /old_locus_tag="AN8913.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007954"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007954"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007954"
FT                   /db_xref="GOA:Q5AS17"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS17"
FT                   /protein_id="CBF84677.1"
FT                   /translation="MKPWILAFLALSACALAQETETPGPSPTESVGCEPHGDHWHCDAP
FT                   ATSTETDLESTSETLPPSPTESIGCEPHGDHWHCDAPATTTESESESDATSTSTTTATD
FT                   GEASESESASLSPSPTESVGCEPHGDHWHCDGPAETESASSDSSSSAAADATATDEAGA
FT                   EETGGEQPEDGAGIVGVKLSGVVAMAIGAAAVLL"
FT   gene            complement(471233..472880)
FT                   /locus_tag="ANIA_08912"
FT                   /old_locus_tag="AN8912.4"
FT                   /product="myo-inositol transporter (AFU_orthologue;
FT                   AFUA_2G07910)"
FT   mRNA            complement(join(471233..472516,472578..472880))
FT                   /locus_tag="ANIA_08912"
FT                   /old_locus_tag="AN8912.4"
FT                   /note="transcript_id=CADANIAT00007955"
FT   CDS_pept        complement(join(471233..472516,472578..472880))
FT                   /locus_tag="ANIA_08912"
FT                   /old_locus_tag="AN8912.4"
FT                   /product="myo-inositol transporter (AFU_orthologue;
FT                   AFUA_2G07910)"
FT                   /note="transcript_id=CADANIAT00007955"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007955"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007955"
FT                   /db_xref="GOA:Q5AS18"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS18"
FT                   /protein_id="CBF84679.1"
FT                   /translation="MTIDEDEKTAPVHLEYDGHEADDDSIENIATSWFVWLVSLTASIA
FT                   GSLFGYDTGIISAVLVYLGSDLDGRPASENEKQLITSLCSGGSFVGAIIAGLTADKFGR
FT                   KPAIYVGCVLFTVGAVLQGAAYSIAQMSVGRLIVGFGVGSASMVVPLYIAELSPTKVRG
FT                   RLIGLNNMSITGGQVISYGIGAAFAHVPHGWRYMVGLGGVPSIILACLLPFCPESPRQL
FT                   VYHGKTQEAETVIRKIYKGASDAQVAAKVRLIVRACDESRELNKDSTRWAKIKLLHSNP
FT                   AYFRALVCACGFAVIAQMSGFNTLMYYSATLFDLVGFSDPVAVGIVVAGTNFVMTWVNM
FT                   MLVDPLGRRRVVLLTAWGMSAGLIAVAIAFKFIPVDTSTLELETDTVSPPAIVVLIFII
FT                   WFVFFYGASMGNTAWMNTDFFPMEVRAIGTMFQTCCTWGSNIIVSSTFLSMMQGITPSG
FT                   AFGFYAAICGFGYILIYFFYPEVSGLSIEEIREVFQHGFGVAYSRKLRKTRKAAARAAS
FT                   AAGEEVEAKTV"
FT   gene            complement(474152..475807)
FT                   /locus_tag="ANIA_08911"
FT                   /old_locus_tag="AN8911.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(474152..474403,474469..474841,
FT                   474888..475624,475700..475807))
FT                   /locus_tag="ANIA_08911"
FT                   /old_locus_tag="AN8911.4"
FT                   /note="transcript_id=CADANIAT00007956"
FT   CDS_pept        complement(join(474152..474403,474469..474841,
FT                   474888..475624,475700..475807))
FT                   /locus_tag="ANIA_08911"
FT                   /old_locus_tag="AN8911.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007956"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007956"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007956"
FT                   /db_xref="GOA:Q5AS19"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS19"
FT                   /protein_id="CBF84681.1"
FT                   /translation="MAEPKPSTSYIESVGDEKAISYDPKETEEYDPNDPQNWSTVSRLT
FT                   TYLTICFYTFLANVNSSNFTVATKAIVQEFGVSQTQAGELVCFNVFLFGLGNIFWVPLM
FT                   RVVGKRPVYLTSMLLLCMMNVWSSRASSYGELLSSRILSGFAAAAADATVPAVVSDMVA
FT                   PQDRGHYLMVFHLALTSGLFIGPLINAYLVQEENWRWMCYFLAVAVGVVFVTAIFTVRE
FT                   TTYRRDRPRSGRRTPWQWMSLTLGYNPDASFVRTLLDIVWNVGYPQLLWAAFAIGISVG
FT                   WNIVVQLTASRTFTAPPYNWSAGSLGLLSLSGFIGSVLAFYLGGRLIDIISTRYTKRSG
FT                   QRLPEYRLPAIVIPGVIGPGGLLIFGLCIAHQVHWIGAAVGYAMQAFGVAAISNVAVTY
FT                   CLDCYKPLTGEALVIIFVIRNTIGMLLSLYAADWITQQGPAAVFGEMTAIQAASILLAI
FT                   PLFSWGGPLRAWTSRYGPMKRFMSAGENRCL"
FT   gene            480420..488155
FT                   /locus_tag="ANIA_08910"
FT                   /old_locus_tag="AN8910.4"
FT                   /product="polyketide synthase, putative (JCVI)"
FT   mRNA            join(480420..481478,481526..481649,481697..481809,
FT                   481858..482284,482332..482781,482828..486174,
FT                   486232..486306,486351..486682,486733..488155)
FT                   /locus_tag="ANIA_08910"
FT                   /old_locus_tag="AN8910.4"
FT                   /note="transcript_id=CADANIAT00007957"
FT   CDS_pept        join(480420..481478,481526..481649,481697..481809,
FT                   481858..482284,482332..482781,482828..486174,
FT                   486232..486306,486351..486682,486733..488155)
FT                   /locus_tag="ANIA_08910"
FT                   /old_locus_tag="AN8910.4"
FT                   /product="polyketide synthase, putative (JCVI)"
FT                   /note="transcript_id=CADANIAT00007957"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007957"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007957"
FT                   /db_xref="GOA:Q5AS20"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS20"
FT                   /protein_id="CBF84683.1"
FT                   /translation="MSETTPQTGRTTSASWADDPIAIVGVGLRLPGSIRTPQQFWQFLV
FT                   NKRSGRCRVPADRYNVDAFHGPKGKLGHVCTEYGHFLDVDLAAVDSSFWSIPPKELLLL
FT                   DPQQRLLMEVVYECLESSGTAAYRGRDIGLYIGALGEDWMDIQTRDPQGLGMHCVAGYS
FT                   DFALSNRLSKELGLTGPSMTIRTACSSSMMALHAACQALYTGECSSAVVGGCNLILSPR
FT                   MTTTMSELGVMSPTGDCRSFDARADGYARGEAVNAIHIKRLSHALRDGDPIRSVIRSVC
FT                   INSDGPRSPVFIPSPESHELLIRRCHQLAGISDLSQTAMIECHGTGTKVGDVQEGRAVA
FT                   NVFGDIGGVLIGSVKPNLGHSEGASALTSIIKMTLALENQTIPPNINFSTPNPKIPFGP
FT                   ACLRVPVECEPWPKDKAERVGLNGFGIGGANGHVLLESARSFLGTFVNEAPSGCTPQLL
FT                   VFSGTHPETVKRNISLSLDFLAKNPAKVADASYTLACRRRILPNRAFAVGCLDSWDVSP
FT                   VRKAGPADLVWVFPGQGAQYPEMGLKLVTGNAIARDTIRSLDEVLDLIDAGRSWTLHDE
FT                   LLRPEPSSRLSQAKFSQPCCTAIQIALINVLKSMNVKPSAVVGHSAGEIAAAYAAGALT
FT                   AAEAMAIAYQRGNIAERVEGSGGMIAVSLSREQVSPFLTDQVTVACENSSRNITLSGDS
FT                   AALDDVVEKLQCTYPEVTTKRLGVNCAYHSEHMNIVKDEYLDRLVALKVKQQPLSTTFV
FT                   SSVTGKSVENAGDLDTEYWCRNLVSPVLFYSAVKDTIAALPNPVFLEIGPHSALSGPLR
FT                   DISPSTPYIPTLVRGISANTSILRTVGRLFQFTEIDLSGLVTGSVLTDLPPYQWQYDRR
FT                   FWSESRVSRNWRFRQHPHHDILGSQIPDGNEMEPLWRSLIHLDSVPWLRDHVIDGKTVF
FT                   PRSSYISMAGEAIRQLTGSSDVSLRRVSFLEDITFDGKHPTEVLTQFRPIQGTEWYDFT
FT                   LTSQFEGKWTKLCMGQARRGYDLPSDIKQLCPGHRKVKPETFNRAMERLRIIYGPRFRA
FT                   LDRIAVNATAPEATAEITERHERQESHYIVHPCTTSSIFQLLTIAKAKGRNFDHSFVPT
FT                   YIEEVYVTASTGSISAQSIITATQNRTFSGDAAGFCGGSLVFFMRNIRLMPTENRYDRG
FT                   LDPHAGARLVWQPDIDKAHLARLIRPHCDKSILENLFLVEELALACIIESEQQTRSSKA
FT                   LAHFARYSEWLSLQRQRAEQGNYDHVKSCQAIASMPSKDRGNHIKELYQKALMTPVQHV
FT                   ATAVMRIYHETTTLFAGQVDPLSILMKDDLLSAIYGFNLCDFADFFRVIAHNRPCMRVL
FT                   EIGAGTGGITATILPAMHTPHGERLYHSYTYTDISSGFFERAQERFRAYKGVDYRVLDI
FT                   SVDIAAQGFDAPYDLIIASNVLHATPNLQQTLANVKALLKPGGKLFLQELAPTTKWVNY
FT                   IMGTLPGWWLSNDDRPWEPYVSPKRWDAELRAAGLSGADTVVHDGHMNAHIVSSLPELR
FT                   SERNRQVTVLCKPGSEHLNSVIAYLHTRDFVTDTRHLGEELPNNQMVISLLELDGPQLH
FT                   AMNETEYLNLRDLITSLDQKTMLWVTRTSQVACSDPRYAATLGLLRTARRELGLTVATL
FT                   EVDTLDVKAIDAIAEVTERVLRLETTSSLDPVLEYTHAYGTLMVGKYYPAIVSEELLDR
FT                   AASDQTAAVLRTSPRNIETLTWERMSLEISAPVEDWVLVETRAVGMNLKDLLVVNGTLD
FT                   AALGSECAGTVQRVGPGVKNLRAGDRVMVLSPNSGVMATKFVTSERLCARMARNLSWTE
FT                   AATIPFAFATAFYALIDVARLKYGDSVLIHHACSEIGTAAIQICRMIGAKFYCTVAKRA
FT                   DEDYLLQLGIPKERIFSSRNSTFVRDLMVPTAGLGVDVVLNTLSDNLFHASWQCVAEFG
FT                   VLVDLPQGEFNKQLPMEAFEGNRSFCAVNLSQVAAKRPETIQGLLRRCMHHYALGELTP
FT                   LQLQEFPAEKAQDAFKSMKEGKTGKAAIIMPEESSSLPACFSRREPSFRNDAIHLIVGG
FT                   LGGLGRSVSSWMASHGARHFVFFSPSAASKENDDFVLELRAQGCRLDLVSGDISNPEDV
FT                   DMLIKGLDENIPIAGVMQASMALEVTSFATMSFAQWQAAFAPKCQGTWNLHNTLLKYSR
FT                   KTDYFLLFSSLSGLIGQTGYANYAAGNAFLDAFVQYRHSLGLPCSAINIGVMEDVGYVS
FT                   EQTHAIDHFVATSTYTLQERDLHDAVQLAIDKSSPVGTTTRNGPAQPTYVNESQLLIGL
FT                   RSTAPLDSPNNRTSWRRDPRMALYHNLNQSAAKSASEKTTDTADDQILVCFLEQLKGEP
FT                   DILDKPESIDLLSTEIGKTLFSYMQRDRSNLDLDVPLPSLGVDSLLAIKMRNWFQRKIG
FT                   VDIGVVQILNSGSLRDLGRITAKAIAGLRIAESTVSVADLTPMS"
FT   gene            488493..489620
FT                   /locus_tag="ANIA_08909"
FT                   /old_locus_tag="AN8909.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(488493..489246,489298..489620)
FT                   /locus_tag="ANIA_08909"
FT                   /old_locus_tag="AN8909.4"
FT                   /note="transcript_id=CADANIAT00007958"
FT   CDS_pept        join(488493..489246,489298..489620)
FT                   /locus_tag="ANIA_08909"
FT                   /old_locus_tag="AN8909.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007958"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007958"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007958"
FT                   /db_xref="GOA:Q5AS21"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS21"
FT                   /protein_id="CBF84685.1"
FT                   /translation="MDHLNLSPPQSLIQNLELCVSNDHISSLTPDLLLHIFGYLREDGR
FT                   SLCNYALVCRRWQKLLEPLIYNTIQVYNEAPTPPRAFSVVRFKHFVGGLNNVRRRAMVR
FT                   KLVFHYQATQFPRGPGETASRAQDPAQNPTDAGFRKAVAGLFQTLRFWEPWYKIELDIA
FT                   LAYSYTGAPRLASMANPSTTADLVTFPTVHCVAEIAFHYSEHGQVFQRIWEATPFHIAQ
FT                   SCANLASLVMDSDAFKLTGRQAPVIRRRKVIAECLDGLPATIENFSMRVIGVSNPYVLD
FT                   WFTPEEDPFSCKLLRITTHLHAIKLYNVTIPVDFWCPLDKNYRPKRDRPVWPCLTHILS
FT                   DDNCLVEGTGKLVLVRLI"
FT   gene            490980..491828
FT                   /locus_tag="ANIA_08908"
FT                   /old_locus_tag="AN8908.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            490980..491828
FT                   /locus_tag="ANIA_08908"
FT                   /old_locus_tag="AN8908.4"
FT                   /note="transcript_id=CADANIAT00007959"
FT   CDS_pept        490992..491828
FT                   /locus_tag="ANIA_08908"
FT                   /old_locus_tag="AN8908.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007959"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007959"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007959"
FT                   /db_xref="GOA:Q5AS22"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="InterPro:IPR039516"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS22"
FT                   /protein_id="CBF84686.1"
FT                   /translation="MKFPLPLPTLLGALTLLTPAFSANTLNIVAHPDDDLLFLNPDIQN
FT                   DISSGFNVRTVYLTSGDAGQPYEYWTLRQAGLLTAYAQMAGVESIWDESDAGVAGKDIP
FT                   VYTLRPKPEVSLAFMHIPDGSMDGNGFPATGQESLEKLWKGAIARIRTVDASGTTYSRG
FT                   ELVETLRQIIDSFVPDSLNSLDYVHPYGSGDHSDHTSAGLFTNTAAITSSFPGSVIAYR
FT                   GYPIKSEPANVGGEDLVRKKEVFYTYAAFDEDVCGSDQACAGKEYELWLPKQYTAN"
FT   gene            complement(495092..496166)
FT                   /locus_tag="ANIA_08907"
FT                   /old_locus_tag="AN8907.4"
FT                   /product="C-4 methyl sterol oxidase, putative
FT                   (AFU_orthologue; AFUA_8G02440)"
FT   mRNA            complement(join(495092..495235,495282..495953,
FT                   495999..496166))
FT                   /locus_tag="ANIA_08907"
FT                   /old_locus_tag="AN8907.4"
FT                   /note="transcript_id=CADANIAT00007960"
FT   CDS_pept        complement(join(495174..495235,495282..495953,
FT                   495999..496140))
FT                   /locus_tag="ANIA_08907"
FT                   /old_locus_tag="AN8907.4"
FT                   /product="C-4 methyl sterol oxidase, putative
FT                   (AFU_orthologue; AFUA_8G02440)"
FT                   /note="transcript_id=CADANIAT00007960"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007960"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007960"
FT                   /db_xref="GOA:C8VLK9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLK9"
FT                   /protein_id="CBF84688.1"
FT                   /translation="MANVTLPSGSMSYPELLQVAKQDSSLSWPEQLWWAHYTFWNNDVL
FT                   ATGVMTFLAHELIYFGRCIPWIVADALPSVFRRFKIQDHKTPSFSDQWTCVKYILAIHF
FT                   IVELPLIVLFHPMMEVCHVQYTLPFPKLSLFAAQVALFFIVEDTYHYWLHRAMHWGPLY
FT                   RSIHRIHHQYAAPFGLTAEYASPAETFLLGLGTICPPLILGSITGDVHLITVLGWMALR
FT                   QLQAIDAHSGYDFPWSLRRIVPFWGGADWHDDHHRYFWGNYSSSFTHWDILMGTVAGPR
FT                   GKAMGHNKRH"
FT   gene            complement(496668..497625)
FT                   /locus_tag="ANIA_08906"
FT                   /old_locus_tag="AN8906.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(496668..496707,496823..497359,
FT                   497483..497625))
FT                   /locus_tag="ANIA_08906"
FT                   /old_locus_tag="AN8906.4"
FT                   /note="transcript_id=CADANIAT00007961"
FT   CDS_pept        complement(join(496668..496707,496823..497359,
FT                   497483..497625))
FT                   /locus_tag="ANIA_08906"
FT                   /old_locus_tag="AN8906.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007961"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007961"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007961"
FT                   /db_xref="InterPro:IPR031818"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS24"
FT                   /protein_id="CBF84689.1"
FT                   /translation="MCSQTQTSHDPQPQSNMIKRLSARISLRWPPEPPFENTDTLVLSV
FT                   GNCMKDEVLFTHELDSRNAFGVADCGTFSALPNGDDLEVGVMPRPDLPGAPVREYEEVW
FT                   RELPFVRMEGHENVSFVLESATGGTQLKEGEEKEITRTFIGAIWGSFIALRQTQVLARP
FT                   IGETRTVIKSGAEVSAKREDFVQGQGFVVRYSLGPEADELPTHSDIQLPASDGSLEKLV
FT                   VCGQDLHPQGKDVTVKE"
FT   gene            497910..499616
FT                   /locus_tag="ANIA_08905"
FT                   /old_locus_tag="AN8905.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            join(497910..498223,498276..498306,498363..498503,
FT                   498554..498683,498735..499365,499457..499616)
FT                   /locus_tag="ANIA_08905"
FT                   /old_locus_tag="AN8905.4"
FT                   /note="transcript_id=CADANIAT00007962"
FT   CDS_pept        join(497910..498223,498276..498306,498363..498503,
FT                   498554..498683,498735..499365,499457..499616)
FT                   /locus_tag="ANIA_08905"
FT                   /old_locus_tag="AN8905.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007962"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007962"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007962"
FT                   /db_xref="GOA:C8VLL1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLL1"
FT                   /protein_id="CBF84691.1"
FT                   /translation="MLTFYLAASIIVTVLFMRRLCSPIAKLPGPWYATFTSWVLKYHEF
FT                   TSNRRLFIHDLHKKYGSTVRIAPNEISFASLEAIKEIYGSGGSGYDKTELYDLFRQFGI
FT                   KTMFSTLDKHSHSQRKRELADRYAMSNILREEHVSAIVDRARAVVSRCAASAESVDVYV
FT                   WLHCYALDGVTNFMFSPGGLHSLDSEHDFKIMEELTYHQSLQKNLLHYYLPTVAAYFPP
FT                   CLTPRRSPKTNEYVLKMCAQQLPSQHSLVAKLARKDSPLNHTQVAAECKDHMAAGIDTT
FT                   GDGLCFLMWKLSQPHNIRFQERLWEELRTARPDIPLDKLPYLDAVVKEGLRCAPPIPMS
FT                   FPRYVPTGGRSIDGHFVPEKTIVSCQPYTVHRLDENVFPEPDSFNPDRWMVEKGAVERN
FT                   RLFFAFSTGGRGCTGRNLALVEMKILLREVYSRFRTTVAKDMHGCMDIDDQIISSRPLG
FT                   QTCKLRFSET"
FT   gene            complement(500484..502401)
FT                   /locus_tag="ANIA_11149"
FT                   /old_locus_tag="AN11149.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(500484..500831,500894..501031,
FT                   501100..501558,501604..502076,502122..502401))
FT                   /locus_tag="ANIA_11149"
FT                   /old_locus_tag="AN11149.4"
FT                   /note="transcript_id=CADANIAT00007963"
FT   CDS_pept        complement(join(500484..500831,500894..501031,
FT                   501100..501558,501604..502076,502122..502401))
FT                   /locus_tag="ANIA_11149"
FT                   /old_locus_tag="AN11149.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007963"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007963"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007963"
FT                   /db_xref="GOA:C8VLL2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012083"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLL2"
FT                   /protein_id="CBF84693.1"
FT                   /translation="MKLSSLVALVGVSALSEASPRPKPNFVFVFTDDQDLTMNSVEYMP
FT                   HVAGRIRDRGLDFTNHFVTTALCCPSRVSLWTGRQAHNTNVTWVAPPYGGYPKFVSQGF
FT                   NEDWFPLWLQDAGYNTYYVGKLFNAHSVTTYNNPFVKGFNGSDFLLDPFTYSYWNSSYQ
FT                   RNHEAPKSYAGQYTTDVTEEKALGFVDDALEDKERPFFLTVAPIAPHFEQDPGHSSDTP
FT                   PQAPIPAPRHAHLFPDAKVPRVPSFNPLNQTGPSWIRDLKHQNQSVVDYEDFFYRQRLR
FT                   ALQSVDEMVDKLLDRLERSGQLNNTYVIYSSDNGFHIGHHRLPPGKSTSYEEDIRVPFF
FT                   IRGPGIKSGGKVTQVTTHIDFAPTIFELLGLPPRSDFDGTPMRIMKDSAAIPHEHVIVE
FT                   YWGQALMMVTAPTNTDRMPNTTYKSVRLLSEKYNLFYAVWCTGDHELFDLNTDPYQMHN
FT                   IYNTASRSFKNRLDALLLVLKSCAGSTCIKPWAELHPDGSVQSLSDALDSQYDGFYAQL
FT                   PKVEYEACVDGYLIAAEGLQWEDVSASALRNYVRRNYAFDDVQKYRKL"
FT   gene            complement(502764..504929)
FT                   /locus_tag="ANIA_11143"
FT                   /old_locus_tag="AN11143.4"
FT                   /product="glucoamylase (Eurofung)"
FT   mRNA            complement(join(502764..503454,503512..504149,
FT                   504199..504295,504343..504629,504689..504929))
FT                   /locus_tag="ANIA_11143"
FT                   /old_locus_tag="AN11143.4"
FT                   /note="transcript_id=CADANIAT00007964"
FT   CDS_pept        complement(join(502858..503454,503512..504149,
FT                   504199..504295,504343..504629,504689..504929))
FT                   /locus_tag="ANIA_11143"
FT                   /old_locus_tag="AN11143.4"
FT                   /product="glucoamylase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007964"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007964"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007964"
FT                   /db_xref="GOA:C8VLL3"
FT                   /db_xref="InterPro:IPR000165"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR008291"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR034836"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLL3"
FT                   /protein_id="CBF84695.1"
FT                   /translation="MAFLSLYTQFFILGVVTLWVTHGPRPLQQTLAAGDLDIWLPSEAN
FT                   IARTALLDLIGDKGRWAEGAAAGVLVASPSRSDPDYFYTWTRDSSLVFKTLVEMFRAGD
FT                   SDLLPIIQDWISSQARIQGVENPSGGLADGRGLGEAKFTAEETAFAGSWGRPQRDGPAL
FT                   RATTMIEFGWWLLSQGYHQLAANTVWPVVHNDISYLTEYWNQSGFDLWEDLYGRSFFTL
FT                   AVTYRALTEASLFARSIGSSCAECESQAPQVLCLLQSFWTGRFIRSNLDTGRTGKDAST
FT                   LLGVIHTFSPRSECDDVTFQPCSARALANHYRVVDAFRDLYDINADRSQDQAIAIGRYP
FT                   EDQYFGGNPWFLCTIAAAEQLYSAIYQWTHLGSITITAVSLPFFQTLHPTAVPGTYSSS
FT                   TEIYHQLIDAVRTYADGFMRIVQTYASHNGSLAEQFSRYDGSHLSANDLAWSYASLLTA
FT                   HRRRNAIAPSPWGNPGQPSIPSYCEPTSASGTYSLATITTWPPMNGLPTTTSAPCQVPS
FT                   LVSVTFELTASTVWGEEIRLVGSSGELGYWVSERGITFSTDRYSSSQPIWWATVWLPAG
FT                   QTVEYKYIRVREGYVVWEGDSNRLLTIPAVCGVKSIYRRESWR"
FT   gene            507361..509575
FT                   /locus_tag="ANIA_08903"
FT                   /old_locus_tag="AN8903.4"
FT                   /product="MFS peptide transporter, putative
FT                   (AFU_orthologue; AFUA_8G02550)"
FT   mRNA            join(507361..507726,507781..507900,507962..508574,
FT                   508625..509575)
FT                   /locus_tag="ANIA_08903"
FT                   /old_locus_tag="AN8903.4"
FT                   /note="transcript_id=CADANIAT00007965"
FT   CDS_pept        join(507408..507726,507781..507900,507962..508574,
FT                   508625..509459)
FT                   /locus_tag="ANIA_08903"
FT                   /old_locus_tag="AN8903.4"
FT                   /product="MFS peptide transporter, putative
FT                   (AFU_orthologue; AFUA_8G02550)"
FT                   /note="transcript_id=CADANIAT00007965"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007965"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007965"
FT                   /db_xref="GOA:Q5AS27"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS27"
FT                   /protein_id="CBF84697.1"
FT                   /translation="MNPADSVEIGDAVAAQQNAHLAQLPLGKDIKLEKDAIARESSIEE
FT                   IPATKEYPTGSEEDQDLNKLHPTQEEMQTLRRVAGPMNWITFSVAFVELCERFSYYGTT
FT                   AVFVNFIQQPLPPGSTTGAISGGSEVPGALDMGQQASTGLTLFNSFWSYVMPLAGAFLA
FT                   DQYWGRFRTIMFSIGCALVGHVILIISAIPPVIANPNGAIGCFAIGLIIMGMGTGGFKS
FT                   NISALIAEQYPDERPYLKTLPSGERIIIDPAATVARVYLYFYLCINVGSLTGQISMVYA
FT                   ERYVGFWLSFLLPTIMFCFSPLVLYLCRNKYHLVPPTGSVYTQAYRLIREAIRHHWSVT
FT                   TVKVAGIPFKRIKKNDTHFWNTVKPSTMGANRPTWMTFDDEWVDEVARGLKACRVFLWY
FT                   PLYWLAYNQMLNNLTSQAATMRLGGVPNDIINNFNPLALIIFIPIFDRLLYPFLRRIGI
FT                   KFTPLKRITAGFFVAGSGMIVATVTQHYIYKKGPCGKEANSCLEQGLHAPISVWVQALT
FT                   YILGGISEILASVTSLEYAFTKAPKNMRSLVQAVSLFMNAFSSAIGQAFVGLSEDPLLV
FT                   WNYAVVAILAFVGGIGFWATNYKLDKQEDELNTLAQSKYEGSGLKQDEEAKA"
FT   gene            510003..512356
FT                   /locus_tag="ANIA_08902"
FT                   /old_locus_tag="AN8902.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(510003..510655,510711..511145,511203..512356)
FT                   /locus_tag="ANIA_08902"
FT                   /old_locus_tag="AN8902.4"
FT                   /note="transcript_id=CADANIAT00007966"
FT   CDS_pept        join(510003..510655,510711..511145,511203..512286)
FT                   /locus_tag="ANIA_08902"
FT                   /old_locus_tag="AN8902.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007966"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007966"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007966"
FT                   /db_xref="GOA:Q5AS28"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS28"
FT                   /protein_id="CBF84699.1"
FT                   /translation="MPNNAEGTTDPTTPISPSFARPYRSHKVPACDFCRKRRSRCTQEV
FT                   ADQPCLLCRMHGATCTRASSRPGPAKRRRLAVDNAPQDPQEPQQRPSPPPTTESASYAE
FT                   STHQHPSARDRSTATPVFSQNDASNQSGHIVGPVMARDAQVLERCMSSIPNSAVSYARP
FT                   NPYSVYSDDTRNPVIYMKVPRQRNIAPSGNGTAGFRQFEAMEKVVEPLGPELCSVYFNN
FT                   IHPPFPILDEQTVLKAYQQDGLPYALACEIYACSLLLWKSSPKIAASNRPVPDIRYMWN
FT                   LTVSAMNDDFLSPNFSTILACILDLLGRPITSITYNAVNVGRVVALSQSLGLNRNPSTW
FT                   GVDSRQKSLRIRTWWGILIHDQWASLSHGTPPHIHKSVWDVPLPDSDSLMVSITPGEVF
FT                   PPDARVQGAHSFIALCSLTTLLGQILPLIYVLEVQPLEASFRALRRHETALNEWEEGLP
FT                   SWLRPSSPVFERKAAGALNLQLSFLAVKLCLSRIALLEIHRSNESPAEEDKLYYRSRCR
FT                   KAARTVIDFTVNLARDELHAFWLPYTAYHFTSAATLTLRCALEAENADTAQECIASAKK
FT                   LIDFLRRIKNEVNWDLADICLGQCEAVVEKLCDTEYLEMWRKNPHPHSQGEYALDRTQP
FT                   GHGVNAPSFHFAAHNNVPNPEGQDEFIIQQAQTNQAMADDIGINGIGDPSFLQTFMTFG
FT                   SMPGLMAESPPFPDLWQMPYMDEYGSRGL"
FT   gene            complement(512672..514249)
FT                   /locus_tag="ANIA_08901"
FT                   /old_locus_tag="AN8901.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_7G01190)"
FT   mRNA            complement(join(512672..512698,512753..514249))
FT                   /locus_tag="ANIA_08901"
FT                   /old_locus_tag="AN8901.4"
FT                   /note="transcript_id=CADANIAT00007967"
FT   CDS_pept        complement(join(512672..512698,512753..514249))
FT                   /locus_tag="ANIA_08901"
FT                   /old_locus_tag="AN8901.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_7G01190)"
FT                   /note="transcript_id=CADANIAT00007967"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007967"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007967"
FT                   /db_xref="GOA:Q5AS29"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS29"
FT                   /protein_id="CBF84701.1"
FT                   /translation="MDEKAPPNGSCPDKDIQVGTVTVSDLDEGRLFLRQHNITNNDLEG
FT                   FLADEVRNKALVRKVDLILLPLLAGTYMLQYIDKTALAYSAVFDLLPSTNMTSEQYSWL
FT                   ASIFYFAYLVAEYPWTILAQRTAMAKVVSGNVIAWGSILMITAACKNFAGIATCRFFLG
FT                   IFEAPITNCFMMIVGMWYTRREQPFRAGIFYSCNGMGAIVGGILTYGIGQIKTIAVWRA
FT                   IFLILGGITVAWGLVLLLFLPDDILSAKRFTIEEKALLVARGRLARTGILSHQIKWYQI
FT                   REALLDPQVWILFLFMLLNETINGGLANFSKLIIKGLTDDSLRTVALGIPFGAFQLLWV
FT                   LSGTFIASKIPNTRTIVMFVYLIPSLVGIIMLWKLSHETQRIAVLFGYYISGGYVCSLV
FT                   LALQMPATNLGGYTKRATSVALVFLAYCAGNIIGPHAFLAAEAPIYQTGCKLIISCLAV
FT                   QAALSICLRFLLIRRNKQRDSATADAPVSEEEELADITDFENPRFRYVL"
FT   gene            514577..516257
FT                   /locus_tag="ANIA_08900"
FT                   /old_locus_tag="AN8900.4"
FT                   /product="extracellular lipase, putative (AFU_orthologue;
FT                   AFUA_7G01180)"
FT   mRNA            join(514577..515170,515220..516257)
FT                   /locus_tag="ANIA_08900"
FT                   /old_locus_tag="AN8900.4"
FT                   /note="transcript_id=CADANIAT00007968"
FT   CDS_pept        join(514577..515170,515220..516257)
FT                   /locus_tag="ANIA_08900"
FT                   /old_locus_tag="AN8900.4"
FT                   /product="extracellular lipase, putative (AFU_orthologue;
FT                   AFUA_7G01180)"
FT                   /note="transcript_id=CADANIAT00007968"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007968"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007968"
FT                   /db_xref="GOA:Q5AS30"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS30"
FT                   /protein_id="CBF84702.1"
FT                   /translation="MARPSVTLPQGKVVGIRLEYKFPQPVDAFLGIPYARPPVGDLRFR
FT                   PAERFPNSTEIIDASNYGPAAPGKALLPGGPALRQSEDCLSVNIFRPSKSNLAEKLPVA
FT                   IYVHGGAYNRGSAAMHKTASMVAWSEEPFIAVTFGYRLGALGFLPSSVSKKEGLLNLGL
FT                   RDQSFLFQWVQENIALFGGDPGTVTLFGLSAGAHSIGHHLLNYDGHKTPLFHRVILESG
FT                   SPTSRAVRPYNAEIHEQQFRDFLQEVGCPSTLAESEIFPFLRSLPSSVITNAQIAVFDK
FT                   YNPSLRWAFQPVIDDDVIPRKPLDAWTAGLWHRVPIMTGFNSNEGTMYVDKSMSDSAQF
FT                   RKFWQELLPQLTKEDLDTIDRLYPDPSTDPTSPYVETRTGLDLGPQYKRIEAAYGHYAY
FT                   VAPARQTAHFAASIPGAPSVYLYHWALPRTIIGRANHGDNMYYETYNDEITGLSESQKE
FT                   LSGTLHAYITSFITHGDPNSIKGRYGTRPEWKPYKPSSPGILVFGENNEELIGGSVAPP
FT                   AKFVSDNWAREETEFWWSKVPISQLA"
FT   gene            516807..518047
FT                   /locus_tag="ANIA_08899"
FT                   /old_locus_tag="AN8899.4"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase,
FT                   putative (AFU_orthologue; AFUA_2G01030)"
FT   mRNA            join(516807..517868,518003..518047)
FT                   /locus_tag="ANIA_08899"
FT                   /old_locus_tag="AN8899.4"
FT                   /note="transcript_id=CADANIAT00007969"
FT   CDS_pept        join(516903..517868,518003..518047)
FT                   /locus_tag="ANIA_08899"
FT                   /old_locus_tag="AN8899.4"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase,
FT                   putative (AFU_orthologue; AFUA_2G01030)"
FT                   /note="transcript_id=CADANIAT00007969"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007969"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007969"
FT                   /db_xref="GOA:Q5AS31"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005965"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS31"
FT                   /protein_id="CBF84704.1"
FT                   /translation="MPSQDVPLPEPFASVPRETLTFGPSPIQYLPNITAALGGKVNIYA
FT                   KREDVNSGLAFGGNKTRKLEYLASDALAQKADTLVSIGGFQSNHTRQVAAVARKLGLEV
FT                   ALVQEKWVDWDDKNGVYDKAGNIQLSRLMGADTRLDMSGFGIEHKLTLKNLEEEIRARG
FT                   GKPYYIPAGASDHPLGGLGFARWAFEVEMQEKELGVFFDTVIVCAVTGSTMAGMIAGFK
FT                   LAQKVNGSRKRKIIGIDASATVEQTFEQILRIAKFTGVKIGLDEEDITAEDVILDDRYH
FT                   AGVYGIPDEATIEAIKFGARTEAFITDPVYEGKSLNGMMDMGLLSCCRIVFRVKS"
FT   gene            complement(518196..519656)
FT                   /locus_tag="ANIA_08898"
FT                   /old_locus_tag="AN8898.4"
FT                   /product="flavin-binding monooxygenase, putative
FT                   (AFU_orthologue; AFUA_8G02570)"
FT   mRNA            complement(518196..519656)
FT                   /locus_tag="ANIA_08898"
FT                   /old_locus_tag="AN8898.4"
FT                   /note="transcript_id=CADANIAT00007970"
FT   CDS_pept        complement(518196..519656)
FT                   /locus_tag="ANIA_08898"
FT                   /old_locus_tag="AN8898.4"
FT                   /product="flavin-binding monooxygenase, putative
FT                   (AFU_orthologue; AFUA_8G02570)"
FT                   /note="transcript_id=CADANIAT00007970"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007970"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007970"
FT                   /db_xref="GOA:Q5AS32"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS32"
FT                   /protein_id="CBF84706.1"
FT                   /translation="MTDYDVVIVGAGISGINSAYRLQTQLPHLRYTILEARDNLGGTWD
FT                   LFKYPGIRSDSDLFTFGFAWHPWDQDNAIAAGPAIVNYLKRTTAQYGINRHIQYGQRLR
FT                   GADWSSADHTWSLSVENTADEQMKTLSARFIIFGTGYYDYQTPLQTDIPGLDQFAGQVV
FT                   HPQFWPEDLDYSNKRIVIIGSGATAVTLLPNLVEKAQHVTMLQRSPTYILALPNRKPLM
FT                   SWILPAFIARRLIRVSWMLTSRIFFLFCQAFPLLARFILRFRTKTLLPKDVPWDPHFKP
FT                   NYNPWDQRLCVSPDGDFYKSLHTGKAAVKTDTIKTVTPKGIELNSGEFLDADMIVPATG
FT                   LRLRIAGGASISVDGAPVHLNDKFIWHGMMLQDMPNAAFIIGYTNASWTLGADATALTI
FT                   CRILKNLEKRGFAAVVPRLSPSLASNIQPRRLLNLSSTYITKAEKDLPRAADRGPWVPR
FT                   DNYFSDLWFAKYGNIDDGMEFLGEKKTL"
FT   gene            520116..521286
FT                   /locus_tag="ANIA_08897"
FT                   /old_locus_tag="AN8897.4"
FT                   /product="lipase/thioesterase family protein
FT                   (AFU_orthologue; AFUA_8G02590)"
FT   mRNA            join(520116..520297,520353..521286)
FT                   /locus_tag="ANIA_08897"
FT                   /old_locus_tag="AN8897.4"
FT                   /note="transcript_id=CADANIAT00007971"
FT   CDS_pept        join(520116..520297,520353..521286)
FT                   /locus_tag="ANIA_08897"
FT                   /old_locus_tag="AN8897.4"
FT                   /product="lipase/thioesterase family protein
FT                   (AFU_orthologue; AFUA_8G02590)"
FT                   /note="transcript_id=CADANIAT00007971"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007971"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007971"
FT                   /db_xref="GOA:Q5AS33"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS33"
FT                   /protein_id="CBF84708.1"
FT                   /translation="MLTIAQKLDYIPALASVAVTFVWALLTVAIRAPEYPSHWLLHVGY
FT                   AVFRKLTARLSAAQMQYVLPASNLVYNRYIRSVRQKPLTVQLEHGAMGHWIGDPKAKNI
FT                   LVWYHGTSRLLAHNPPGVLTEAGGGFALPANIGYFKFFASIVADCERNGQSLAVFALTY
FT                   TLAPVATYPTQLRQAVEALRYILVEKRHSADHVMLGGDSAGGNLVGGVLSHLSHTHPAI
FT                   DPLPLDGAALAGAVMIAPWTQLQPELGDRIIDSRGDLITPAVGPLWGSGYVGEAPKDFY
FT                   TDLSDAPVEWFAKFPVRKILVCGGEREILLPVIEDFVEKLRKGFKGDVEFCVGKGEGHV
FT                   APVYNLYIGDKRETQQGARAKSFIRGLLEKM"
FT   gene            complement(521550..522694)
FT                   /locus_tag="ANIA_08896"
FT                   /old_locus_tag="AN8896.4"
FT                   /product="short-chain dehydrogenase/reductase 2, putative
FT                   (AFU_orthologue; AFUA_8G02600)"
FT   mRNA            complement(join(521550..521832,521906..522299,
FT                   522358..522694))
FT                   /locus_tag="ANIA_08896"
FT                   /old_locus_tag="AN8896.4"
FT                   /note="transcript_id=CADANIAT00007972"
FT   CDS_pept        complement(join(521550..521832,521906..522299,
FT                   522358..522694))
FT                   /locus_tag="ANIA_08896"
FT                   /old_locus_tag="AN8896.4"
FT                   /product="short-chain dehydrogenase/reductase 2, putative
FT                   (AFU_orthologue; AFUA_8G02600)"
FT                   /note="transcript_id=CADANIAT00007972"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007972"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007972"
FT                   /db_xref="GOA:Q5AS34"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS34"
FT                   /protein_id="CBF84710.1"
FT                   /translation="MSLSLSHLSLVLGQWLQPIVEQLPPSVQDVVLHPLAPKALLVLLA
FT                   LAFLRQTNRILTNWSMNNGERDRFDHERELVLLTGGCSGIGKQMVLDLAKANVRVVILD
FT                   IQEPSFTLPSGTAFFKADITSSASIAEVAEKIRAEHGDPTVLINNAGVGHDGTILQKPE
FT                   AKIRQTFEVNTVSHFLMVREFLPSMIEKNHGHVVTIASMASFIGLGDMVEYSCTKASAL
FT                   AFHEGLRQELRLWYKAPKVRTTVVHPLWVRTPMIKVLTDAGSEFKQPILTPEMVSEAVV
FT                   KQVLAQSSGQIILPGYYTPLSMLRALPNWFQEFARGVGSRDFIKLREWQQKQLKTQ"
FT   gene            523180..524968
FT                   /locus_tag="ANIA_11142"
FT                   /old_locus_tag="AN11142.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            join(523180..523365,523426..523886,523918..524302,
FT                   524351..524968)
FT                   /locus_tag="ANIA_11142"
FT                   /old_locus_tag="AN11142.4"
FT                   /note="transcript_id=CADANIAT00007973"
FT   CDS_pept        join(523180..523365,523426..523886,523918..524302,
FT                   524351..524968)
FT                   /locus_tag="ANIA_11142"
FT                   /old_locus_tag="AN11142.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007973"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007973"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007973"
FT                   /db_xref="GOA:C8VLS3"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLS3"
FT                   /protein_id="CBF84711.1"
FT                   /translation="MIPMLAATLAEAFILQRSVFTDTPLRTVVFGSAAVNLLILAIYNV
FT                   WIWPFFLDPLRHLPRAPGRFNMLRFIFDNPRGRLPLLWMKTVPNDGLIYFRDLLNRTQL
FT                   LATNHQALLDVMSTNTYDFEKPWRAREFLARIIGFGLILSEGAAHKRQRRALTPFFTIK
FT                   NVRALYTLMWDKTNQLLVEMDKQISRCPMEGTSPDSGWGKVEMSVWARYFTLSRLTLDV
FT                   IGPAAMGRDFRSLQNAENKVADSFLAILEPTKEKIAFLAINFLLPQWFAKKLPWRLNQV
FT                   IEEQVGYLRDLCKEIVHEKRAAITATKVTASELEADILGSMMLSGDFTDDELVDQMLTF
FT                   LAAGHETTASALTWTCYLLTLHPEVQDRLRAEIRTAIPHSTHPVTHSDLESLPLLNGVC
FT                   QEVLRLYPTVPSTIREAVRDTTVAGKHVPKGTKIMLCPYAINRAPEFWGADGDAFRPER
FT                   WIDTDPVTGKTSVNNHGGAATNYAQITFLHGQRSCIGKDFARAELRCAVAGVVGRYEFA
FT                   MQDPKQVIHISGAVTTKPVEGMHLRMRRVEGW"
FT   gene            525301..525819
FT                   /locus_tag="ANIA_11150"
FT                   /old_locus_tag="AN11150.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(525301..525447,525583..525819)
FT                   /locus_tag="ANIA_11150"
FT                   /old_locus_tag="AN11150.4"
FT                   /note="transcript_id=CADANIAT00007974"
FT   CDS_pept        join(525301..525447,525583..525819)
FT                   /locus_tag="ANIA_11150"
FT                   /old_locus_tag="AN11150.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007974"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007974"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007974"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLS4"
FT                   /protein_id="CBF84713.1"
FT                   /translation="MKKGKRMKKTIIMKTALASLITAYVPAECTRPESMNERDPTRNLR
FT                   REAGSGPKNIPPRTENGWVHPRICSQPRRNDVQTAYGEQCDSGPDAIDKSVAGYPARGR
FT                   QQKSADKLFACLWGDVVLEAKVI"
FT   gene            526391..529758
FT                   /locus_tag="ANIA_08894"
FT                   /old_locus_tag="AN8894.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(526391..526631,526666..526779,526842..526892,
FT                   527389..527927,528088..529758)
FT                   /locus_tag="ANIA_08894"
FT                   /old_locus_tag="AN8894.4"
FT                   /note="transcript_id=CADANIAT00007975"
FT   CDS_pept        join(526391..526631,526666..526779,526842..526892,
FT                   527389..527927,528088..529758)
FT                   /locus_tag="ANIA_08894"
FT                   /old_locus_tag="AN8894.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007975"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007975"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007975"
FT                   /db_xref="GOA:Q5AS36"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS36"
FT                   /protein_id="CBF84715.1"
FT                   /translation="MVKYNALFKDKDSGIFSSAKRNTPTKSMVDISLYEKRREEIWSLW
FT                   PEFRETNEERHAEGLAKAQIVSVCQPEHNRMSYSMENGLNPEDIVTVSRAYQVFPHQGE
FT                   DELVPSAICGKCHDGVSCPKNNTQPAKIPIPDHGQSSAPRRRRPALSCSICRRRKLKCD
FT                   RSLPCGQCIKSKTPDLCVFSAPTPAQSATSSSMAASTSSEKRHALSDEASAVGNGLYVF
FT                   DSKHRVAKPRGRPDELHELRSRVHTLELALAKSNTIQLPESSGYDCMPELGLRTLADPI
FT                   SDQVMNLCGRACFRGRNGRTRYRGRSSTELTLTFIERRDQVKDGTPSSLKEMLPPRSIA
FT                   DELLHLYLSTFETTYRILHIPSFLKEYEAYWTAPEAADTVFVAKLLALMATASCFISSS
FT                   TTVNGKDTLHDVAVGWIFGVQRWIGSLFMRATAKFDILQIQCLLMIARQALAVDGDVVW
FT                   LTSGSLIHTATIMGMHRDPARFGKMTPFWAEMRRRLWATILELELQASIDVGIPPSIDT
FT                   DQYDCDLPSNLDDSDLTEDLVEAPVAKERTVLTQCSFQTMLAQSFPLRVRIAKAVNSLR
FT                   FTMAYDEALRLGENLIRFMNEALVPFPTPVSDGTPSFARSFMLFLFQRSLLILHRPFSL
FT                   SISLSPKYSYSRKVCLESSLEMLTQFESPLPSFQSSRTPCLGQIGGGMFRDECFHAAIT
FT                   LCVELSLQSTESASNSAPSTHGGSLNDIVRSQQEVLVRVLERTRENFGSRLTPKGNGCK
FT                   AYAFLAMALASTKARLNGDDPLKSVEQAAHRSVKVFHHVISGLPYEEFLAQPESDWSDI
FT                   GPSSTQTPEFGSSTPDMSFDPLSLLTNNPMDFSPLDFNNMFDTFNYRMPDLWDPNFLNL
FT                   "
FT   gene            530252..531037
FT                   /locus_tag="ANIA_08893"
FT                   /old_locus_tag="AN8893.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(530252..530444,530577..530635,530692..530752,
FT                   530799..531037)
FT                   /locus_tag="ANIA_08893"
FT                   /old_locus_tag="AN8893.4"
FT                   /note="transcript_id=CADANIAT00007976"
FT   CDS_pept        join(530252..530444,530577..530635,530692..530752,
FT                   530799..531037)
FT                   /locus_tag="ANIA_08893"
FT                   /old_locus_tag="AN8893.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007976"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007976"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007976"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS37"
FT                   /protein_id="CBF84717.1"
FT                   /translation="MTKIALFGSTGQICRAILLALLTTTPHEIASIDQPSSENKAKEID
FT                   VCEEEKKRLKTAGINILEAVGYGMHLLHTDENGRGVLHPTWNIKEDGNRKALHHPPISA
FT                   GQRASLVSLDPAGRAVYTLHILGDADAAVDFTHIDNLAAFVVFTIDSPDVAGNKSLNIV
FT                   SDRISYNELTTLLEKYSKKK"
FT   gene            532362..537073
FT                   /locus_tag="ANIA_08892"
FT                   /old_locus_tag="AN8892.4"
FT                   /product="ABC multidrug transporter (Eurofung)"
FT   mRNA            join(532362..532813,532867..534193,534243..534452,
FT                   534501..535107,535166..536429,536528..536870,
FT                   536930..537073)
FT                   /locus_tag="ANIA_08892"
FT                   /old_locus_tag="AN8892.4"
FT                   /note="transcript_id=CADANIAT00007977"
FT   CDS_pept        join(532362..532813,532867..534193,534243..534452,
FT                   534501..535107,535166..536429,536528..536870,
FT                   536930..537073)
FT                   /locus_tag="ANIA_08892"
FT                   /old_locus_tag="AN8892.4"
FT                   /product="ABC multidrug transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007977"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007977"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007977"
FT                   /db_xref="GOA:C8VLS7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034001"
FT                   /db_xref="InterPro:IPR034003"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLS7"
FT                   /protein_id="CBF84719.1"
FT                   /translation="MPARLHSRPQGNSTLASSQEAGDHADRPSSPQVHLTYEDEDAIAE
FT                   IHRTLTKKDHDYSEPHLSFDKFLEEELRAGRKKPNLGVCFQSLSTWGTGGEHVNVKTLG
FT                   TALWRTLIFQDVYEWTIKPWLAKPEPESGRQLIRDFTGVVRSGEIMLVLGRPGSGCSTF
FT                   LRTIAGYHSSFLGVTGSIAYSGLSLEDVRKHYRGQVAYVPEDDVHFPTLSVRQTLEFAL
FT                   QSKTPKRYHDRIPRYLEIYGRVFGMSHTMDTLVGNEYIRGVSGGERKRISIIESLATDS
FT                   SVMCWDNSTRGLDASSALDYARSLRIMTDTCGKATLMTLYQASDAIYDLVDKVLLIDEG
FT                   RMLYQGPAHEAKAYFHDLGYECGPMQTVSDFLTSITIPERRKFREGWEQRAPKGPIELE
FT                   QAFRKSAAFMNVQKEVRSYDSQGFGGRSRAESHSDTDYESLEDVKEALQTDKSRFVSSK
FT                   SPYTISLFRQVVLCAKRQIWQIRGHMSPLYIKLISSVIYGLLVGSMFYDQPQTTDGMYS
FT                   RGGVIFYSSILLAWLQMSELEEAMQGRDILSRQKKFAFVRPSAVCLARVVADIFIAALL
FT                   TFLYLVVVYFLSGLKSDAGAFFIDFLFIYMCTISLTAQFRLFAAASSNFEVALRYTGFL
FT                   VLLCIVFGGYVLSVDKMMADVPWVGWIAYITPALYTYEAMMAAEFHNTNFTCSPASVVP
FT                   AGPVYTDIAYQTCAYAGSQIGSTIVNGDDYLAVKYGFYFSHVWRNFGILCLFTVASVAA
FT                   TCLLSEIMEWEPDSAGPVQYKKSRKQLRKIANISDEEERPVQVNQTSPSASDTDGPSVG
FT                   ALTATKSTFTWDNLELFVRVGKENRKLLDGVSGYCKPGTLTALVGASGAGKSTLLTALT
FT                   QRQSSGDLTGTMYVDGRPIDSSFKSRIGYCEQMDIHDESSTIREAFEFSALLRQDSTVP
FT                   DQEKLAYARTVLETLDLVELQNAIIGSLDIEKKKRVTIGVELCARPELLLFLDEPTSGL
FT                   DSQAASSICALLRRLADQGLAILCTIHQANQEQFEMFDRVLALSPGGKTYYFGEVGEAG
FT                   HSIFDYFAKYGQKPENITNAADYIIEVVVGGMKNTASTVDWAAVWNQSVEAQQVQQDLE
FT                   RFRNMKQESLPSLDMQSQAMPAISRQIFLLTQRTSRQFWRSPEYPYSRLYASFLHALIN
FT                   CLTYLQIGNSTTDLQSKAFSCFLVLMLVPEFINAISARFIMNRDLWKAREGPSGAYGWV
FT                   AFCTAQIISEIPYAIISAVVFFVLYYFSVGLPLGFAAGYSFLMFFLFFLFATSWGQWIA
FT                   ALSADSVVAATLMPFFIIMCETMNGILQPHKYMPAFWAYTMYYVTPFTYWIGGVLTSVL
FT                   RGVPVICDENELTVFQSPPNITCSEYAGSWLAEKGVGYLSNPDGSGECGYCEYSYGDDY
FT                   LSTIGLDSSKIWPYFGIFVAFVVSNYLMVYLLVYIRSVMKPFRRRT"
FT   gene            537512..539364
FT                   /locus_tag="ANIA_08891"
FT                   /old_locus_tag="AN8891.4"
FT                   /product="Exopolygalacturonase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q873X6]"
FT   mRNA            join(537512..537874,537932..538099,538157..538330,
FT                   538384..538629,538694..539364)
FT                   /locus_tag="ANIA_08891"
FT                   /old_locus_tag="AN8891.4"
FT                   /note="transcript_id=CADANIAT00007978"
FT   CDS_pept        join(537521..537874,537932..538099,538157..538330,
FT                   538384..538629,538694..539074)
FT                   /locus_tag="ANIA_08891"
FT                   /old_locus_tag="AN8891.4"
FT                   /product="Exopolygalacturonase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q873X6]"
FT                   /note="transcript_id=CADANIAT00007978"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007978"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007978"
FT                   /db_xref="GOA:Q873X6"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q873X6"
FT                   /protein_id="CBF84721.1"
FT                   /translation="MRLHFLPLVALCATTASSLAFDSSTSQPPGAQVYSVNDAAGLKRI
FT                   GAHHPKYHDRRTVTIRSSHNDTDDVSADFLWGIRRANHGGRLLLKKGQKYVIGRKLDLS
FT                   FLDNVEVQLDGELKFTDDVPYWQENNFYYDFQKSISFWRWGGHDVRIFGRGTLNGNGQR
FT                   WYNEFAGQEILDPDNTYYRPILFVAENATRLSVEGITELNSPCWTNFLVNSKDISFDNV
FT                   FINAYSTNASAEPKNTDGFDSLNVNGLSVTNTRVDIGDDCFSPKPNTTNIFVQNLWCNN
FT                   THGVSMGSIGQYPGVLDIIEHAYIENVTLLNGENGARLKAWAGEDVGYGRINNITYKNI
FT                   HVENTDYPIVLDQCYFNIPADECASYPSQVNVTNIVFENVYGTSSGAEGNVVAELICSP
FT                   NAICEDIKLKGINLTTPEGEKGVVVCDGISGGVGVECQSSE"
FT   gene            complement(541316..542610)
FT                   /locus_tag="ANIA_08890"
FT                   /old_locus_tag="AN8890.4"
FT                   /product="cellobiose dehydrogenase, putative
FT                   (AFU_orthologue; AFUA_8G05805)"
FT   mRNA            complement(join(541316..542475,542536..542610))
FT                   /locus_tag="ANIA_08890"
FT                   /old_locus_tag="AN8890.4"
FT                   /note="transcript_id=CADANIAT00007979"
FT   CDS_pept        complement(join(541316..542475,542536..542581))
FT                   /locus_tag="ANIA_08890"
FT                   /old_locus_tag="AN8890.4"
FT                   /product="cellobiose dehydrogenase, putative
FT                   (AFU_orthologue; AFUA_8G05805)"
FT                   /note="transcript_id=CADANIAT00007979"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007979"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007979"
FT                   /db_xref="GOA:C8VLS9"
FT                   /db_xref="InterPro:IPR005018"
FT                   /db_xref="InterPro:IPR006593"
FT                   /db_xref="InterPro:IPR015920"
FT                   /db_xref="InterPro:IPR038697"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLS9"
FT                   /protein_id="CBF84723.1"
FT                   /translation="MKYSIFSAKALVLGLCSFVGAHIDTFSPGGQSDIFYSITAPRSTV
FT                   STGSGPIFFQIRAPTTLQWVALGQGTQMTGADIFVLYSSSSSNVTLSPRLGTGHVPPRY
FT                   NPSAKISLLEGSGIQNGVMTANVRCDTCNYLASSPWIFAYRDGTSLDSESPEAEISIHN
FT                   DFGSTNVALANAVSTMDNPFLDYDPRDPLNQPSEVGGGARSNARMLIAHGFIMSIAFVL
FT                   LFPFFGLLVAIPMRGVVAKVHAPLQIFTLSSVIAGMGLGLKMGTDGDILDHAHPILGLI
FT                   VVGLLILLQPAMGLLQHLHFRRTGKKSYFSVLHRWLGRLAIILGVITGGLGFKLVGIDS
FT                   SPYTPKSAVIAYSVIAGVMGLVYVAVQVLRTIREGARSNRDLYGRKAAEGSTDAGTNSQ
FT                   DA"
FT   gene            545407..547162
FT                   /locus_tag="ANIA_08889"
FT                   /old_locus_tag="AN8889.4"
FT                   /product="MFS sugar transporter, putative (AFU_orthologue;
FT                   AFUA_3G00220)"
FT   mRNA            join(545407..545527,545585..545668,545708..546656,
FT                   546723..547162)
FT                   /locus_tag="ANIA_08889"
FT                   /old_locus_tag="AN8889.4"
FT                   /note="transcript_id=CADANIAT00007980"
FT   CDS_pept        join(545407..545527,545585..545668,545708..546656,
FT                   546723..547074)
FT                   /locus_tag="ANIA_08889"
FT                   /old_locus_tag="AN8889.4"
FT                   /product="MFS sugar transporter, putative (AFU_orthologue;
FT                   AFUA_3G00220)"
FT                   /note="transcript_id=CADANIAT00007980"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007980"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007980"
FT                   /db_xref="GOA:Q5AS41"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS41"
FT                   /protein_id="CBF84724.1"
FT                   /translation="MTVRESQKPDNGQLAVVFETPWWSPQLRRLSFCILSLIFFSSSNG
FT                   FDGSLVNGLQSLDSWMGFMGQPSGALVSTIFAAWCSNRYGRKQCVWIGIAFILAGSILG
FT                   AAAPNDTVYIVSRAVIGVSSGMVSNAPPLLLNEIAYPAHRSISSCLFMIGYYFGAVISS
FT                   WVTFATRTYASSWSWRLPTLLQMLCPLVAIPGFLLTPESPRWLIGQNRVEEARKVLADL
FT                   HASGDLTAPLVIKEIHEIQEAISTERESAASSSYSDMITTPGNRHRLLITVTLGIFSQW
FT                   SGNGVVSYYLAMVLDTVGVTATKDQLLISGCLQIWNLIFGTIGAVLVERAGRRPLFLTS
FT                   AGVMLVSYIIITGLSGSFASTGSAPMGTAVIPFIFIYFAGYDIALTPLLVAYPCEIWPF
FT                   ALRSRGLSVAWFSAIGALIFNTFVNPIALSAIGWRYYFVFVAILICYGLTSWFVYPETK
FT                   GYNLESISHIFDGNHQPGHDSEKATSSEDCIEKVPESREVERV"
FT   gene            547278..547807
FT                   /locus_tag="ANIA_08888"
FT                   /old_locus_tag="AN8888.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            547278..547807
FT                   /locus_tag="ANIA_08888"
FT                   /old_locus_tag="AN8888.4"
FT                   /note="transcript_id=CADANIAT00007981"
FT   CDS_pept        547358..547777
FT                   /locus_tag="ANIA_08888"
FT                   /old_locus_tag="AN8888.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007981"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007981"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007981"
FT                   /db_xref="GOA:C8VLT1"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT1"
FT                   /protein_id="CBF84726.1"
FT                   /translation="MSYYNALIRTHHITSRKKVSALKRAADSLNVFALLRSGGCPGIMY
FT                   IEAKDKDAVESWVSVVRNLRYKDFQLVSRPACVVIEEDFMKVEGKQKNDAQRRGKAFLD
FT                   AGLEEVESVKEFGDLMAQRGVWQWWRKRMGYVRGD"
FT   gene            complement(548595..549410)
FT                   /pseudo
FT                   /locus_tag="ANIA_11148"
FT                   /old_locus_tag="AN11148.4"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(548595..548720,548813..549410))
FT                   /pseudo
FT                   /locus_tag="ANIA_11148"
FT                   /old_locus_tag="AN11148.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00010578"
FT   gene            complement(549606..550553)
FT                   /locus_tag="ANIA_11141"
FT                   /old_locus_tag="AN11141.4"
FT                   /product="alphaN-acetylglucosamine transferase
FT                   (AFU_orthologue; AFUA_8G02690)"
FT   mRNA            complement(join(549606..550291,550370..550553))
FT                   /locus_tag="ANIA_11141"
FT                   /old_locus_tag="AN11141.4"
FT                   /note="transcript_id=CADANIAT00007982"
FT   CDS_pept        complement(join(549606..550291,550370..550553))
FT                   /locus_tag="ANIA_11141"
FT                   /old_locus_tag="AN11141.4"
FT                   /product="alphaN-acetylglucosamine transferase
FT                   (AFU_orthologue; AFUA_8G02690)"
FT                   /note="transcript_id=CADANIAT00007982"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007982"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007982"
FT                   /db_xref="GOA:C8VLT2"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR030518"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT2"
FT                   /protein_id="CBF84729.1"
FT                   /translation="MVFDALERFGSRAQRVLYYPKDWDVIADSDNDRDRQLLRLAKVKY
FT                   KAMLVPIELEMIKPDAGPGEEWEKSISKLLAFAETEFNRVIHLDSDVLLLQSMDELFFL
FT                   PHTPVAMPRAYWLLPEQKVLSSLLLVIEPSYRRYKALLDTALGIEGTEGENKRNKYDME
FT                   LLNEFYGNSAMVLPHRQYGLVSGEFRSENHTMFLGSDDEVWDPDKVLADAKFVHFSDWP
FT                   LPKPWVMWPHQILADILPKCKVNPGSLHESGCRDRDVWMKLYDDFRIKRRVRRTFYQPP
FT                   FPSIKVTR"
FT   gene            complement(551020..553912)
FT                   /locus_tag="ANIA_08886"
FT                   /old_locus_tag="AN8886.4"
FT                   /product="repressor protein (AFU_orthologue; AFUA_8G02700)"
FT   mRNA            complement(join(551020..551320,551425..553912))
FT                   /locus_tag="ANIA_08886"
FT                   /old_locus_tag="AN8886.4"
FT                   /note="transcript_id=CADANIAT00007983"
FT   CDS_pept        complement(join(551069..551320,551425..553587))
FT                   /locus_tag="ANIA_08886"
FT                   /old_locus_tag="AN8886.4"
FT                   /product="repressor protein (AFU_orthologue; AFUA_8G02700)"
FT                   /note="transcript_id=CADANIAT00007983"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007983"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007983"
FT                   /db_xref="GOA:Q5AS44"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS44"
FT                   /protein_id="CBF84731.1"
FT                   /translation="MPHCSGADVYRRVDPEASLVLIGIRGCGKRSLGFVAATALKRRFI
FT                   TEDHYFKEVTGLSRHEYLKQHGSQNFQQRDIEVLKLMLDNHRSRCVIECGLGTLTRPVQ
FT                   EYLRQYSLTNPVVYIARDMDRIQKLLGFDDQAAKLLCEGDPLHRTCSNFEYYNAEDRSS
FT                   FAQLDEETQDRRSVVYSFKLKEAKEDFTRFVRFVTGTDVGHSSYDSPFVLLETPPELRS
FT                   YTYAIFVRSSDMIDNRVRLSELESGGDAIELCVDRWGPNMAMTVSKQVSILRRNTHAPI
FT                   ILSIDTRSLGITGGDQYPIKGSNVYAQIVEHCLRLAVEYLVVDLDQDQALINETIRNRG
FT                   MTKIIGQRIFEPSSGVSWDNEECLSAYLNAAGLGCQLVRILRVATEREDNAAIAKFTNR
FT                   IELLPGDHPPVIAFNLGSLGRTSQVFNSILTSVSHSAIDRLSHNERDPQIMARDAVQAL
FT                   FQSYVLDPLQFYILGGSVAYSLSPAMYNAAFRHCGMNHTYSIPEKPTLAALDELGRDPN
FT                   FGGASIVQPWRVQVFQKLAAKSRHAEAIGAINTIMPLRGHSDGTMFPLQEQASRRHLAG
FT                   PVLGWYGENTDWVGIMTCINRNLSPRNAISPSRTTGLVIGAGGMARAAIYAMLRLGCRK
FT                   IFIYNRTLSRAETVARHFNSWAASQVGSTEVVYVLRSLHEEWPQDACPPCMVASCVPAD
FT                   PDRDEPPANFEMPTQWLGSPTGGVVLEFAYKPLETPLLRQMRRFRSETGRQWELVDGLD
FT                   NVAEQAIAQFEILTGRKAPRRLMTMEALRNYAGENGPFDEKTIRARINIYE"
FT   gene            555164..558181
FT                   /locus_tag="ANIA_08885"
FT                   /old_locus_tag="AN8885.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(555164..555241,555297..557831,558004..558098,
FT                   558142..558181)
FT                   /locus_tag="ANIA_08885"
FT                   /old_locus_tag="AN8885.4"
FT                   /note="transcript_id=CADANIAT00007984"
FT   CDS_pept        join(555164..555241,555297..557831,558004..558098,
FT                   558142..558181)
FT                   /locus_tag="ANIA_08885"
FT                   /old_locus_tag="AN8885.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007984"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007984"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007984"
FT                   /db_xref="GOA:Q5AS45"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS45"
FT                   /protein_id="CBF84733.1"
FT                   /translation="MDEGPDSKAPRRKRVSRACDRCRSKKDKCDGLRPSCSACLASGQT
FT                   CSYDPHAKKRGLPEGYVRGLEKLWALAICNIDGFEDTMLSLLGTTADSVGRRNKLISLW
FT                   VDEAASETLHESWKTCRLYNALEKMLSSSSGPSSPRNAGKRPREEHGSLLNETGSEWGF
FT                   RIDRSSTPLSQDAPRVVEPGASPPVKRARLSLLGDSRLSSATNGLHALQLPPNTSQLLD
FT                   TYFAATHSWFPIVAKHNILRASYLYANAPSISVARLSPGSGDHAALWALLSYTVFLSRS
FT                   SPESGSFGVLSKAKEHYAVARSLIPSETEHYELGHVQALLLLTLVNIGLEDWTAAWMLS
FT                   GQAVRMVVPMDVAAFSDARRPEESRQGKAVFLGCFVIDSLLSFRLSRRPSMHSRDLVAV
FT                   GLLEEDGLEEWNSWADVLLLSGNSQGKNPPRRGPLQSLSCFNRLVELASVLNKIARDSI
FT                   TGPSAHIFAQQLVSELKQWDDRLPLGCRLIGPESIYPERHSALLPHQTYLGLTYIATLL
FT                   LLYLRIAPHELGMHRSQRPATEGAKKLLYRALPMLAQHLDNFSVCSLPPVFELSLRTIA
FT                   EQAFALRNKIESDLFPYGRWTEALVQRTSELSTTWPVYRTLTTNIERWCRSKNAVANSP
FT                   SQPFAHDSNNNPARGMNRPSNYSPSQNSLSMPSTENRGFERDSQLPPFARRNTIDVVEP
FT                   NYSSSIMGIAIPVDGQYMTPKDTTMESSDAPFPPQSINNSQSHNPKMSSSAMDILDPAN
FT                   ELDAMLDGPSHPHPPTPDSSMSNPPVSGTSTTNAAAPANEQTTALADKSNSASTSDNQI
FT                   QGDTSAASLDAIFKDLAYLDTTEWATSREAGLKDFGFMDDTTFQEFCHDPDRLAGSQPL
FT                   LCLCDTHTCENKVFLASIRIGPSAASNGFRDMIFMDIVLEQAML"
FT   gene            complement(558286..559612)
FT                   /locus_tag="ANIA_11144"
FT                   /old_locus_tag="AN11144.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(558286..558621,558677..559612))
FT                   /locus_tag="ANIA_11144"
FT                   /old_locus_tag="AN11144.4"
FT                   /note="transcript_id=CADANIAT00007985"
FT   CDS_pept        complement(join(558286..558621,558677..559612))
FT                   /locus_tag="ANIA_11144"
FT                   /old_locus_tag="AN11144.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007985"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007985"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007985"
FT                   /db_xref="GOA:C8VLT5"
FT                   /db_xref="InterPro:IPR003378"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT5"
FT                   /protein_id="CBF84735.1"
FT                   /translation="MRKDWAFSDNSGATTDWQIKNVTNAPKYDNMTACAHLPGMDKVLV
FT                   ILKTGATEALDKIPVHLRTTLECVQHYVIFSDFEEYIYGVHVQDVLRSVSEGMKQTNSD
FT                   FGIYNRLRASGRGGLTADDWRDDENGPLGKQGNPGWKLDKWKFVPMIDEALLASPWAHW
FT                   YVFLEADTYIVWRNMVRWLSQLDQRKALYLGAPMQMGSQIFAYGGAGIVLSRTAMRLIS
FT                   QYRAQNFTVVEQMTADDWAGDHVLGRILGDIGVPLIWSWPLLVPSSIWEFEYFTKAYGR
FT                   QPWCYPAVSFHHMSTQDIWDMWLLEQQWFKYQVDVPLLHKDIFNWKLYDAISSMKDDWD
FT                   NISSDQQPRNISDSPTTSEECKQRCSLITDCLQFSFSHEGCRTSKKVVGGVPRPGFHSG
FT                   WVATRIKALIKNAGRCSKAQYITG"
FT   gene            complement(561159..562955)
FT                   /pseudo
FT                   /locus_tag="ANIA_11140"
FT                   /old_locus_tag="AN11140.4"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(561159..562083,562139..562955))
FT                   /pseudo
FT                   /locus_tag="ANIA_11140"
FT                   /old_locus_tag="AN11140.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00010579"
FT   gene            564859..565478
FT                   /locus_tag="ANIA_11633"
FT                   /old_locus_tag="AN11633.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(564859..564952,565122..565184,565294..565333,
FT                   565424..565478)
FT                   /locus_tag="ANIA_11633"
FT                   /old_locus_tag="AN11633.4"
FT                   /note="transcript_id=CADANIAT00007986"
FT   CDS_pept        join(564859..564952,565122..565184,565294..565333,
FT                   565424..565478)
FT                   /locus_tag="ANIA_11633"
FT                   /old_locus_tag="AN11633.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007986"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007986"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007986"
FT                   /db_xref="GOA:C8VLT6"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT6"
FT                   /protein_id="CBF84738.1"
FT                   /translation="MLLYPPTFVLGRWSRPAAVLRTSGIHALTFERFLFPAIEGHWAYC
FT                   DSQNIAFPSREPYGLDSPDMKRWQQTYVISLDEIRQCD"
FT   gene            566320..567250
FT                   /locus_tag="ANIA_08883"
FT                   /old_locus_tag="AN8883.4"
FT                   /product="RNA binding protein Tma22, putative
FT                   (AFU_orthologue; AFUA_8G02730)"
FT   mRNA            join(566320..566464,566530..566549,566685..566772,
FT                   566829..567250)
FT                   /locus_tag="ANIA_08883"
FT                   /old_locus_tag="AN8883.4"
FT                   /note="transcript_id=CADANIAT00007987"
FT   CDS_pept        join(566404..566464,566530..566549,566685..566772,
FT                   566829..567250)
FT                   /locus_tag="ANIA_08883"
FT                   /old_locus_tag="AN8883.4"
FT                   /product="RNA binding protein Tma22, putative
FT                   (AFU_orthologue; AFUA_8G02730)"
FT                   /note="transcript_id=CADANIAT00007987"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007987"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007987"
FT                   /db_xref="GOA:C8VLT7"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT7"
FT                   /protein_id="CBF84739.1"
FT                   /translation="MAEVSQPPAETQARQITYCGVCTLPPEYCEFGGTAKKCQEWLKDN
FT                   RLEEYQRLYSDEAISANLSTLSVSVQERAAKDAAKKEAKAAAAEARDAERRATSKVQIK
FT                   RVERNKRKHVSVVTGLEVYGLENKKVAKELGKKFATGSSVTKSASGIEEITVQGDVCED
FT                   IKEWLLENYGKGISESNIEIVEDKKKKKGTAEA"
FT   gene            complement(567382..568426)
FT                   /locus_tag="ANIA_08882"
FT                   /old_locus_tag="AN8882.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(567382..568099,568143..568426))
FT                   /locus_tag="ANIA_08882"
FT                   /old_locus_tag="AN8882.4"
FT                   /note="transcript_id=CADANIAT00007988"
FT   CDS_pept        complement(join(567382..568099,568143..568426))
FT                   /locus_tag="ANIA_08882"
FT                   /old_locus_tag="AN8882.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007988"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007988"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007988"
FT                   /db_xref="GOA:C8VLT8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT8"
FT                   /protein_id="CBF84741.1"
FT                   /translation="MHHVSSRADGRGSISTYQQQESEEDGMLRPSARENTQSRWGSVST
FT                   GLESRRDSVFYGIDKDIRLGSIKRPEEIHSMDDLQRVRDLRSRGEQYVILYLRSALSAV
FT                   GTLATDITRRLDYTYYGLLEKIAALTMTIVSLQELSDTTSKLFDDFQQETTGLEHDIRK
FT                   QIGDLHEFQPQVQRIEALEERMRASKTRAKALSNRLDAMRSEIERWDKREMEWQMRTNQ
FT                   RLRIFWGIITSVILAALVFIILQHWPSEETSSGFKALPRSLKLTNNPSHIPHPKENDAF
FT                   SPSSRSEYAMTLESSNLDGTTSTVQKDPSTSVGADKATRSADYDPLRIFDEL"
FT   gene            complement(569271..569980)
FT                   /locus_tag="ANIA_11145"
FT                   /old_locus_tag="AN11145.4"
FT                   /product="rRNA-processing protein cgrA
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q9Y708]"
FT   mRNA            complement(join(569271..569396,569453..569607,
FT                   569678..569823,569904..569980))
FT                   /locus_tag="ANIA_11145"
FT                   /old_locus_tag="AN11145.4"
FT                   /note="transcript_id=CADANIAT00007989"
FT   CDS_pept        complement(join(569467..569607,569678..569823,
FT                   569904..569961))
FT                   /locus_tag="ANIA_11145"
FT                   /old_locus_tag="AN11145.4"
FT                   /product="rRNA-processing protein cgrA
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q9Y708]"
FT                   /note="transcript_id=CADANIAT00007989"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007989"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007989"
FT                   /db_xref="GOA:Q9Y708"
FT                   /db_xref="InterPro:IPR005579"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y708"
FT                   /protein_id="CBF84743.1"
FT                   /translation="MSSAAPAPSTHAAKSIRKNGKNWHDNKKPFRPNGGLTSYTKRAAA
FT                   RKEQEAIKEYEKELREEREAERQAHIQRIKERRAAKEEKERYEKMAEKMHRKRVERLKK
FT                   REKRNKLLNS"
FT   gene            570199..571925
FT                   /locus_tag="ANIA_08881"
FT                   /old_locus_tag="AN8881.4"
FT                   /product="Mitochondrial carrier AMCAPutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q8X1Z8]"
FT   mRNA            join(570199..570644,570699..571925)
FT                   /locus_tag="ANIA_08881"
FT                   /old_locus_tag="AN8881.4"
FT                   /note="transcript_id=CADANIAT00007990"
FT   CDS_pept        join(570534..570644,570699..571568)
FT                   /locus_tag="ANIA_08881"
FT                   /old_locus_tag="AN8881.4"
FT                   /product="Mitochondrial carrier AMCAPutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q8X1Z8]"
FT                   /note="transcript_id=CADANIAT00007990"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007990"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007990"
FT                   /db_xref="GOA:G5EB14"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB14"
FT                   /protein_id="CBF84745.1"
FT                   /translation="MAATESALTIHNDISMELPELAPNQGLEAFKDIVFGSAAGMIGKV
FT                   IEYPFDTVKVRLQSQPDHLPLRYNGPLDCFRQSFQAEGLRGLYRGISAPMAGAAVENSC
FT                   LFFSYRVVQELLQASYYSSTEPLPLTALVFSGAASGSITSLALTPIELIKCKMQVPSEP
FT                   SSARVGPLKIIVSVFRQDGVLGFWRGQLGTLIRETGGGAAWFGGYEGVSALFRSYHYSP
FT                   STTFSSEVESGSLPLYQQMLAGAAAGVSYNFLFYPADTIKSRLQTEDINNTSSKRQTFG
FT                   GAARALWHQQGLRGLYRGCGITCARSAPSSAFIFTVFEGLRSYFG"
FT   gene            571957..572795
FT                   /locus_tag="ANIA_11146"
FT                   /old_locus_tag="AN11146.4"
FT                   /product="cytidine deaminase, putative (AFU_orthologue;
FT                   AFUA_8G02770)"
FT   mRNA            join(571957..572048,572127..572260,572364..572449,
FT                   572542..572623,572716..572795)
FT                   /locus_tag="ANIA_11146"
FT                   /old_locus_tag="AN11146.4"
FT                   /note="transcript_id=CADANIAT00007991"
FT   CDS_pept        join(571976..572048,572127..572260,572364..572449,
FT                   572542..572623,572716..572757)
FT                   /locus_tag="ANIA_11146"
FT                   /old_locus_tag="AN11146.4"
FT                   /product="cytidine deaminase, putative (AFU_orthologue;
FT                   AFUA_8G02770)"
FT                   /note="transcript_id=CADANIAT00007991"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007991"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007991"
FT                   /db_xref="GOA:C8VLU1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLU1"
FT                   /protein_id="CBF84747.1"
FT                   /translation="MASLTAEEIELLASKANAAKEAAYCPYSKFRVGAALLTQSGEFFT
FT                   GANVENASYPVGTCAERVAFGTAVVAGHRRFKAIAVATDIKPPASPCGMCRQFMSEFTT
FT                   RSFPVYMYDKEMNCSIISMGELLPNSFGPEDFEH"
FT   gene            complement(573136..577599)
FT                   /locus_tag="ANIA_08880"
FT                   /old_locus_tag="AN8880.4"
FT                   /product="vacuolar protein sorting protein, putative
FT                   (AFU_orthologue; AFUA_8G02780)"
FT   mRNA            complement(join(573136..573772,573824..577599))
FT                   /locus_tag="ANIA_08880"
FT                   /old_locus_tag="AN8880.4"
FT                   /note="transcript_id=CADANIAT00007992"
FT   CDS_pept        complement(join(573136..573772,573824..577599))
FT                   /locus_tag="ANIA_08880"
FT                   /old_locus_tag="AN8880.4"
FT                   /product="vacuolar protein sorting protein, putative
FT                   (AFU_orthologue; AFUA_8G02780)"
FT                   /note="transcript_id=CADANIAT00007992"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007992"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007992"
FT                   /db_xref="GOA:Q5AS50"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031777"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AS50"
FT                   /protein_id="CBF84749.1"
FT                   /translation="MIPRWIQLVGCLLLALMLPPSAAKKDKPGISFHKLHEKPYSMFYF
FT                   EKSDTVLLNLEDGEVLRSFDAGENWEVIEDNGMKHGVTSIHQHPFDEDKAYALGDDGKH
FT                   WITTDKAKTWKSFKVPDQAYFKSPQTGPLTFHGRDSSKVIFETRPCPSCAPRSYYTTDD
FT                   FDTIEVLTESAVGCYWAVGNPQFAAGPNMPKGMEERTVCVVPGLKASSRFAFRLVYSDD
FT                   YFRSQGIETKLQDGRPVSGVTSIAQVKSFIVAAVESQGTTERALYVTTDIEKWHRAEFG
FT                   DHRLEQDAYTVLESSDYSLQVDVLTNPFSGMGVLFTSNSDGTYFTRNIEHTNRGPRGYV
FT                   DFEKLAAIQGIVLVNTVRNPDDVEAGASKEVVSQISFDDGRTFQPLKSTDGQRIHLHSV
FT                   NSDTNLGRVFSSPAPGLVMGVGNTGDYLGKRSDGHLYVSDDAGLTWRLALKGPHKYEFG
FT                   DQGAVLVAISEAPKVKKIEYSLDHGKEWKSVDLPHEVDGETSTLTTTPDSTSLKFILLG
FT                   HSKGEPSVYAIDFEDLHERKCEDEDFDNHWPARLDEHGEPDCLMGQKQFFRRRKANADC
FT                   FVAEAFNSSMSKFEPCKCTVEDFECQSTRTEDGKDCVPPKSFTPPDGDCINPDDTTMIP
FT                   SGWRLIPGDVCVRDDGVNLDKDVEIPCKDVNNRPKSKEITSTMKMFSSGLSAYRYLERQ
FT                   VSNLGEDETVLMLSRNQELFVSHDHGQTWQQELKGASIMKIVPHPYNSDTAYILTDSEE
FT                   VFYTINRGATFGSFRAKTLPDYENGPILRFHPLKRDWLLWVGTECDSGSCHSNAYFSDD
FT                   RGDSWKTILRHAKKCEFEYKENRPDSLYLVFCEQYENEDDKKRLQLMSTTDERFSDWET
FT                   VEENLVEYATRAEYIILASHTDKDNALKARVSVDGTTFADLKFPPNVVPAQNLYTLVDA
FT                   SEHAIFLYVGGSNNTGSLIKSNSNGTTYVLSLDAVNQNDWGYVDFERMQALEGVIIANI
FT                   VSNVDELSDGAPKRLRTMITHNDGGEWTLLAPPTKDANGKKFPCSVVEGKGTEDCALHL
FT                   HGYTERADPRDTFSSGSAIGLMMGLGNVGDRLTSKDEADTFLTMDGGITWKSVKKGRYM
FT                   WEYGDSGSVIVIVSEQKSTKVLHYSTDEGATWQDYYFSDEEIEVIDISTVPSDTSKKFI
FT                   LWGKKSDELVTVNVDFSGLYDRDCEFDDKGGDVSDDYQLWTPKHPFQEENCLFGHVEQY
FT                   RRKKPSAECWNNWRGPHLHSIQRNCTCTTADYECDYNYERQNDGTCKLVPGLKPHDPVG
FT                   YCKAHPDAIEYFEPTGYRRIPQTTCQGGYNLDHQTAKPCPGKQQEYDKKHGISGIGLFF
FT                   AIVAPIAVAGAVGYYIYTKWDGKFGQIRLGETSTGTQGILSRDSLLVTVPIAIIAGIVA
FT                   VAKALPLLVTSLWRSASGYMRVGNRSYPRPYASRASFAARRGDYSSVVEDEDELLGVVD
FT                   FDGDEEEDS"
FT   gene            complement(579733..582616)
FT                   /locus_tag="ANIA_08879"
FT                   /old_locus_tag="AN8879.4"
FT                   /product="Exocyst complex component Sec10, putative
FT                   (Eurofung)"
FT   mRNA            complement(join(579733..580410,580466..580535,
FT                   580619..580674,580709..582616))
FT                   /locus_tag="ANIA_08879"
FT                   /old_locus_tag="AN8879.4"
FT                   /note="transcript_id=CADANIAT00007993"
FT   CDS_pept        complement(join(579907..580410,580466..580535,
FT                   580619..580674,580709..582616))
FT                   /locus_tag="ANIA_08879"
FT                   /old_locus_tag="AN8879.4"
FT                   /product="Exocyst complex component Sec10, putative
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007993"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007993"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007993"
FT                   /db_xref="GOA:Q5AS51"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="InterPro:IPR033960"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS51"
FT                   /protein_id="CBF84751.1"
FT                   /translation="MSLHSNAASRSVFPKGPSFTLEDFSSRDYIVKEFIEALSDSAISS
FT                   RRSSLGPANGNQPFDPKPLIRTFEHAQRRLGELSGDLEIRENELSAAVRRAEAQHSQNL
FT                   NILGRKLKQAIESFQQLDTSFQSAGPGDTALGSGNMAVETGRRLEELDRQRRRALDAHF
FT                   LLECWDGVSNRGEIILLENLRRSGSGEAKVRSAHIARQLLRISQRLDPKSWNESRSTEP
FT                   YNDGHLAPNSNNMEGTNGFRWNTREIIEKFSETLEKDLLRQFDDFYRKANFEGMKDCAT
FT                   VLQDFNGGASVVALFVNQHQFFIDRSQLVTEEVGGDPESWEKLADPDAEPSGVEPSLQS
FT                   LVDEVRVVVQEESAIIRRAFPNYEQVLGKFLQRVFQQSIQQRLEMVLEKANSVSSLAFL
FT                   RSLQSSRSCISTLVDELKAHGLTEHPETISSQTSLILDQQLEDLFVPYFVGSSYIEREK
FT                   RTLEELYTSLLFKFTTFHGRRKKAATTFMASLSKSGSELLASAREAYINRLDSSEHSPT
FT                   QKRVLIQVADLKESTDLARPNDLIFTEEDGQPSISYAKRMLKWLAEAVGRGLELNMNNE
FT                   TPKDMATFLNLLLSIMGEGYLEVCLDAALEAAATQESGRTEPDFAFLRAVRDSISIANL
FT                   MQQGALPFVERWKRRPTWQLQKKNDFRPKEGDSTAWLEKLQTPTCASLCAFLARVHDVA
FT                   VSSLPASGANLPQLLSEIALGTRSLLLEHFKRFVVNGPGGLMVTKDMTQYANLLKSWEI
FT                   DEQIRAPSGMLDVLLEVGSLFVIGPEALRERMRGPGGSSSGKTSSNPGATSARGPGVTS
FT                   TEAGLSIQDVRAYVFRREDSNTPAMQQMLTNAL"
FT   gene            583152..584493
FT                   /locus_tag="ANIA_08878"
FT                   /old_locus_tag="AN8878.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(583152..583641,583689..584493)
FT                   /locus_tag="ANIA_08878"
FT                   /old_locus_tag="AN8878.4"
FT                   /note="transcript_id=CADANIAT00007994"
FT   CDS_pept        join(583152..583641,583689..584260)
FT                   /locus_tag="ANIA_08878"
FT                   /old_locus_tag="AN8878.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007994"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007994"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007994"
FT                   /db_xref="GOA:Q5AS52"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="InterPro:IPR038887"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS52"
FT                   /protein_id="CBF84753.1"
FT                   /translation="MVSRRDRELLRDNIRSRGAKLSATDRENIMKPYLPDPSELPRWPP
FT                   QRRRKLPRKTPIRTFIKSQIHLITYTFLHIFFGIAVRLVQTYHAVLDRILAIIYYHHRT
FT                   PELIRKDVKDLDRLPGHLSVILSLRKEDDALPILMDEVAELVSWSASAGIPVLSVYEKS
FT                   GLLKSCIPMLHQVITNKLSSYFGSLQQPTLQLFAPHHPIYKTRPAGDAAKNSLVVLLLS
FT                   ATDGQETLVDLTKTLAEMSQNGKLSPDDITMELVDAEISEITTQPSQDVAPTANDHKVS
FT                   KPLQVKPEPDLLLVFGPSLKLNGYPPWHIRLTEMYCTGVNSDGFTGYGDNVEYQGFLRG
FT                   LWHYAGAQMRFGR"
FT   gene            585690..587414
FT                   /locus_tag="ANIA_08877"
FT                   /old_locus_tag="AN8877.4"
FT                   /product="ELMO/CED-12 family protein (AFU_orthologue;
FT                   AFUA_8G02810)"
FT   mRNA            join(585690..585953,586014..587414)
FT                   /locus_tag="ANIA_08877"
FT                   /old_locus_tag="AN8877.4"
FT                   /note="transcript_id=CADANIAT00007995"
FT   CDS_pept        join(585690..585953,586014..587414)
FT                   /locus_tag="ANIA_08877"
FT                   /old_locus_tag="AN8877.4"
FT                   /product="ELMO/CED-12 family protein (AFU_orthologue;
FT                   AFUA_8G02810)"
FT                   /note="transcript_id=CADANIAT00007995"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007995"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007995"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR006816"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024574"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS53"
FT                   /protein_id="CBF84754.1"
FT                   /translation="MDSNVSELVERLGSEEDAVRKMAVFKLQSSIGDPSFADVFIAEDG
FT                   LTRLRYLTLHATGNTLAYSLTSFARLLEVDKGWECVDHELVERVVELIVTHPLVNILRG
FT                   AMSILVSIVSHPSSVGRLSQNAVWGFRALKPAIAIYPQFLEMLVNRLSSADHALCANAL
FT                   QLINSLMRDSITNDSDHEWPKFIQKLQDLGVIKAVYSLMQGTALQDHAHPLIEFQSLTK
FT                   ILLRKWRDTALDLENPEHRRALKGIHLASSQEKGNETGADMRRSKKHSPEKWRRLGFES
FT                   ESPVAQFEDMGFLGMMDLADYVRNHQDEFQKMLLEQSTKPARQRCPIARASLSVTSILY
FT                   DHFEVDKCETEDSKTYLILESRSNLDKLFKPLLLHWTRLHVAGLHSFFRLWKSTSAELE
FT                   DYDKIVELVRILIESVVGGAARTKDVQDVEEDLMEFEYSRLRDLQMELLELTYEDAWGQ
FT                   HLRQVREELQHEAAQFVKEQRIRCLLQGAWFPNENISELEGESGSPKWRYVQLSHNRRI
FT                   LHFGDFESMEMNRLDLDVLPGKSEVPLQPAIFELLAN"
FT   gene            588281..590723
FT                   /locus_tag="ANIA_08876"
FT                   /old_locus_tag="AN8876.4"
FT                   /product="cell cycle checkpoint protein Rad17, putative
FT                   (AFU_orthologue; AFUA_8G02820)"
FT   mRNA            join(588281..588827,588903..590723)
FT                   /locus_tag="ANIA_08876"
FT                   /old_locus_tag="AN8876.4"
FT                   /note="transcript_id=CADANIAT00007996"
FT   CDS_pept        join(588327..588827,588903..590702)
FT                   /locus_tag="ANIA_08876"
FT                   /old_locus_tag="AN8876.4"
FT                   /product="cell cycle checkpoint protein Rad17, putative
FT                   (AFU_orthologue; AFUA_8G02820)"
FT                   /note="transcript_id=CADANIAT00007996"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007996"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007996"
FT                   /db_xref="GOA:C8VLU6"
FT                   /db_xref="InterPro:IPR004582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLU6"
FT                   /protein_id="CBF84756.1"
FT                   /translation="MRNHKTQQLSDTTVCGLLQSASEPNYSHRRWPNSQMPGSAGTADV
FT                   DDNEDSIEDDYDSYDDLFTQHFTDEKLSHLDGIKVAPRPQNRAISPIGNAKDQTAKNAK
FT                   HFFWKSVSPSNNELPNPTPSEKGALPWAQRYAPLNLDELAVHKRKVGDVERWLSDALEG
FT                   KTRKNLLILRGPAGSGKTTTISLLSKKLRFDVLEWKTPSTVTYSSKDYVSFGAQFDGFL
FT                   SRSHIFGSLTLDGHHSSQVPLNNDHASQRRVILIEEFPTMAARNTTVLASFRLSILRYL
FT                   SLNGPHGGNTYGREVRVPPIVMVVSETFSSTESSFNNLTTHQLLGRELYNHPDTTIIEF
FT                   NSIAPTFMHKALNLVLKKSSCQPCGNQTLTQSIIENISKIGDIRNAIASLEFICLGNGN
FT                   KGYWSDPTVKTRRTARTRMKNTAVGSEMREEIAQREASLGLFHAVGKIIYNKRSDASDA
FT                   EHVQLPSPPDHLRDHDRPTVSMVHVNELLDETGTDIQLFIGTLHENYVPSCNGSSFTEC
FT                   LEGCIGFLSDSDMLCYDRKDRSKFQAGLGIGTVKIETGGVDVLRQEEISYQVAARGLLF
FT                   SLPYPVRRQLSYARNIKQAGDSHKVFFPPVIRLVRQLQEISNQIDSWKDALLSSTVRPT
FT                   AVPMKDHTTREFISGKGKSLQGNRDEESPSLVAMLSRSDLILHQLPYLTKIVGKGTMSK
FT                   NLQQSTGFGAGGSDFTSQHDEDYDFEPSFCEAPGPKSRLEKRIGLSEPQTTLSSQTTDE
FT                   RLVLSDDDIIDDL"
FT   gene            590932..592472
FT                   /locus_tag="ANIA_08875"
FT                   /old_locus_tag="AN8875.4"
FT                   /product="UDP-N-acetylglucosamine transporter, putative
FT                   (Eurofung)"
FT   mRNA            join(590932..591207,591261..591286,591321..591356,
FT                   591683..591886,591977..592194,592228..592472)
FT                   /locus_tag="ANIA_08875"
FT                   /old_locus_tag="AN8875.4"
FT                   /note="transcript_id=CADANIAT00007997"
FT   CDS_pept        join(590932..591207,591261..591286,591321..591356,
FT                   591683..591886,591977..592194,592228..592472)
FT                   /locus_tag="ANIA_08875"
FT                   /old_locus_tag="AN8875.4"
FT                   /product="UDP-N-acetylglucosamine transporter, putative
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007997"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007997"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007997"
FT                   /db_xref="GOA:Q5AS55"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS55"
FT                   /protein_id="CBF84758.1"
FT                   /translation="MTMTTEPSARDSFVENDIRLTENGHKLKLRSGHSDPARSGGATTD
FT                   LGKRRRDADKSIHNMPGIAAVAIQTAFAHWTSIILMISLIFGGCCANVFALEAIVKFAN
FT                   LMQRSTRFRYSRGQILSVALLTFGVVTSALADAQAKGEAVQFGGSGSSNIYSTFIGFAI
FT                   LALAMLLSAFQGIYADRLLLTQWRTLNSSPSLLYHIRALLNPMGHPTELPASDETAGAS
FT                   NSCAISTSNPAEAFLQLLVTCRVYEGFQPILANALTQYWCIRGVHLLSAKSSSLTVTIV
FT                   LNIRKLVSLLLSIHLFGNALSKGVVMGAILVFVGGSLYGFEGARLRRAAQKKD"
FT   gene            complement(592600..595460)
FT                   /locus_tag="ANIA_08874"
FT                   /old_locus_tag="AN8874.4"
FT                   /product="dynamin-like GTPase Dnm1, putative
FT                   (AFU_orthologue; AFUA_8G02840)"
FT   mRNA            complement(join(592600..593078,593140..595110,
FT                   595176..595460))
FT                   /locus_tag="ANIA_08874"
FT                   /old_locus_tag="AN8874.4"
FT                   /note="transcript_id=CADANIAT00007998"
FT   CDS_pept        complement(join(592764..593078,593140..595110,
FT                   595176..595274))
FT                   /locus_tag="ANIA_08874"
FT                   /old_locus_tag="AN8874.4"
FT                   /product="dynamin-like GTPase Dnm1, putative
FT                   (AFU_orthologue; AFUA_8G02840)"
FT                   /note="transcript_id=CADANIAT00007998"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007998"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007998"
FT                   /db_xref="GOA:Q5AS56"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS56"
FT                   /protein_id="CBF84760.1"
FT                   /translation="MAALGENLLVTVNKLQDLVFNTIGNDSLDLPQIVVVGSQSSGKSS
FT                   VLENIVGRDFLPRGSGIVTRRPLILQLINIPSERHDKPETDEVHVPHTAASVAGQNEWA
FT                   EFHHQPGRKFDDFALVKQEIEAETARIAGNNKGINRQPINLKIFSPHVLNLTMVDLPGL
FT                   TKVPIGDQPSDIEKQTRALILEYIAKPNSIILAVSPANVDLVNSESLKLARQVDPMGRR
FT                   TIGVLTKLDLMDHGTNAMDILSGRVYPLKLGFIGVVNRSQQDIQSGKSLSEALQAELDF
FT                   FRHHPAYRNMANRCGTQFLAKTLNSTLMSHIRDRLPDIKARLNTLMGQTQQELASYGNK
FT                   QFSGKEHRGSLILQLMTRFASSFISSIDGTSSEISTKELCGGARIYYIFNSVFGNSLDT
FT                   IDPTQNLSISDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLEPPSQRCVELVYEEL
FT                   IKICHTCGSQELLRFPRLQAKLIEVVSDLLRERLGPCSSYVESLISIQRAYINTNHPNF
FT                   LGAAAAMSSIIQSKQDQERKAALAEERRKREKRRIKELGGPNGNAPTHPEDEEEQPETK
FT                   NLPIRTQSSKGTRSMSPHIGKISDTGITATLNGTHSNPPTAFGGANTTRDSFLNYFFGK
FT                   DGAQPQLTTSASPNQNQTRQSIHEVNVSSNARRTEMLSPVDDYTTVPEYNEASSVLKDD
FT                   SEPAISERELMETELIRRLISSYFTIVRETIADQVPKAIMHLLVNHSKDVVQNRLVSEL
FT                   YKEEFFAELLYEDDGIKAEREKCERLLETYKAAAKIVGEVL"
FT   gene            complement(597693..598251)
FT                   /locus_tag="ANIA_11147"
FT                   /old_locus_tag="AN11147.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(597693..597873,597970..598251))
FT                   /locus_tag="ANIA_11147"
FT                   /old_locus_tag="AN11147.4"
FT                   /note="transcript_id=CADANIAT00007999"
FT   CDS_pept        complement(join(597787..597873,597970..598239))
FT                   /locus_tag="ANIA_11147"
FT                   /old_locus_tag="AN11147.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007999"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007999"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007999"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR035718"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLU9"
FT                   /protein_id="CBF84762.1"
FT                   /translation="MVDKDWWLGSNAQGERGLFPSNYVELLEDGRQSRAESDTRPADAH
FT                   ESEALADPTPTSGSHVKPTAKALYDYEAAEDNELSFPEGAEIINIEFPDDDWWLGEFRG
FT                   KTGLFPANYVQLDD"
FT   gene            complement(598550..600758)
FT                   /locus_tag="ANIA_11139"
FT                   /old_locus_tag="AN11139.4"
FT                   /product="actin binding protein (Eurofung)"
FT   mRNA            complement(join(598550..598593,598716..599814,
FT                   599877..600064,600186..600399,600651..600758))
FT                   /locus_tag="ANIA_11139"
FT                   /old_locus_tag="AN11139.4"
FT                   /note="transcript_id=CADANIAT00008000"
FT   CDS_pept        complement(join(598550..598593,598716..599814,
FT                   599877..600064,600186..600399,600651..600758))
FT                   /locus_tag="ANIA_11139"
FT                   /old_locus_tag="AN11139.4"
FT                   /product="actin binding protein (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008000"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008000"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008000"
FT                   /db_xref="GOA:C8VLV0"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLV0"
FT                   /protein_id="CBF84764.1"
FT                   /translation="MTNAFGKALRHWVSPRSGQLNRATVWTSVTYFQTDSFEQIQTLET
FT                   CSTSVFFTEEDLDCQHGISQPIGQWTFDIEELSVSGRLCNNGFCKEFFNIRQMGIVLCF
FT                   NAPEGELADLIDEFSEGKIQFAFVKVIDTNTGLPKSVLIAWCGEGVPERTKGYFTSHLS
FT                   TVSKFLHGYHVQITARSEADLTVEGIIQKVGDASGAKYTQGLEKPNASVPKPPVSSKPV
FT                   FTPLRTGGINVNAAAAAPLPLRAKKNDDDGWGPDAPPVTRTNLEKVEPAYKPTRVNIQE
FT                   LKSEKQNEPTVNPSLTTGHQPDGVIKGGYQPIGKVDIAAIRRQAREAGNLTDDRPEPVK
FT                   GAYQPVGKVDIAAIRARAQKPDETDTSSKGSSARPDGSSGPTTDLDSTESSRLTSLPKP
FT                   KVTNKFASSTSFTGTKPPLPGGNALSATPVPPIGSASRTFADQGGKTPAQLWAEKKAKE
FT                   RSQEPAAAEESTKPAVANNVQSQLSGVREWKSSYTGRTWAPVQTTHTGKSVENNRTEVA
FT                   GSFATGMPTPEAITAQQSEATSSAATCPADPNT"
FT   gene            601436..>602346
FT                   /locus_tag="ANIA_08872"
FT                   /old_locus_tag="AN8872.4"
FT                   /product="AMP deaminase Amd1, putative (AFU_orthologue;
FT                   AFUA_8G02860)"
FT   mRNA            join(601436..602218,602272..>602346)
FT                   /locus_tag="ANIA_08872"
FT                   /old_locus_tag="AN8872.4"
FT                   /note="transcript_id=CADANIAT00008001"
FT   CDS_pept        join(601436..602218,602272..>602346)
FT                   /locus_tag="ANIA_08872"
FT                   /old_locus_tag="AN8872.4"
FT                   /product="AMP deaminase Amd1, putative (AFU_orthologue;
FT                   AFUA_8G02860)"
FT                   /note="submitted as non-partial"
FT                   /note="transcript_id=CADANIAT00008001"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008001"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008001"
FT                   /db_xref="GOA:C8VLV1"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006329"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLV1"
FT                   /protein_id="CBF84765.1"
FT                   /translation="MNLNSDGDTVTSELNAICRKIRDLLGLRANYIQLSLQTLEDNPIN
FT                   RPEWRIYPPPPEPAWGDDKETARMNEDPGTDQRRRKMGENIGEDFHLEECMPLPGESDW
FT                   VFKLDESSVYQVYKNSSDVDREEPVVKIPSLRDFYMDLDAVIDVSTDGPAKSFSFKRLS
FT                   YLEGKFQLYSLLNEYQEIADSKKVPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKSKMK
FT                   KSPDEVVLFRDGKHLTLREVFESINLTAYDLSIDTLDMHAHTDSFHRFDKFNLKYNPVG
FT                   ESRLR"
FT   gene            complement(604191..606237)
FT                   /locus_tag="ANIA_08871"
FT                   /old_locus_tag="AN8871.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(604191..606032,606178..606237))
FT                   /locus_tag="ANIA_08871"
FT                   /old_locus_tag="AN8871.4"
FT                   /note="transcript_id=CADANIAT00008002"
FT   CDS_pept        complement(604191..606008)
FT                   /locus_tag="ANIA_08871"
FT                   /old_locus_tag="AN8871.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008002"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008002"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008002"
FT                   /db_xref="GOA:C8VLV2"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLV2"
FT                   /protein_id="CBF84767.1"
FT                   /translation="MSQAASTTSRKPRRFLPEPIETSSRSSKNRQDNELTTQCLHQMQT
FT                   SFRTSEIRSTSCKNEDSGRSSHPPPQQTCLSPCLTTDHDAHRFTATMHKTPFTQVIGGN
FT                   QQGNAKRYTPQLMETVRHSFRPGKKPAKLFSSAGLGTQSSRDAIEAANRMEADHGAVQE
FT                   SRFSYSSLLRRQETRRHSFRVPDLPAIPSSGSDESNESDSPQVSSETIATARGTFSDDT
FT                   ARPRNGREMSFIEYILPFPRHPSENQLKEQALAAFPNEQVYQQVDHFAIDRDEEEPVNE
FT                   DIIKIRDPELEFRTRRRASSADLPSELEYLRKHKEEAGMNRRHYFTTRGACFSTCAVYQ
FT                   TSRKSGKPANHDDGWDPNSPFARLRQAASPPMLGGDLIFPQSLTPKTTICEHPNSVGSQ
FT                   GHRDHSLGSGLWSACPCSSAQYDIGGLWNGTCKSDRYSTHGVENLSREAITPKKDVINN
FT                   NSGNLDASSKASNLRHRKRQNAVQSPTNESADSERIDQEFNDDFVTQIYDYLSLGYPSI
FT                   ARYFDHELSRVSGLPIAALRADDLNMDAKGYVGVNDITNKGVANRVCMRWTALKLYIHE
FT                   WARQHPRMLEAGHYHETWGVSERKGSWAV"
FT   gap             612118..612217
FT                   /estimated_length=unknown
FT                   /note="centromeric region"
FT   misc_feature    612218..632097
FT                   /note="contig 1.175 1..19880(1)"
FT   gene            complement(613423..614793)
FT                   /locus_tag="ANIA_11663"
FT                   /old_locus_tag="AN11663.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(613423..613445,613573..613592,
FT                   614183..614189,614787..614793))
FT                   /locus_tag="ANIA_11663"
FT                   /old_locus_tag="AN11663.4"
FT                   /note="transcript_id=CADANIAT00008003"
FT   CDS_pept        complement(join(613423..613445,613573..613592,
FT                   614183..614189,614787..614793))
FT                   /locus_tag="ANIA_11663"
FT                   /old_locus_tag="AN11663.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008003"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLV3"
FT                   /protein_id="CBF84769.1"
FT                   /translation="MSEKRIIRAAGVFILAVF"
FT   gene            complement(616737..617403)
FT                   /locus_tag="ANIA_09418"
FT                   /old_locus_tag="AN9418.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(616737..617101,617301..617403))
FT                   /locus_tag="ANIA_09418"
FT                   /old_locus_tag="AN9418.4"
FT                   /note="transcript_id=CADANIAT00008004"
FT   CDS_pept        complement(join(616737..617101,617301..617403))
FT                   /locus_tag="ANIA_09418"
FT                   /old_locus_tag="AN9418.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008004"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008004"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008004"
FT                   /db_xref="GOA:Q5AQL2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQL2"
FT                   /protein_id="CBF84771.1"
FT                   /translation="MAQRSDVAVHGRKRPAEEELDDQPLTKKFGRLQIEQELAETEILD
FT                   GAFTILPGIEDRLSLTNILVANDSKRPCTDVVLYREPESLSIPKDKDQVRRALIETRER
FT                   ARLSQQKLRSSPGQEKNDAACTDQNLTHKEECQQRANSDDDDAMDIDVDGY"
FT   gene            617642..621028
FT                   /locus_tag="ANIA_09419"
FT                   /old_locus_tag="AN9419.4"
FT                   /product="alanyl-tRNA synthetase, putative (AFU_orthologue;
FT                   AFUA_8G03880)"
FT   mRNA            join(617642..617765,617855..618000,618050..618076,
FT                   618131..618166,618215..620623,620694..621028)
FT                   /locus_tag="ANIA_09419"
FT                   /old_locus_tag="AN9419.4"
FT                   /note="transcript_id=CADANIAT00008005"
FT   CDS_pept        join(617672..617765,617855..618000,618050..618076,
FT                   618131..618166,618215..620623,620694..620867)
FT                   /locus_tag="ANIA_09419"
FT                   /old_locus_tag="AN9419.4"
FT                   /product="alanyl-tRNA synthetase, putative (AFU_orthologue;
FT                   AFUA_8G03880)"
FT                   /note="transcript_id=CADANIAT00008005"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008005"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008005"
FT                   /db_xref="GOA:Q5AQL1"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AQL1"
FT                   /protein_id="CBF84773.1"
FT                   /translation="MASNLQSQPKWTSKLVRDTFLQYFQGKGHTFVASSPVAPLSDPTL
FT                   LFTNAGMNQFKSIFLGTVNPNSDFAQLKSAVNSQKCIRAGGKHNDLDDVGKDSYHHTFF
FT                   EMLGNWSFGDYFKKEAIQYSWELLTQVYGLDPGRLYVTYFEGNKEGGLQPDLEAKALWK
FT                   AVGVPEDHILPGNMKDNFWEMGDQGPCGPCSEIHYDRIGGRNAASLVNQDDPNVLEIWN
FT                   NVFIQYNRENDGSLRSLPNKHVDTGMGFERLVSVLQDKSSNYDTDVFGPIFQTIQVITG
FT                   AREYQGRFGTDDSDGIDTAYRVVADHVRTLMFAISDGVVPNNEGRGYVIRRVLRRGARY
FT                   ARKYFNVEIGSFFSKIVPTVVEQLGDMFPELKQKQQDVIEILNEEEISFAKTLDRGERQ
FT                   FEQYAQQAKTAGDHKLHGADVWRLYDTFGFPVDLTRIMAEERGLEIDDRQFEEARHKAK
FT                   EASKGQKKTTTGSVKLDVHDLGKLEKMNGVPKTDDSAKFEIGNVTAQIKAIYHGKTFHS
FT                   STQNLDDSEQIGIILDRTNFYAEQGGQENDTGRIVIDGQAELEVVDVQQYAGYVLHTGY
FT                   MKYGSFKVDDTVICEYDELRRWPIRNNHTGTHILNFALRGVLGDGIEQKGSLVSAEKLR
FT                   FDFSHKSPVTDVELVKIEDLSTQYIRRNCLVYSKEVPLSIARNIAGVRAVFGETYPDPV
FT                   RVVSVGAELDEILKNVEDPRWADFSIEFCGGTHVQKTGDIKDLVILEESGIAKGIRRII
FT                   AVTGEDAHEVQRLAEEFEKRLNHLEAMPSGSAKEQNAKQIQVELNQLSISAVQKSRFRE
FT                   RFTQINKKIIDEQKAQQKLESKKAVESITSYFAAPENANKSWLIAKLPISANAKAVSEC
FT                   LTYVKTKLADKMVYVLASSLEDGRVAHGCYVPKAISDQGASASEWSSAVSRAVGGKAGG
FT                   KGPTSIGNGINPEKVDDAVDLASEYLSKFKL"
FT   gene            complement(621152..621779)
FT                   /locus_tag="ANIA_09420"
FT                   /old_locus_tag="AN9420.4"
FT                   /product="Peptidyl-prolyl cis-trans isomerase H (PPIase
FT                   H)(Rotamase H)(EC 5.2.1.8)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AQL0]"
FT   mRNA            complement(join(621152..621331,621388..621533,
FT                   621704..621779))
FT                   /locus_tag="ANIA_09420"
FT                   /old_locus_tag="AN9420.4"
FT                   /note="transcript_id=CADANIAT00008006"
FT   CDS_pept        complement(join(621152..621331,621388..621533,
FT                   621704..621779))
FT                   /locus_tag="ANIA_09420"
FT                   /old_locus_tag="AN9420.4"
FT                   /product="Peptidyl-prolyl cis-trans isomerase H (PPIase
FT                   H)(Rotamase H)(EC 5.2.1.8)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AQL0]"
FT                   /note="transcript_id=CADANIAT00008006"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008006"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008006"
FT                   /db_xref="GOA:Q5AQL0"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AQL0"
FT                   /protein_id="CBF84775.1"
FT                   /translation="MSNTGSAVPQTTSSNPIVFFDVALGGEPLGRLKLELFADVTPRTA
FT                   ENFRQFCTGESKNQQGRPQGYKGSKFHRVIKDFMIQGGDFVNGDGTGSCTIYGTPKFSD
FT                   ENFTLRHDRPGLLSMAVSMPIFLSGISDS"
FT   gene            622052..623920
FT                   /locus_tag="ANIA_09421"
FT                   /old_locus_tag="AN9421.4"
FT                   /product="RING finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G03900)"
FT   mRNA            join(622052..622542,622599..623920)
FT                   /locus_tag="ANIA_09421"
FT                   /old_locus_tag="AN9421.4"
FT                   /note="transcript_id=CADANIAT00008007"
FT   CDS_pept        join(622409..622542,622599..623700)
FT                   /locus_tag="ANIA_09421"
FT                   /old_locus_tag="AN9421.4"
FT                   /product="RING finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G03900)"
FT                   /note="transcript_id=CADANIAT00008007"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008007"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008007"
FT                   /db_xref="GOA:Q5AQK9"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQK9"
FT                   /protein_id="CBF84777.1"
FT                   /translation="MSSTTSSSPAPTDNGSGDNGGSSPTSSPLLFFVALGFGVVFTNLW
FT                   IIVGVKYCFRYNQRNRQIRGGDNGEPIDLVAMPRTHRRRREKKLMTMDEVNERFPLTKY
FT                   KVWRSSRANAGLSTAGGITAAHTENALDAEDDQQSLPEGATSLVTAPDAKSHQRLNSAT
FT                   SQQPTKPVDDGDMAPESEEKSIKGFSRTNNASPRVSSDRINPVVRDHDYHTVEDIIPTT
FT                   VLTDLDTSPGDSCAICLDLIEDDDDIRGLSCGHAFHASCVDPWLTSRRASCPLCKADYY
FT                   TPKPRPDASDLPSTSGRRAASPNHPQAVLIRGRVNPFRAQTLYGQASQSAPDTVSGTSR
FT                   PIGHRLWAVRTTPTIEEGRSRNDTSIPRLSSWLSNFSNRFRVRNQDSTTVPGNSHLNAP
FT                   RTPSQLEAGQTR"
FT   gene            complement(624240..625833)
FT                   /locus_tag="ANIA_09422"
FT                   /old_locus_tag="AN9422.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(624240..624849,624916..625047,
FT                   625116..625276,625335..625833))
FT                   /locus_tag="ANIA_09422"
FT                   /old_locus_tag="AN9422.4"
FT                   /note="transcript_id=CADANIAT00008008"
FT   CDS_pept        complement(join(624283..624849,624916..625047,
FT                   625116..625276,625335..625659))
FT                   /locus_tag="ANIA_09422"
FT                   /old_locus_tag="AN9422.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008008"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008008"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008008"
FT                   /db_xref="GOA:Q5AQK8"
FT                   /db_xref="InterPro:IPR024382"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQK8"
FT                   /protein_id="CBF84779.1"
FT                   /translation="MRSVFSFLTTIGAISVGATALEASVITFGSVTQKQGLKSPDISSA
FT                   TLLQLLELRTKSPTTSSLQSSDEENLEFLNRLAGPPTRLFGAPAADGGLDTLLVVLEGL
FT                   TDEIGRSIQAEYQDELLITEFVTGSAEDTFLDYILEARLEGIVSPESKRCSLTSDSNEG
FT                   FVMSCLPANFNLTLGSGFLGQITSGESWIDNRKELVVMHIAFKGSTAYINDLKAFLSGL
FT                   RSLSLNGRRVTAVALPDLNASQKLSRTRRAPEHTALDTTFSWDRDERLMIADQHAQASL
FT                   SLGPVCYASNSSCNDATDTCSGHGACYEKSGGCYACLCHDTYVKTASGTERKIRWGGSA
FT                   CQKRDISSPFFLIMGVTVAVLLAVISAIAMIFGIGNDELPGVISAGVGTVRAQK"
FT   gene            625981..627425
FT                   /locus_tag="ANIA_09423"
FT                   /old_locus_tag="AN9423.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(625981..626280,626334..626623,627022..627425)
FT                   /locus_tag="ANIA_09423"
FT                   /old_locus_tag="AN9423.4"
FT                   /note="transcript_id=CADANIAT00008009"
FT   CDS_pept        join(626156..626280,626334..626623,627022..627425)
FT                   /locus_tag="ANIA_09423"
FT                   /old_locus_tag="AN9423.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008009"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008009"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008009"
FT                   /db_xref="GOA:C8VLV9"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLV9"
FT                   /protein_id="CBF84780.1"
FT                   /translation="MPPSRPLLYSHQSVLQIHPSRRYFSHGPNVRYVKVIKRPWSRGFI
FT                   ANILLCGIAAYFWSSFVPARKDNTSSNTASQTTVDSHSAPETTSRDRIEAVFIPTGWSH
FT                   LEEGRLYAATDPEWKEFVKISQSPEKLQSLKGNLLSERACLSDSYMDFKTLDKLGGASQ
FT                   SESPSTHLQPSSILATLRWLPLPKLGPGSDLHDATQVFKKRIDECQRSDSRAYRQGIFF
FT                   IRGPVGLKGSQGSCRIQVEGEYDPVASQWVSVSMHLNDLAFLSQKPLGRK"
FT   gene            complement(628409..629506)
FT                   /locus_tag="ANIA_09424"
FT                   /old_locus_tag="AN9424.4"
FT                   /product="cell cycle regulatory protein Cks/Suc1, putative
FT                   (AFU_orthologue; AFUA_8G03920)"
FT   mRNA            complement(join(628409..628982,629107..629165,
FT                   629213..629357,629403..629506))
FT                   /locus_tag="ANIA_09424"
FT                   /old_locus_tag="AN9424.4"
FT                   /note="transcript_id=CADANIAT00008010"
FT   CDS_pept        complement(join(628850..628982,629107..629165,
FT                   629213..629357,629403..629506))
FT                   /locus_tag="ANIA_09424"
FT                   /old_locus_tag="AN9424.4"
FT                   /product="cell cycle regulatory protein Cks/Suc1, putative
FT                   (AFU_orthologue; AFUA_8G03920)"
FT                   /note="transcript_id=CADANIAT00008010"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008010"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008010"
FT                   /db_xref="GOA:Q5AQK6"
FT                   /db_xref="InterPro:IPR000789"
FT                   /db_xref="InterPro:IPR036858"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQK6"
FT                   /protein_id="CBF84782.1"
FT                   /translation="MDIDPSRRNKKPRPLLESERERLDEFIDSIHYSARYSDDQFEYRH
FT                   VQLPKNMLKKIPADYFDSSKGTLKLLWEEEWRALGITQSLGWEHYEVHEPEPHILLFNV
FT                   YTGVDSPDTEEEPSRRAAIQCTLECSRQFKTPCNEFDKWNMV"
FT   gene            630385..631949
FT                   /locus_tag="ANIA_11227"
FT                   /old_locus_tag="AN11227.4"
FT                   /product="heat shock 70 kDa protein (Eurofung)"
FT   mRNA            join(630385..630540,630593..630643,630696..630822,
FT                   630872..631037,631090..631323,631386..631442,
FT                   631509..631949)
FT                   /locus_tag="ANIA_11227"
FT                   /old_locus_tag="AN11227.4"
FT                   /note="transcript_id=CADANIAT00008011"
FT   CDS_pept        join(630498..630540,630593..630643,630696..630822,
FT                   630872..631037,631090..631323,631386..631442,
FT                   631509..631949)
FT                   /locus_tag="ANIA_11227"
FT                   /old_locus_tag="AN11227.4"
FT                   /product="heat shock 70 kDa protein (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008011"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008011"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008011"
FT                   /db_xref="GOA:C8VLW1"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLW1"
FT                   /protein_id="CBF84784.1"
FT                   /translation="MSDEVYEGAIGIDLGTTYSCVANYEGTNVEIIANEQGSYTTPSFV
FT                   SFTDKERLIGEAAKNQAAMNPQNTIFDIKRLIGRRYEDPIVKKDVESWPFKVVDQGGNP
FT                   AVEVEYLGETKTFTPQEISSMVLMKMKEVAETKLGKKVEKAVITVPAYFNDNQRQATKD
FT                   AGAIAGLNVLRIINEPTAAAIAYGLGSGKSEKERNVLIYDLGGGTFDVSLLNIQGGVFT
FT                   VKATAGDTHLGGQDFDTNLLEHFKKEFQKKTGKDLSGDSRALRRLRTACERAKRTLSNA
FT                   TQTSVEIDSLFDGEDFNTSITRARFEDLNAKSFSGTLEPVQQVLKDSGLAKNQVDEIVL
FT                   VGGSTRIPRIQKLLSDFFDGKKLEKVSFLCHC"
FT   gene            631503..632948
FT                   /locus_tag="ANIA_10202"
FT                   /old_locus_tag="AN10202.4"
FT                   /product="Heat shock protein 70
FT                   [Source:UniProtKB/TrEMBL;Acc:O42808]"
FT   mRNA            join(631503..631925,631975..632455,632506..632948)
FT                   /locus_tag="ANIA_10202"
FT                   /old_locus_tag="AN10202.4"
FT                   /note="transcript_id=CADANIAT00008012"
FT   CDS_pept        join(631503..631925,631975..632455,632506..632774)
FT                   /locus_tag="ANIA_10202"
FT                   /old_locus_tag="AN10202.4"
FT                   /product="Heat shock protein 70
FT                   [Source:UniProtKB/TrEMBL;Acc:O42808]"
FT                   /note="transcript_id=CADANIAT00008012"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008012"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008012"
FT                   /db_xref="GOA:C8VLW2"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLW2"
FT                   /protein_id="CBF84786.1"
FT                   /translation="MQAGDTHLGGQDFDTNLLEHFKKEFQKKTGKDLSGDSRALRRLRT
FT                   ACERAKRTLSNATQTSVEIDSLFDGEDFNTSITRARFEDLNAKSFSGTLEPVQQVLKDS
FT                   GLAKNQVDEIVLVGGSTRIPRIQKLLSDFFDGKKLEKSINPDEAVAYGAAVQAGILSGK
FT                   ATSAETQDLLLLDVVPLSLGVAMEGNIFAPVVPRGQTVPTIKKRTFTTVVDNQTTVQFP
FT                   VYQGERTNCADNTSLGEFTLAPIPPMRAGEAALECVFEVDVNGILKVTATEKSSGRSAN
FT                   ITISNAVGKLSTTEIEQMIDDAAKFKTSDEAFTKRFESRQQLESYISRVEEIISDPTMS
FT                   MKLKRGNREKIESALSDAMAQLEIEDSTPEDLKKKELALKRLITKAMATR"
FT   misc_feature    632098..907665
FT                   /note="contig 1.22 729..276296(1)"
FT   gene            633153..634082
FT                   /locus_tag="ANIA_10205"
FT                   /old_locus_tag="AN10205.4"
FT                   /product="ribosome recycling factor, putative
FT                   (AFU_orthologue; AFUA_8G03940)"
FT   mRNA            join(633153..633572,633643..634082)
FT                   /locus_tag="ANIA_10205"
FT                   /old_locus_tag="AN10205.4"
FT                   /note="transcript_id=CADANIAT00008013"
FT   CDS_pept        join(633153..633572,633643..633990)
FT                   /locus_tag="ANIA_10205"
FT                   /old_locus_tag="AN10205.4"
FT                   /product="ribosome recycling factor, putative
FT                   (AFU_orthologue; AFUA_8G03940)"
FT                   /note="transcript_id=CADANIAT00008013"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008013"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008013"
FT                   /db_xref="GOA:C8VLW3"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLW3"
FT                   /protein_id="CBF84788.1"
FT                   /translation="MRPIAALPQFLKTSRIRAVRGIELQGYAFRRSFTSSPALNKSKKR
FT                   DTLKQTDAGAKGQATIASDDPSDLSQLELGIATAVSRLKDELTKLRTGGRLCPETIESL
FT                   RVQLSKGTKETARLGDLAQVVPKGGRMVAVLVSEESYMKPISSAILASNLSLTPQQDPH
FT                   NALQLNIPIPPPTKESRDQTVLAAKAAMERAASNVRETRGIVHKRLQEMIKKKIARPDD
FT                   ARKAQDKMEKLTEKGQKEVKDLFEVAKKAMERT"
FT   gene            complement(633835..635305)
FT                   /locus_tag="ANIA_01405"
FT                   /old_locus_tag="AN1405.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(633835..635053,635166..635305))
FT                   /locus_tag="ANIA_01405"
FT                   /old_locus_tag="AN1405.4"
FT                   /note="transcript_id=CADANIAT00008014"
FT   CDS_pept        complement(join(634143..635053,635166..635286))
FT                   /locus_tag="ANIA_01405"
FT                   /old_locus_tag="AN1405.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008014"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008014"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008014"
FT                   /db_xref="GOA:Q5BDH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDH5"
FT                   /protein_id="CBF84789.1"
FT                   /translation="MLQSRAMILHPWRLRRVVPSFSSIRQLSTSGALGADSSPADESKL
FT                   RVSTATPRKNEPKKLKIPPVLLKLNNSNVDRLRPRRIIDARSLAASKSSGGLPTNVLRG
FT                   PRRLGAQGGTSLRGRKPFNAKPAPRAPRRARQRDSAGEDENPSLTAELEDVYRELAEKT
FT                   KPTATRYEPQAPSLQSLSETWPSLPTDVTATAAGVAEKLSLLSERYPNGYVPPYTLGKR
FT                   LIEGKYVRFTSEAERIEALEAAKKFAQEAADKLSQEKGELIEPQAVKFQGAKGGEYKTL
FT                   IESLAQGKYPTVETVSTDKPPVVGEILRNIRNNESYQAPGKKAQFMAKLETLLVPNRAV
FT                   KRP"
FT   gene            635436..636025
FT                   /locus_tag="ANIA_10206"
FT                   /old_locus_tag="AN10206.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(635436..635724,635794..636025)
FT                   /locus_tag="ANIA_10206"
FT                   /old_locus_tag="AN10206.4"
FT                   /note="transcript_id=CADANIAT00008015"
FT   CDS_pept        635453..635680
FT                   /locus_tag="ANIA_10206"
FT                   /old_locus_tag="AN10206.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008015"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008015"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008015"
FT                   /db_xref="GOA:C8VLW5"
FT                   /db_xref="InterPro:IPR018860"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLW5"
FT                   /protein_id="CBF84791.1"
FT                   /translation="MIRRKPTAIAITSDDLTMFEEERLRKLEPRNSGHDPAQNGTRVNF
FT                   DPSDELKPLPGDKARIVRSREERIGIGQRS"
FT   gene            complement(636313..639245)
FT                   /locus_tag="ANIA_01406"
FT                   /old_locus_tag="AN1406.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(636313..636628,636682..637130,
FT                   637180..637730,637777..638058,638106..638447,
FT                   638494..639015,639068..639112,639138..639143,
FT                   639191..639245))
FT                   /locus_tag="ANIA_01406"
FT                   /old_locus_tag="AN1406.4"
FT                   /note="transcript_id=CADANIAT00008016"
FT   CDS_pept        complement(join(636313..636628,636682..637130,
FT                   637180..637730,637777..638058,638106..638447,
FT                   638494..639015,639068..639112,639138..639143,
FT                   639191..639245))
FT                   /locus_tag="ANIA_01406"
FT                   /old_locus_tag="AN1406.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008016"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008016"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008016"
FT                   /db_xref="GOA:C8VM18"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM18"
FT                   /protein_id="CBF84793.1"
FT                   /translation="MQGYSYMPPTGPPREGQRSIYYVFVDEHNRHKRLKVMRACNGCRK
FT                   RKIKCDAATTNIWPCSACNRLKLVCVPPTIGQESDFSSGPSVEPYSINTINTLNVPESS
FT                   HLTAFQTYRDGVAPHGQAANQYNDGVGSFSQYAPGAVSTQSSLYGIRSPLEAVSQDSYQ
FT                   AHQLFSVSQARSIGPNDGIEYGDHEHSTAENLSEVLGELRIDETGIAPYIRQQRTDRTE
FT                   PEIPIQDEVEECLPPLRTGSGSKIRIPPELMPSDDEVMNYFKIYFDDIHPYVPVVHRAH
FT                   LYHQWQHDRNSISPLLLEALFACAGRLSDDPAQGAQWLALATRHESSFMDVPRLSTIQA
FT                   LLLLLKARESLPKKGYYYRSWQTVKTIISMAKDLDIHEHYSTHLEEKTCNLSPVECLVQ
FT                   TRVWQALLVVEVMIGAPQGRSDYGVDPQTVDMQPELDVENMDQFEIDRSRQYAYFVRNA
FT                   HHIRILTDVYHKIKRQKDWGSNSKFVENNPLFADWLQSLPPDLQVNYPPDGSPPWIPSH
FT                   FVGNMHSHCHLGIVLCHRPQLIASKFPASGNWKTHMSLCYSSAKCLCRLQEAILARFGL
FT                   SGLLYMQRGINFTIYCILTCTMLHLVAITSPDPEFHTDAREYFTRHMRILERCSSAWPM
FT                   PEIQAQIDSLRLAFSANINRPFELKATFPYGSPSEPYQPSPTLETQYNPQPNQISNLQE
FT                   RAAFHPYPITPPISAGTEDSKAGTPQLHPPALLSTHSVHAEGPLVDESSWDPTRIINQW
FT                   DMAFSFSPAVNSNSPPMAIPGTSEGLQPTIADQYTLQYQQPAKLPVTQASAVPQPQMSG
FT                   QPVVFTARDWQQSVASVYDPHGLKRRWNYSVDMEMENNTKRPR"
FT   gene            641113..641820
FT                   /locus_tag="ANIA_01407"
FT                   /old_locus_tag="AN1407.4"
FT                   /product="cytoplasmic protein required for cell viability,
FT                   putative (AFU_orthologue; AFUA_8G03980)"
FT   mRNA            join(641113..641398,641447..641820)
FT                   /locus_tag="ANIA_01407"
FT                   /old_locus_tag="AN1407.4"
FT                   /note="transcript_id=CADANIAT00008017"
FT   CDS_pept        join(641167..641398,641447..641820)
FT                   /locus_tag="ANIA_01407"
FT                   /old_locus_tag="AN1407.4"
FT                   /product="cytoplasmic protein required for cell viability,
FT                   putative (AFU_orthologue; AFUA_8G03980)"
FT                   /note="transcript_id=CADANIAT00008017"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008017"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008017"
FT                   /db_xref="GOA:Q5BDH3"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR039796"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDH3"
FT                   /protein_id="CBF84795.1"
FT                   /translation="MASEMQNSNPTIINTADLPTRLRPSASPKSSTYGSEFFASALPSL
FT                   TVDALSDYSPSTSESENDDDLMEEPIDEQEIYDLVSTISDPEHPISLGALAVVSLPDIS
FT                   IKPALPDVPDSPLRTVTVLITPTITHCSLATVIGLGVRVRLEQSLPPRFRVNVQIKEGT
FT                   HSTADEVNKQLADKERVAAALENGTLMGVIAKMLETCL"
FT   gene            complement(641890..645063)
FT                   /locus_tag="ANIA_01408"
FT                   /old_locus_tag="AN1408.4"
FT                   /product="hypothetical U5 snRNP component (Eurofung)"
FT   mRNA            complement(join(641890..642452,642505..644733,
FT                   644794..644939,644996..645063))
FT                   /locus_tag="ANIA_01408"
FT                   /old_locus_tag="AN1408.4"
FT                   /note="transcript_id=CADANIAT00008018"
FT   CDS_pept        complement(join(641890..642452,642505..644733,
FT                   644794..644939,644996..645015))
FT                   /locus_tag="ANIA_01408"
FT                   /old_locus_tag="AN1408.4"
FT                   /product="hypothetical U5 snRNP component (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008018"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008018"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008018"
FT                   /db_xref="GOA:Q5BDH2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031950"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035655"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDH2"
FT                   /protein_id="CBF84797.1"
FT                   /translation="MDDLYDEFGNYIGEAAESDEEFQHEAAKPQAFDYDEAFGADELEE
FT                   PAQQELMEVDEGPSNAVILHEDKQYYPSAQQVYGEDVETLVQEEDAQPLSEPIIAPVTQ
FT                   KKFAIEESELPPVFFSREFMTDLLNFPDQIRNIALVGHLHHGKTAFMDMLVMQTHDLAE
FT                   RLEKRTGRKRDEQLRYTDVHHLERERGLSIKSAPMSFVLQSSKGKSHLFNIIDTPGHVN
FT                   FVDEVAASSRLVDGVVLVVDVVEGVQANTEQIIRHAVLEDLPLTLVVNKMDRLILELKL
FT                   PPNDAYFKLKHVIEEVNTMIENVMPGHGEKRRLSPEKGNVAFACASMKWCFTLQSFAKM
FT                   YADTYPNIETADFAIRLWGDIFFNPRSRKFTRKGAEDNSKRTFVKFVLEPIYKLYSHTL
FT                   SESPDDLKGTLASVGISLKPSQLRSDAKVLLDLVCEQFFGPAEGFVDMVLQHIPSPVEG
FT                   AKRVLERYYTGPLDTKIAAAMANCDPDGPLVVHVTKLLANTDASRFHALGKILSGTARP
FT                   GLQTRVLGEGYTPDDEEDMVNATISDTWIAETRYNIPTSGVTAGNLVLLGGVDNSIVKT
FT                   ATVVATKFEDNEEAHIFRPIRHMTESVFKVAVEPVNPSELPKMLEGLRKVNKSYPLIST
FT                   KVEESGEHIVLGTGELYMDCVLHDLRRLFSEMEIKVSDPVTRFCETVVETSAIMCYSIT
FT                   PNKLNKITMIAEPLDDGIAEDIETGKVSIKDPIRKVARFFEEKYDWDKLAARSIWAFGP
FT                   DELGPNILQDDTLPSQVDKKLLGSVRDSITQGFSWGTREGPLCEEPIRNAKFRLTDVSL
FT                   ADQAIYRGGGQIIPTARRAVYSSFLMASPRLMEPLYSCSMTGPADAVASVYTVLSRRRG
FT                   HVLSDGPIAGTPLYSVRGLIPVIDSFGFETDLRIHTQGQAAVSLVFDKWSVVPGDPLDR
FT                   DVKLKPLEMAPAMATARDFVLKTRRRKGLAEDVTVSKFLEPELWKGLKESGVLDS"
FT   gene            645391..646999
FT                   /locus_tag="ANIA_01409"
FT                   /old_locus_tag="AN1409.4"
FT                   /product="acetyl-CoA acetyltransferase, putative
FT                   (AFU_orthologue; AFUA_8G04000)"
FT   mRNA            join(645391..645572,645635..645684,645741..645816,
FT                   645867..646356,646412..646999)
FT                   /locus_tag="ANIA_01409"
FT                   /old_locus_tag="AN1409.4"
FT                   /note="transcript_id=CADANIAT00008019"
FT   CDS_pept        join(645508..645572,645635..645684,645741..645816,
FT                   645867..646356,646412..646930)
FT                   /locus_tag="ANIA_01409"
FT                   /old_locus_tag="AN1409.4"
FT                   /product="acetyl-CoA acetyltransferase, putative
FT                   (AFU_orthologue; AFUA_8G04000)"
FT                   /note="transcript_id=CADANIAT00008019"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008019"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008019"
FT                   /db_xref="GOA:C8VM21"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM21"
FT                   /protein_id="CBF84799.1"
FT                   /translation="MASLPPVYIVSYARTPVGSFLGSLSSQTAPQLGSHAIKAALERAD
FT                   GIKPSDVQEVFFGNVLSANVGQNPARQCALGAGLETSTVCTTVNKVCASGLKAVILGAQ
FT                   TIMTGNADVVVAGGTESMSNTPHYLPNLRTGAKYGNQTMVDGIVKDGLTDVGKQELMGL
FT                   QAEECAQDHGFNRQQQDDYAIRSYEKAQAAQAAGLFNDEIAPIDLPGFRGKPGVTVTQD
FT                   DEPKNLNPDKLRAMKPAFIPGTGTVTAPNSSPLNDGAAAVVLVSEAKLKELNLKPVAKI
FT                   LGWGEAAQQPSKFTTAPALAIPRALKHAGVSQDAVDAFEINEAFSVVALANLKLLGLSE
FT                   DKVNIHGGAVAIGHPLGASGARILTTLLGVLKARKGKVGCAGICNGGGGASALVVEYIA
FT                   "
FT   gene            complement(647317..648665)
FT                   /locus_tag="ANIA_10203"
FT                   /old_locus_tag="AN10203.4"
FT                   /product="ZIP family zinc transporter, putative
FT                   (AFU_orthologue; AFUA_8G04010)"
FT   mRNA            complement(join(647317..648425,648474..648665))
FT                   /locus_tag="ANIA_10203"
FT                   /old_locus_tag="AN10203.4"
FT                   /note="transcript_id=CADANIAT00008020"
FT   CDS_pept        complement(join(647317..648425,648474..648510))
FT                   /locus_tag="ANIA_10203"
FT                   /old_locus_tag="AN10203.4"
FT                   /product="ZIP family zinc transporter, putative
FT                   (AFU_orthologue; AFUA_8G04010)"
FT                   /note="transcript_id=CADANIAT00008020"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008020"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008020"
FT                   /db_xref="GOA:C8VM22"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM22"
FT                   /protein_id="CBF84801.1"
FT                   /translation="MALFLILVLSTLACSFPILARRFPRLPIPRRFLFLSRHFGTGVLI
FT                   ATAFVHLLPTAFVSLTDPCLPQFWSETYRAMPGFVAMISVFGVVLVEMFFAMKGAGHVH
FT                   GSEYDQLISEANANGDRDSDYSRLEASESVDDIHLSAMRESSASMNMPRNSTEESSLDR
FT                   SSTNFIKNGALPALGEGRNPVVRANLSSRYPAQVSSGPNMDDNTDPKMTLQNPHRQLLQ
FT                   CLLLEAGILFHSIFIGMAVSVATGTSFIVLLVAICFHQTFEGFALGSRIASLIPDLFPP
FT                   SSMKPWLMSLAYGTTTPIGQAIGLVLHNFYDPASATGLLMVGITNAISSGLLLFAGLVE
FT                   LLAEDFLSEESYVILRGRRRLEACIAVAAGALLMAFVGAFA"
FT   gene            complement(649156..650757)
FT                   /locus_tag="ANIA_10190"
FT                   /old_locus_tag="AN10190.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(649156..650757)
FT                   /locus_tag="ANIA_10190"
FT                   /old_locus_tag="AN10190.4"
FT                   /note="transcript_id=CADANIAT00008021"
FT   CDS_pept        complement(649156..650757)
FT                   /locus_tag="ANIA_10190"
FT                   /old_locus_tag="AN10190.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008021"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008021"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008021"
FT                   /db_xref="GOA:C8VM23"
FT                   /db_xref="InterPro:IPR018791"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM23"
FT                   /protein_id="CBF84802.1"
FT                   /translation="MSCDICTRTQASAFLCATCARNRLYQLRFDSASVILEREYLGQQI
FT                   EAAINADNEHEKCLSGRGNNSAELEEGRPRLWTIQRIKNEQSRSAARIEIVANHIKSLQ
FT                   SRIKDKSLDISQRKIKLTRQRSDSESALYQLSERESGMLSGIQNIIKRTDHLWHANHTK
FT                   TAEARIFLCREAASLYGLRQNVRKNNNGMKETYTIGGVGILDLREMNGKSLPYSGVKQF
FT                   VNTHTGAAPDHISTSFSYIAHILVLVSNYLSLRLPAEITLPHKDYPLPTIYTPSASYLP
FT                   QELRAVPFSDQLPSSRPTSRTALAHASFPRPRPLCIDKSLPKLAKEDPGTYALFIEGVT
FT                   LLAWNVSWLCRSQGLNLGSDSWEDVCDIGKNLWQLLVAPPGQSSALIATRKGSYQTRAH
FT                   KDFPRTMIQRTKSFPMLGHYSHGTAHSFLGASEGTEFVRNWKLPSPTKVVDGLKSTLLG
FT                   EMASAEWELLEENEWDDSRQPVSHESSHGSDLPHDDQSSYTSDTITLAPKLGAPDAPAI
FT                   AARSKGTSGWTKLRHR"
FT   gene            651511..652089
FT                   /locus_tag="ANIA_01411"
FT                   /old_locus_tag="AN1411.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(651511..651744,651820..651878,651910..651974,
FT                   652025..652089)
FT                   /locus_tag="ANIA_01411"
FT                   /old_locus_tag="AN1411.4"
FT                   /note="transcript_id=CADANIAT00008022"
FT   CDS_pept        join(651511..651744,651820..651878,651910..651974,
FT                   652025..652089)
FT                   /locus_tag="ANIA_01411"
FT                   /old_locus_tag="AN1411.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008022"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008022"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008022"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDG9"
FT                   /protein_id="CBF84804.1"
FT                   /translation="MASGDKTPSRLPGPKSGIARSKPMLREQSVTSGDEESQLKDSIKD
FT                   FDWSQLESVYIQMMEQHEKSEEELRNHITRLLQTTVVHDESRAVKRLVVSFRRFRTQMH
FT                   HVQNSEESLEKKRRHYMDVVNAFERALALLNDRAKP"
FT   gene            complement(652197..654113)
FT                   /locus_tag="ANIA_01412"
FT                   /old_locus_tag="AN1412.4"
FT                   /product="Probable lysosomal cobalamin transporter
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDG8]"
FT   mRNA            complement(join(652197..652460,652508..654113))
FT                   /locus_tag="ANIA_01412"
FT                   /old_locus_tag="AN1412.4"
FT                   /note="transcript_id=CADANIAT00008023"
FT   CDS_pept        complement(join(652282..652460,652508..654113))
FT                   /locus_tag="ANIA_01412"
FT                   /old_locus_tag="AN1412.4"
FT                   /product="Probable lysosomal cobalamin transporter
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDG8]"
FT                   /note="transcript_id=CADANIAT00008023"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008023"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008023"
FT                   /db_xref="GOA:Q5BDG8"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BDG8"
FT                   /protein_id="CBF84806.1"
FT                   /translation="MILLQTSLIWVVYAVVVVVLFAVASVFIYVYQSPRDRSPSVTLTC
FT                   IVAITSLLATILLLPVDVALVSSTVSSSVGQRKDWATPEVVDRITFSLTLVYYILYSLD
FT                   ILLCLLVVPFVYFWYEEYDEVAAQTGEQSSGQRFWGASKYTLSFIAILIILFLVGVFVP
FT                   ISRANGGNGLDPFKSLLGENREDPHIETRSQVSANCWFAGGERALTFALGLLITIGMYV
FT                   YALHTSTGLAVLPIRLIKGGPRLSNAGSWNATFTVQLDSNRERRRQLEGRCGGNFDHLS
FT                   SKDRRELDALIREERTLIRRQRLAQEADGKGNALLPRMWFRLEAFFRPFRRLVGLILLL
FT                   LVLLIWVSMILTASDKAKNSICKRHCGYVLGHINIFNPINEIFVQSAKLFPIDYAIFTM
FT                   LVLLLFFGTVVGIATVGIRFLWISIFRIRLGHTSPQALLVMTAILMLSILALNYSISMI
FT                   VAPQYATFGPQTFCDRLSGSSVLPELQCVVKRCSEAFGSDAAKKVCTPSVASTVLNRVT
FT                   VSFPFFGAIFFWSQFAFIGVYLLALITSLLRSPKLDEQQLDEDAEEAEEEALLSGSRRN
FT                   MDDRWQSIVGRASRSEDT"
FT   gene            654515..659112
FT                   /locus_tag="ANIA_01413"
FT                   /old_locus_tag="AN1413.4"
FT                   /product="Protein cft1 (Cleavage factor two protein 1)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDG7]"
FT   mRNA            join(654515..656420,656492..656751,656797..656964,
FT                   657012..657341,657389..657584,657690..657765,
FT                   657811..658264,658309..658456,658508..659112)
FT                   /locus_tag="ANIA_01413"
FT                   /old_locus_tag="AN1413.4"
FT                   /note="transcript_id=CADANIAT00008024"
FT   CDS_pept        join(654515..656420,656492..656751,656797..656964,
FT                   657012..657341,657389..657584,657690..657765,
FT                   657811..658264,658309..658456,658508..658989)
FT                   /locus_tag="ANIA_01413"
FT                   /old_locus_tag="AN1413.4"
FT                   /product="Protein cft1 (Cleavage factor two protein 1)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDG7]"
FT                   /note="transcript_id=CADANIAT00008024"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008024"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008024"
FT                   /db_xref="GOA:Q5BDG7"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BDG7"
FT                   /protein_id="CBF84808.1"
FT                   /translation="MQCYTELISPTGVTHALAVPFLSATANNLIVARTSLLQIFSLRDV
FT                   SLSALDTEVRPAQHRQETCKLVLEREYQLPGTVTDICRVKILKTKSGGDAVLVAFRDAK
FT                   LSLVEWDPERYGLSTISIHYYERDDMTRSPWASDLSTCGSILSADPGSRCAIFQFGARS
FT                   LAIIPFHQPGDDLVMDDFGSEPDYENRVEGNSRSHEAKDKDAAEYQTPYASSFVLPLTA
FT                   LDPSVIHPISLAFLYEYREPTFGILYSQVATSHALLHERKDVVFYTVITLDLEQRASTT
FT                   LLSVTRLPSDLFKVVALPPPVGGSLLIGSNELVHIDQAGKTNAVGVNEFSRQASSFSMT
FT                   DQSDLALRLENCVVERFSDDNGDLLLALSTGVFALVSFKLDGRSVSGISVRPLSGPSKE
FT                   FLASTASSSAFLGNGKVFFGSESADSVLLGWSSASSATKKSFSGSTSNDESEDDAYEDD
FT                   LYSSAPAAMTDNPQNQPSNSSVAAFGDLRIHDRLSSPGPIRDIVLGRSSEASSRDTKDG
FT                   VLELVAAQGSDEGGTMVIMKREVDPYLVASMAADTANSLWTVSLLPDNNDQKRDYVILS
FT                   KQEKPDKEESEVFVLEDKLRPITAPEFNPNHELTVEIGTLASKSRVIQVLRNEVRSYDA
FT                   VWDEDDSDERVAVNATLVDPYLAIIRDDSTLLLLQADDSGDLDEVTLSEDVVSQKWLSA
FT                   CFYSDNAGFFTAPFASILFLLNQDHQLYVYRLPDFAVISVIEGVGCLPPILSTEPPKRS
FT                   TTRENVLQIAVVELGDSYSSLPFLILRTENDDLVVYKPFFTNSKELTGLRFLKEANHTL
FT                   PKTPNTTDELQSEMKPLRILPNIAGCSSIFMPGPSAGFIFRASTTSPHFIRLRGGFIKG
FT                   LGCFDSPDKGFAYLDSHGLHLAKLPEGTQLGYPWIMRTVPIGQQIDKLTYVSASDTYVL
FT                   GTCQRCEFRLPEDDELHPEWRNEEISFLPEVNQSSLKVVSPKTWSVIDSYPLEPAEHIM
FT                   VMKTMSLEVSENTHERRDMIVVGTSLARGEDIPSRGCIYVFEVIEVVPDPEQPETNRRL
FT                   KLIGKEPVKGAVTALSEIGGQGFLIAAQGQKSMVRGLKEDGSLLPVAFMDMQCFVSVIK
FT                   ELKGTGMCIFGDAVKGLWFAGYSEEPYKMSLFAKDLDYLEVLAADFLPDGNKLFIVVAD
FT                   SDCNLYVLQYDPEDPNSSNGDKLLNRSKFHTGNFASTVTLLPRTLVSSERAMSGSDKMD
FT                   IDNTAPLHQVLVTSHNGSIGLVTCVPEESYRRLSALQSQLTNTLEHPCGLNPRAYRAVE
FT                   SDASAGRGMLDSNLLLQYLDMSKQRKAEIAGRVGATEWEIRADLEAISGGGLGYL"
FT   gene            complement(659328..661916)
FT                   /locus_tag="ANIA_01414"
FT                   /old_locus_tag="AN1414.4"
FT                   /product="Protein pacG (Nonrepressible acid phosphatase
FT                   regulator pacG) [Source:UniProtKB/Swiss-Prot;Acc:Q05534]"
FT   mRNA            complement(join(659328..659898,659955..661500,
FT                   661559..661916))
FT                   /locus_tag="ANIA_01414"
FT                   /old_locus_tag="AN1414.4"
FT                   /note="transcript_id=CADANIAT00008025"
FT   CDS_pept        complement(join(659824..659898,659955..661500,
FT                   661559..661704))
FT                   /locus_tag="ANIA_01414"
FT                   /old_locus_tag="AN1414.4"
FT                   /product="Protein pacG (Nonrepressible acid phosphatase
FT                   regulator pacG) [Source:UniProtKB/Swiss-Prot;Acc:Q05534]"
FT                   /note="transcript_id=CADANIAT00008025"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008025"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008025"
FT                   /db_xref="GOA:Q05534"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR024061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05534"
FT                   /protein_id="CBF84810.1"
FT                   /translation="MEGFDTMALPYLASPLSLGNMQGTDYLNALQGMDLPDQRSNFDSE
FT                   TFVSGDDLTFAHLSPQTLKRFSSGYEDSFPEMVTSFDPPPPAEPPADSSIDHNNKLLSF
FT                   SMPVYPWTLLDYSFRRASISISAQLHGMFFLAESPWTTSPTENAPPQQGAELTCYRRNL
FT                   FQITGSVTLPRALRYIITDTGDRIPIVAHELTVSATESVEGNSVKIISVPWKTPAANDA
FT                   GKDTGNSSNTAAKVEKEPPAIPLDMLTGQDLDADYATFPIAWKRLQFRVATANNGRRKE
FT                   LQQHFVVRLRVVATLSTGMKTPICEVHSGPVIVRGRSPRNFQSRKDLPLSGSAAASRKN
FT                   AQAAAASNNLTRTSPSLTDKAKTVVKSSSPETSSNGVPQQSPPNWALATNSTLPPPTTT
FT                   TLPHSSVYSQSSPEFSRPVEAHRRTTSAIAAPINLSLLDDDSLNLSNGDSRPHTSFSND
FT                   LASKSLSVDSGRPVKMRKVSHSMPQAQSRSTSATFLNTANFQQMLPVPFTSESADVLYE
FT                   YFPLGLEDWQGPVDAVYRPHVVHHTNMPQMKYITARGQSKRYFAAEDSYSLVEAICPSG
FT                   WTYSRIISRTMI"
FT   gene            663947..664550
FT                   /locus_tag="ANIA_01415"
FT                   /old_locus_tag="AN1415.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(663947..664193,664393..664550)
FT                   /locus_tag="ANIA_01415"
FT                   /old_locus_tag="AN1415.4"
FT                   /note="transcript_id=CADANIAT00008026"
FT   CDS_pept        join(663947..664193,664393..664550)
FT                   /locus_tag="ANIA_01415"
FT                   /old_locus_tag="AN1415.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008026"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008026"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008026"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDG5"
FT                   /protein_id="CBF84812.1"
FT                   /translation="MPQKDARRQWKRRMRRGLSLPEGPAALSDREKAALDPDKLVDHFS
FT                   FRGAKRGQALAKESQHSSILHLLHRQPTSAARFNLCRRFQRNSPEEPEGKLIRLTADGS
FT                   TPGDDPIGRLFLVPHSSQSLDGHSRLPGVH"
FT   gene            complement(665107..668089)
FT                   /locus_tag="ANIA_01416"
FT                   /old_locus_tag="AN1416.4"
FT                   /product="beta-N-acetylglucosaminidase, putative
FT                   (AFU_orthologue; AFUA_8G04060)"
FT   mRNA            complement(join(665107..665220,665266..667754,
FT                   667803..667921,668040..668089))
FT                   /locus_tag="ANIA_01416"
FT                   /old_locus_tag="AN1416.4"
FT                   /note="transcript_id=CADANIAT00008027"
FT   CDS_pept        complement(join(665107..665220,665266..667754,
FT                   667803..667921,668040..668089))
FT                   /locus_tag="ANIA_01416"
FT                   /old_locus_tag="AN1416.4"
FT                   /product="beta-N-acetylglucosaminidase, putative
FT                   (AFU_orthologue; AFUA_8G04060)"
FT                   /note="transcript_id=CADANIAT00008027"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008027"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008027"
FT                   /db_xref="GOA:Q5BDG4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDG4"
FT                   /protein_id="CBF84813.1"
FT                   /translation="MAPKEDALPPGWDDLDRQMGQLFMMGFDGTTVSPQIRSLIQKYHI
FT                   GSVLLTAKNLKSAEDATRLILELQTIARDAGHPVPLLIALDQENGGVNSLYDEIYIRQF
FT                   PSAMGIAATGSKDLAHDIAFATAQELKAVGFNWILGPVLDVLTNVRNQLMGVRTCGDDP
FT                   QEVSQYGVEFMKGYQQAGLSTCGKHFPSYGNLEFLGSQTDVPIITESLEQLSLTALVPF
FT                   RNAIMNGLDAMMVGGVSMSSAGVNVMHACLSEQVVDDLLRKDMKFDGVVVSECLEMEAL
FT                   THNIGVGGGTVMAKNAGCDIILLCRSFQVQQEAINGMKLGVENGIINRTRIEESLRRVL
FT                   AMKGRCTSWEQALNPGGLPSLTQMQPSHTSLSTRAYSNSISVVRDNRNLLPLTNVLSSN
FT                   EELLLLTPLVNPLPASAVSRSVTEHLELSADAVAWDRTASVLSGESVFKELGRSLSRHR
FT                   NGRVLHTSYTSNGVRPIHESLIDRASAVIVITADAVRNIYQQGFTKHVSMICKSQLTPS
FT                   GEPLDKPLVVVAVSSPYDFAMDASIGTYLCTYDFTDTALETLVKVLYGELTPTGSLPGS
FT                   FNRSQKLHQARQHWLVENWNEERDSDALDALLKTMGPELSGVTPSSFLLRRDDIDEAHF
FT                   VVRNSTTRALYGFCSTYYFRATGTGVIGSLIVDPSRRRLSIGNSLHNRAIRTLMQRKGM
FT                   KRFQLGSRLPGIYLGIPAANPVERKKRRQWFANLGWNTALSRPVCNVALRNLQTWSPPE
FT                   GLVNSLQSADAVYDLVHGWDYADSIIDHVKTNSRQGVIDIYKIALGGAPHCGIIRARRP
FT                   HDGAILGSVVIYNMQATLAEHMPATKAMHVPTGGISSPVIWPSVGEYATLLQGLILLGI
FT                   KQIRRQGADAVVIDCVDVDSNFDWLTEIGFTTLHSYEEVNCDAATWTMVPGP"
FT   gene            complement(670899..671984)
FT                   /locus_tag="ANIA_01417"
FT                   /old_locus_tag="AN1417.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(670899..670935,671011..671145,
FT                   671176..671267,671345..671412,671502..671536,
FT                   671683..671984))
FT                   /locus_tag="ANIA_01417"
FT                   /old_locus_tag="AN1417.4"
FT                   /note="transcript_id=CADANIAT00008028"
FT   CDS_pept        complement(join(670899..670935,671011..671145,
FT                   671176..671267,671345..671412,671502..671536,
FT                   671683..671984))
FT                   /locus_tag="ANIA_01417"
FT                   /old_locus_tag="AN1417.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008028"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008028"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008028"
FT                   /db_xref="GOA:Q5BDG3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDG3"
FT                   /protein_id="CBF84815.1"
FT                   /translation="MVNRPIDVVANSFVNPWLRCTRHPGSAFPVERDTTLSYYWLPALE
FT                   AHEARSFKIAGRDDDDTAECFFGPLKDHYWILSSPNCMTTHINTGLARMMRASLGICRW
FT                   DGTSARSHPQCNPGCEVVFAPSLMTDQQEVRTRDSGRVMLKLQADDNRATEVIFSRNRF
FT                   WILQRQSIRQWSKAVTKLTTFTETVNSVNGAWTEDSYQVVKLIGVRTRSSGANQLALWR
FT                   "
FT   gene            672049..673604
FT                   /locus_tag="ANIA_01418"
FT                   /old_locus_tag="AN1418.4"
FT                   /product="glucosamine-6-phosphate deaminase, putative
FT                   (AFU_orthologue; AFUA_1G00480)"
FT   mRNA            join(672049..672145,672199..672260,672326..672474,
FT                   672523..673604)
FT                   /locus_tag="ANIA_01418"
FT                   /old_locus_tag="AN1418.4"
FT                   /note="transcript_id=CADANIAT00008029"
FT   CDS_pept        join(672144..672145,672199..672260,672326..672474,
FT                   672523..673386)
FT                   /locus_tag="ANIA_01418"
FT                   /old_locus_tag="AN1418.4"
FT                   /product="glucosamine-6-phosphate deaminase, putative
FT                   (AFU_orthologue; AFUA_1G00480)"
FT                   /note="transcript_id=CADANIAT00008029"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008029"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008029"
FT                   /db_xref="GOA:C8VM31"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM31"
FT                   /protein_id="CBF84817.1"
FT                   /translation="MRVIIRDTSLQASEYIADYIISRIKAYKPSESNPFVLGLPTGSSP
FT                   EIIYKTLVRRYKAGDISFRHVVTFNMDEYVGLPRDHPESYHSFMYKHFFSHVDIPPQNI
FT                   NILDGNATDLAAECASFEARIARYGGIELFLGGVGSDGHIAFNEPGSSLNSRTRVKTLA
FT                   YDTILANSRFFNNDMAQVPRMALTVGIRTIMEAREVVIVATGAHKALAVKEGLEGGVNH
FT                   MWTISSLQLHQHPLIVCDRDATLELKVKTVRYFESIEQAGTDARTQGPPLVYRPRTYVP
FT                   APMTVNKSNGELTPIATPEKTSKDLRINTDLTRSFEDDELTPDSMSSRMVDSAVGGLDA
FT                   TLKGDLMFDRMGARMEAH"
FT   gene            673933..674417
FT                   /locus_tag="ANIA_11301"
FT                   /old_locus_tag="AN11301.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(673933..674082,674391..674417)
FT                   /locus_tag="ANIA_11301"
FT                   /old_locus_tag="AN11301.4"
FT                   /note="transcript_id=CADANIAT00008030"
FT   CDS_pept        join(673933..674082,674391..674417)
FT                   /locus_tag="ANIA_11301"
FT                   /old_locus_tag="AN11301.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008030"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008030"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008030"
FT                   /db_xref="GOA:C8VM32"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM32"
FT                   /protein_id="CBF84819.1"
FT                   /translation="MDICSRVLRKRNQASRTAPADTVPVRVNDLQLQIVPLPRRTSRAQ
FT                   LTTSNKRRNFTTG"
FT   gene            674812..675977
FT                   /locus_tag="ANIA_01419"
FT                   /old_locus_tag="AN1419.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(674812..674909,675083..675174,675513..675542,
FT                   675799..675977)
FT                   /locus_tag="ANIA_01419"
FT                   /old_locus_tag="AN1419.4"
FT                   /note="transcript_id=CADANIAT00008031"
FT   CDS_pept        join(674812..674909,675083..675174,675513..675542,
FT                   675799..675977)
FT                   /locus_tag="ANIA_01419"
FT                   /old_locus_tag="AN1419.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008031"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008031"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008031"
FT                   /db_xref="GOA:Q5BDG1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDG1"
FT                   /protein_id="CBF84821.1"
FT                   /translation="MSRLLWMASDIQTQNEDACLGIHQLLPSTQCRASLSRVYFPVFKK
FT                   RENLTAHYQGAEAISILGRLREANIQKLDGDNNGSAIPTGAVMTKLLTLSSYGLDIVLF
FT                   QLEPRQHQSRISTDCGVRLINGKVAKSV"
FT   gene            complement(676771..679433)
FT                   /locus_tag="ANIA_01420"
FT                   /old_locus_tag="AN1420.4"
FT                   /product="Protein sip5
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDG0]"
FT   mRNA            complement(join(676771..678843,678905..679433))
FT                   /locus_tag="ANIA_01420"
FT                   /old_locus_tag="AN1420.4"
FT                   /note="transcript_id=CADANIAT00008032"
FT   CDS_pept        complement(join(676771..678843,678905..679297))
FT                   /locus_tag="ANIA_01420"
FT                   /old_locus_tag="AN1420.4"
FT                   /product="Protein sip5
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDG0]"
FT                   /note="transcript_id=CADANIAT00008032"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008032"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008032"
FT                   /db_xref="GOA:Q5BDG0"
FT                   /db_xref="InterPro:IPR039301"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BDG0"
FT                   /protein_id="CBF84823.1"
FT                   /translation="MGNSQTKETRPSHSQSSRRSHQWGSGSSHGRSPYGDRHNSEGSRS
FT                   HRSSRPDLSILGLGGSSDRDVATILEHRRETKQEREARRLEKERAARIKERERSMREEH
FT                   VDGGYLVTQGVYTGTEDFNKAIVRQLMIERRLAPFWRGLNDFSDSWTEHQLMAAARGLP
FT                   IPPPDEIPPELEYRNPPKVVEEAKEASNIQSVQHLMVPITSRSASNGSDVSHSSQPAHS
FT                   LPSPSSPIASGTSSSPLFRSRAKTLASLTTSRHNSQVDSTPQEIQLPRDPFVNGQPIEA
FT                   YLYKDAIECPICFLYYPPYLNRTRCCDQPICSECFVQIKRPDPHPPEHADSDSNAPNPA
FT                   GETERQDVQDIQLVSEPAACPFCVQPEFGVAYVPPPFRRGLAYASDSSGRPNIGTPVSS
FT                   TSSLSSATTPTTGRRRATSLSATDPSVITTDKVRPDWAQKLANARAHAARRSAAATALH
FT                   TAAYLMNSNGSGGDTRGFSMRRGVMRRNNGGQDSPGTPGRSGSPALQAFAFLTDRRAPS
FT                   GQETDSAEEGTSNLAPPRNSSRRSRMDDLEEMMMMEAIRLSLASEEERRKREEKELRKE
FT                   AKRREKEAKKAEKMARKAGLYSNNASSSALESPSDSRLPKVTSSSSSIIGEERTPPGKG
FT                   KAVERVTPSQSNVDLTETASSGDVPSSFLEPQQPQSSSSLGPPVPKEPSKPSHLRHVSS
FT                   ASSSFSSLVESMSEEPGLSAQPHEGTSSSAEPLFNFRSLAAVIGDEDKSDEAAEHVEDT
FT                   APHTTSEGSTSSAANLTTAPAGESAVSTSSTAVEKGPTVEESQECSVNKEIETRSMEVT
FT                   DSRNSETTS"
FT   gene            680504..682144
FT                   /locus_tag="ANIA_01421"
FT                   /old_locus_tag="AN1421.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            680504..682144
FT                   /locus_tag="ANIA_01421"
FT                   /old_locus_tag="AN1421.4"
FT                   /note="transcript_id=CADANIAT00008033"
FT   CDS_pept        680504..682144
FT                   /locus_tag="ANIA_01421"
FT                   /old_locus_tag="AN1421.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008033"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008033"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF9"
FT                   /protein_id="CBF84825.1"
FT                   /translation="MTSESSATTRLHITPLNPELIPSVLPASVRSLASDISFHGIPTFP
FT                   ENNYGYVTLPKMEAEKLKKKLNGSILKGRKFKVEPARPQKRQAEEGDEQNFTSTDNPSV
FT                   TVKSKKRKAEENVLSGYELPSDRKVKRGWTESTTDKTERRKKEKRSKDKQEKKAKTQLK
FT                   SKYTEKPECLFRTKVPPNKSALAEEKSKKQPKKKKTSPESVVHEFAQTVTHPTFLRSED
FT                   GGNALICTFEEGKGWVDESGNLKEPASERVRKHQYRPGQIAGHKEKPKKIKVKSAPETD
FT                   SAKTSSSRNAEVKETESTESTESTESEDWTSSSGSSSESDITDSESDDTASSSLPESGE
FT                   SGNFELSSSRNEQQQAATHVSSEEEPEGSAKSGVLPKGNSTEATSQQGSTEVHPLEALF
FT                   KKPADQQKLDTEPPVQFSFFGQGDADSDAGFEEELSSNVAPLTPFTKRDLLDRGLRSAA
FT                   PTPDTSQVSKIINWNTPKISSNAVGEDYSFTDSPMPKSGTAATEESDFSKWFWENRGDN
FT                   NRAWKKRRRDAAKEQRQRENRRKGMKGKS"
FT   gene            682460..683166
FT                   /locus_tag="ANIA_01422"
FT                   /old_locus_tag="AN1422.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(682460..682541,682613..682870,682946..683052,
FT                   683113..683166)
FT                   /locus_tag="ANIA_01422"
FT                   /old_locus_tag="AN1422.4"
FT                   /note="transcript_id=CADANIAT00008034"
FT   CDS_pept        join(682460..682541,682613..682870,682946..683052,
FT                   683113..683166)
FT                   /locus_tag="ANIA_01422"
FT                   /old_locus_tag="AN1422.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008034"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008034"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008034"
FT                   /db_xref="GOA:Q5BDF8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF8"
FT                   /protein_id="CBF84827.1"
FT                   /translation="MSRRNFIWHFLLLFIALLSFASSALASSPASFCKCTCFSNSTIIP
FT                   LDPDKGDSSLHGTLGLFSRNNYIDNQDEKRAGNYRSLSCNDCNRKFCLGYDLPTCKGAK
FT                   EDDVLTTCFQRDSRKDEAIVFIFIIATGGLLLWAVFRPWVQKWMEAARERRTYIPVSDS
FT                   PRL"
FT   gene            684378..685985
FT                   /locus_tag="ANIA_01423"
FT                   /old_locus_tag="AN1423.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_8G04150)"
FT   mRNA            join(684378..684684,684789..684794,684856..685985)
FT                   /locus_tag="ANIA_01423"
FT                   /old_locus_tag="AN1423.4"
FT                   /note="transcript_id=CADANIAT00008035"
FT   CDS_pept        join(684378..684684,684789..684794,684856..685985)
FT                   /locus_tag="ANIA_01423"
FT                   /old_locus_tag="AN1423.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_8G04150)"
FT                   /note="transcript_id=CADANIAT00008035"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008035"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008035"
FT                   /db_xref="GOA:Q5BDF7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF7"
FT                   /protein_id="CBF84828.1"
FT                   /translation="MVKDFHMGEGSDASFYAGILVATFSLVEAFTGMFWGALSDRVGRK
FT                   PVIISGLAGTIVSLLIVGFAPNYWVALLGRGLGGLLNGNIGVIQTMVGEIVKRPEHERP
FT                   AIGGLLAKPADNYPSVFSRDGIFGRFPYLLPNVVCSTLLLGSILFAWAFLQETHPDMQP
FT                   SIGSGELDHPSAEHPLLATAGATANPGVDLRAESYGTFNQVHVQDDEYWRVQENGSKTE
FT                   PDLQKPTAFTRPVILLIIALAIFTYHSMTYDHLLPIFLQDQRGDPHLNGSTFSFPGGLG
FT                   LSTGTVGLIVSSDGIIALIIQSLIFPALAHWLGVWKLFIIVTVLHPVAYFMVPFLVFLP
FT                   QQHLLFGIYTCLVTRNILSIIDFPVLLILIKQASPSDTCLGKINGLAASAGAAARTVAP
FT                   PIAGYLYSVGAQIKFTALAWWGSAFVAVIGALQLVLMAQKKHSLITIEPAAHCHFAPDR
FT                   PHGRKESIHIVVTDTDEVVNGA"
FT   gene            686615..688949
FT                   /locus_tag="ANIA_01424"
FT                   /old_locus_tag="AN1424.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            686615..688949
FT                   /locus_tag="ANIA_01424"
FT                   /old_locus_tag="AN1424.4"
FT                   /note="transcript_id=CADANIAT00008036"
FT   CDS_pept        686615..688777
FT                   /locus_tag="ANIA_01424"
FT                   /old_locus_tag="AN1424.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008036"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008036"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008036"
FT                   /db_xref="GOA:Q5BDF6"
FT                   /db_xref="InterPro:IPR024312"
FT                   /db_xref="InterPro:IPR039915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF6"
FT                   /protein_id="CBF84830.1"
FT                   /translation="MNLSIRQSFGYHNDDFKTRDDQIGEEDALSFNDLQSSPFRPDGRD
FT                   DTVDMQMLQKYQTSHDMSGLSTTPRKRSYDQAPDVHDLERDEIERHKRSVGRKDIPDIN
FT                   IYVDEDSRISYDQSAHDVTKQDMENSNMKEKQHEGMSTVLNEEHEDISSRDQNDFDDDA
FT                   SAVMVDDETHDLMDDTCLSTFSAVPNVDMTAFANLPGGSPFKTPRPLPEFPAENKDTRR
FT                   GSMEPATPVTAKRSPSKNILLDMSSPAGLPTPGKRQRDDPTPSETPNLLDLTDSIDLFP
FT                   RRQRYIMQQQGRYSPSRRSPLRNPRSPAKTSLLDFDIPAAPTPRSIPTVTPRELESLKS
FT                   GFLSEISSLKATLSGKEAEVSSLKKAVSDAERRVGEALEEVRIEAARKETLEIEQAEWQ
FT                   RRGREMEDVLRSVRADILEGEQERERLQKKNEEAERGKEQLQRRIVELETQLSAAQKSA
FT                   VCEHTTSETAAPSKTAEETAKEIQDAVEKVARDLHSLYKEKHETKVAALKKSYEARWEK
FT                   RLREAEKKLKAANDECEQLKAERDAALQESARPDASMISRENEQHEAAKHVFEAQIAGL
FT                   QQEITILKSNSEQLRAELKAERAEKGDLVALVEEWLSMQNQQPAPSPQAKSHEVTPEPV
FT                   PNEQLTPTEDAEREVTRSSSSGLRGPSSGSVSTSSHGEKKIPRFGAPAGRHVRGTSGGK
FT                   SGIAVFTPGRSGIMGSIERMGRGGAA"
FT   gene            693070..695753
FT                   /locus_tag="ANIA_01425"
FT                   /old_locus_tag="AN1425.4"
FT                   /product="FarB [Source:UniProtKB/TrEMBL;Acc:Q1WD25]"
FT   mRNA            join(693070..693308,693364..693548,693616..695753)
FT                   /locus_tag="ANIA_01425"
FT                   /old_locus_tag="AN1425.4"
FT                   /note="transcript_id=CADANIAT00008037"
FT   CDS_pept        join(693070..693308,693364..693548,693616..695753)
FT                   /locus_tag="ANIA_01425"
FT                   /old_locus_tag="AN1425.4"
FT                   /product="FarB [Source:UniProtKB/TrEMBL;Acc:Q1WD25]"
FT                   /note="transcript_id=CADANIAT00008037"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008037"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008037"
FT                   /db_xref="GOA:C8VM39"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM39"
FT                   /protein_id="CBF84832.1"
FT                   /translation="MTDSPVAPNPAVETDPKSKRKASSAGLSANSRPVKRRASKACCCC
FT                   RARKVRCDVVENGSPCTNCRLDQVECVVTESKRRKKSRVDTEISNPQLSQSPAEILDDG
FT                   ALFGGLGDTQGIPHVAPTSPSQGSVDMEQGQHMPHLLYQSQVNRVDPGDRFRKRMAPNP
FT                   LVPSSMPLSHVTSEIQQLLDPSFGSPRSSGIVLPDYIRGLPARLQKEDIDYLAMKGALT
FT                   VPDVTLRNELLKAYIHYVHTYMPLLDLEDFLQTIVQNDGIRRMSLLLFQAVMFAGTAFI
FT                   DLKHLQAAGYPSRKSARKSFFQRARLLYDFDYEVDRISLVQSLLLMTYWYETPDDQKDT
FT                   WHWMGVSLSLAHTIGLHRDPANSRMDVRRQRMWKRIWWSTYTRDRLIALGMRRPMRVKD
FT                   DDCDVPMLTLDDFEFHPFSPEIVSMVGNSEILQSVAHQRELASMFIEKAKLCLCVSHVL
FT                   SAQYSVLSHKFGGTMETTMMLVPKKSAAETFEVRRCDQELEDWLAHLPSEIQYAPAAPA
FT                   KLSEAQEVLHSHRALLKMVYLTTSSALHRPQVLPAVPFPSMDTELQDMSRNKVRFAAIE
FT                   ITNIAQDLHSLDLTRYFPTTGVTVLLPAVIIHLLDIKSSDQNVRMTSLQRFYQCMRILQ
FT                   RLREIYASADFATSFLEAAIRKAGIQLTVPPQELQKRSNNSGASRNTTLTPPPDSLAQK
FT                   IPDLTYPKTGSMGGMTLNLVDEAQPAFASTPPPSDGSENGSTNNINPNYHRDAFRIPNI
FT                   DDTEMSLSQLMDLANDAEVTQNDFDALINFDDAGADFFSSENGVENMTGDGNSKNFPFT
FT                   FQDMVGFDSGNKSDAAASNGADAAQTEAPNLDMDLGLSLNA"
FT   gene            696734..698825
FT                   /locus_tag="ANIA_01426"
FT                   /old_locus_tag="AN1426.4"
FT                   /product="hypothetical serine carboxypeptidase (Eurofung)"
FT   mRNA            join(696734..697096,697153..697257,697310..697426,
FT                   697480..697736,697786..697836,697890..698043,
FT                   698099..698157,698200..698825)
FT                   /locus_tag="ANIA_01426"
FT                   /old_locus_tag="AN1426.4"
FT                   /note="transcript_id=CADANIAT00008038"
FT   CDS_pept        join(696745..697096,697153..697257,697310..697426,
FT                   697480..697736,697786..697836,697890..698043,
FT                   698099..698157,698200..698775)
FT                   /locus_tag="ANIA_01426"
FT                   /old_locus_tag="AN1426.4"
FT                   /product="hypothetical serine carboxypeptidase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008038"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008038"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008038"
FT                   /db_xref="GOA:Q5BDF4"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF4"
FT                   /protein_id="CBF84834.1"
FT                   /translation="MSRLCLISLLSLAAASLGAAEGHPRFSFNKRQLPADATGVKKFKT
FT                   PNGVTIRYKEPGKEGVCETTPGVNSYSGYVDLSPESHTFFYFFEARHDPANAPITLWLN
FT                   GGPGSDSLIGLFEELGPCAISENLTTYVNPYSWNEVSNLLFISQPLGVGFSYAETEEGS
FT                   LNPVTGVVEDSSFAGVQGRYPKINATLTDTTELAAKATWEVVQGFLGGLPQLDSTIKSK
FT                   DFNLWTESYGGHYGPAFFNHFYEQNQKIRNGTIDGIELNFNSLGIINGIIDEGIQAPFY
FT                   PEFAVHNTYGIKAVNETVYNYMKFANEMGNGCQDQIALCKATNRSSFADYALCSEATNM
FT                   CRDNVEGPYYSYGNRGVYDIRHPYNEKDPTPPNLFVPFLQQDWVMNALGVNINYTSSNN
FT                   EIYYAFQQTGDFVWPNFIEDLEEILTYPVRVSLIYGDADYICNWFGGQAVSLAVKYPHS
FT                   KQFQAAGYTPLLVDGVEYGETREYGNFSFSRVYEAGHEVPYYQPAASLQLFNRTLFGWD
FT                   IAEGKVQTWPGYSTNGTAWPTHTESFVPLPTATPSKGLF"
FT   gene            complement(698944..701330)
FT                   /locus_tag="ANIA_01427"
FT                   /old_locus_tag="AN1427.4"
FT                   /product="DUF895 domain membrane protein (AFU_orthologue;
FT                   AFUA_8G04110)"
FT   mRNA            complement(join(698944..699463,699517..699612,
FT                   699665..700278,700339..701330))
FT                   /locus_tag="ANIA_01427"
FT                   /old_locus_tag="AN1427.4"
FT                   /note="transcript_id=CADANIAT00008039"
FT   CDS_pept        complement(join(699220..699463,699517..699612,
FT                   699665..700278,700339..700911))
FT                   /locus_tag="ANIA_01427"
FT                   /old_locus_tag="AN1427.4"
FT                   /product="DUF895 domain membrane protein (AFU_orthologue;
FT                   AFUA_8G04110)"
FT                   /note="transcript_id=CADANIAT00008039"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008039"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008039"
FT                   /db_xref="GOA:Q5BDF3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF3"
FT                   /protein_id="CBF84836.1"
FT                   /translation="MATVNEKAAPLSTTDPEVQQDSQRLPGKPWMYKNLKLGPLTVPYY
FT                   ASPQFQLVLVAFVCFLCPGMYNSVNGLGGAGQLNHSDISKSNTATYSTFAVVGFFAGSI
FT                   ANRIGLRLTLSFGGFGYTLYVAALLCYNHTYNSGFLIFAGALLGLCAGLLWCAQGAVMM
FT                   AYPGENEKGKFISIFWVIFNLGGVIGGLIPLGQNIHNSDSAGSVNDGTYIAFMVLMVLG
FT                   FLLAWGLVDSKNIVRKDGTRVIAIKNPSWKSELLGLYETLLTDWYIVAFFPMFLASNWF
FT                   YSYHFNAINGSYFVPRAAALNSILYWAMQMIGAFCFGLILDLKSLKRPARAKLVWVLLF
FT                   TITMGVWGGGYAFQKTYTRETAGRSKDWNQSGYIGPMFLYMFYGFYDAAFQTCAYWFMG
FT                   CLSNNSRKLANFAGFYKGIQSAGAAITWALDFNETPYMNMFASCWGILCGSLLIASPII
FT                   FFKIKDHTDLEEDLKFSDETVADVTGIEVGDVTLRPQQQHTPEKRSPSDA"
FT   gene            702586..703878
FT                   /locus_tag="ANIA_01428"
FT                   /old_locus_tag="AN1428.4"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase
FT                   (NagA), putative (AFU_orthologue; AFUA_8G04100)"
FT   mRNA            702586..703878
FT                   /locus_tag="ANIA_01428"
FT                   /old_locus_tag="AN1428.4"
FT                   /note="transcript_id=CADANIAT00008040"
FT   CDS_pept        702586..703878
FT                   /locus_tag="ANIA_01428"
FT                   /old_locus_tag="AN1428.4"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase
FT                   (NagA), putative (AFU_orthologue; AFUA_8G04100)"
FT                   /note="transcript_id=CADANIAT00008040"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008040"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008040"
FT                   /db_xref="GOA:Q5BDF2"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF2"
FT                   /protein_id="CBF84838.1"
FT                   /translation="MPGKAALPSHVIKFTNCRIVKGNELVNQDVWIESTSGKILRAQEA
FT                   FYGLHLSPDEVIDLGGRILAPGLIDCQLNGAQGFDFSIPQASKEEYDEGLRVVNKGLAR
FT                   TGVTSYLPTLVSSTAEVYHKVLPSLGPAGSKHRPEDGAESLGAHVEGPFLSPGRNGIHK
FT                   TDVLRSATTVEDLDDCYGRENLYGPNKTIRLITAAPEVGKMMSNIPHIVSNDIIYSIGH
FT                   SDATYEQALAAIDQGATMVTHLFNAMRPFYHRNPGIFGVLGQQSERRRSLFYGIIADGI
FT                   HLHPTSIRIAYNAHPDGLVLVTDAMKLCGLPDGIYDWTNGERIVKTGARLTLEGSDKIA
FT                   GSSATLIECVNNFRRWSGASTAQALNAASAVPARLLGLQGVKGSLDSGADADLLVLSDE
FT                   DDPYSGKTLKVNQVWKRGTKIYDSSKDTGQI"
FT   gene            complement(704222..705965)
FT                   /locus_tag="ANIA_01429"
FT                   /old_locus_tag="AN1429.4"
FT                   /product="choline oxidase (CodA), putative (AFU_orthologue;
FT                   AFUA_8G04090)"
FT   mRNA            complement(join(704222..705603,705656..705965))
FT                   /locus_tag="ANIA_01429"
FT                   /old_locus_tag="AN1429.4"
FT                   /note="transcript_id=CADANIAT00008041"
FT   CDS_pept        complement(join(704222..705603,705656..705902))
FT                   /locus_tag="ANIA_01429"
FT                   /old_locus_tag="AN1429.4"
FT                   /product="choline oxidase (CodA), putative (AFU_orthologue;
FT                   AFUA_8G04090)"
FT                   /note="transcript_id=CADANIAT00008041"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008041"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008041"
FT                   /db_xref="GOA:Q5BDF1"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF1"
FT                   /protein_id="CBF84840.1"
FT                   /translation="MATTTEFPASDVNSYDYVIVGGGTAGCVIASRLAQYLPNKRILLI
FT                   EAGPSDYMDDRVLNLREWLNLLGGELDYDYPTVEQPMGNSHIRHSRAKVLGGCSSHNTL
FT                   ISFRPFEYDCKRWESQGCTGWSFETFTRVLDSLRNTVQPVHDRHRNQLCKDWIQSCSTA
FT                   MNIPIIHDFNKEIRSNGELTQGVGFFSVAYNPDDGRRSSASVAYIHPILRGDEKRPNLT
FT                   ILTNAWVSRVNVDGDTVTGVDITLQSGAKHTLRPKKETILCAGAVDTPRLLLHSGLGPK
FT                   QQLASLGIPVVKDIPGVGENLLDHPESIIIWELNQPVPPNQTTMDSDAGIFLRREAPNA
FT                   AGSDGSAADVMMHCYQIPFCLNTSRLGYDTPVDAFCMTPNIPRPRSRGRLYLTSSDPTV
FT                   KPALDFRYFTDPEGYDAATIVHGLKAAREIAKQSPFKDWIKREVAPGPKVQTDEELSEY
FT                   GRRVAHTVYHPAGTTKMGDVTRDPMAVVDPKLKIRGLKNVRIADAGVFPEMPTINPMLT
FT                   VLAIGERAAELIAEEAGWKREQPRL"
FT   gene            706964..708572
FT                   /locus_tag="ANIA_01430"
FT                   /old_locus_tag="AN1430.4"
FT                   /product="betaine aldehyde dehydrogenase (BadH), putative
FT                   (AFU_orthologue; AFUA_8G04080)"
FT   mRNA            join(706964..707442,707513..708572)
FT                   /locus_tag="ANIA_01430"
FT                   /old_locus_tag="AN1430.4"
FT                   /note="transcript_id=CADANIAT00008042"
FT   CDS_pept        join(706964..707442,707513..708527)
FT                   /locus_tag="ANIA_01430"
FT                   /old_locus_tag="AN1430.4"
FT                   /product="betaine aldehyde dehydrogenase (BadH), putative
FT                   (AFU_orthologue; AFUA_8G04080)"
FT                   /note="transcript_id=CADANIAT00008042"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008042"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008042"
FT                   /db_xref="GOA:Q5BDF0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF0"
FT                   /protein_id="CBF84842.1"
FT                   /translation="MTPSLQRQLFYDGKPQHASSGRTFQSINPADATLLAEIPVASQSD
FT                   IDAAITAAERAFPSWAQTPPIARARILQKAAALLRERNDEIARVETLDSGKAYSETSTV
FT                   DVVTGADVLEYYANLVGGGGLNGETTQLREEAWVYSKKAPLGVCVGIGAWNYPIQIALW
FT                   KSAPCLAAGNTMVYKPSEFTSLHGQTLAEIYKEAGLPDGVFNVVYGAGDVGSYLTSHPT
FT                   VAKVSFTGQVSTGMKVSGAAAGNMKYVTMELGGKSPLLILPDADLENAVDGAMMANFYS
FT                   TGQVCTNGTRVFIPKSMKKDFESRLVEKMQYIRPGPLFDENTNFGPLSSAVHQEKVTAY
FT                   IRHGIEQDKATLLYGGLGKPSLPKDLEAGFWVRPTIFTDCTDDMRIVKEEIFGPVMSIL
FT                   TYDSVEEAVKRANTTELGLAAGVFTKDLNLAHRIIDQLEAGITWVNTWGESPAEMAVGG
FT                   WKKSGLGVENGRRGIEAWVRNKSTLVDMGNAVATVFAKL"
FT   gene            709782..710772
FT                   /locus_tag="ANIA_01431"
FT                   /old_locus_tag="AN1431.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(709782..710632,710664..710772)
FT                   /locus_tag="ANIA_01431"
FT                   /old_locus_tag="AN1431.4"
FT                   /note="transcript_id=CADANIAT00008043"
FT   CDS_pept        join(709782..710632,710664..710772)
FT                   /locus_tag="ANIA_01431"
FT                   /old_locus_tag="AN1431.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008043"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008043"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008043"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE9"
FT                   /protein_id="CBF84843.1"
FT                   /translation="MAILDKDRPRGLRVPSLSSFRSKHKSPESTPTIHLPSPSQMTLQN
FT                   ESIPVSSFKPAEKALPPQPLPSAPQPSSAAGYPYPYPPQTYNNPPTPVSVQNSTPTRPF
FT                   GHDGPAQPPLPALPADRPMPRPIPQSTTPPARRPIPRSTAASTTAPAPAPAPEPAPEPA
FT                   PEPVPAQTSTPVYAPAPIPAPSSVPPVNNLIAQQRTPPLSEGGPEQRKSNGTSDSLEDL
FT                   IPSPEPEPELDGASSTPNETGSSEEDNRPFTPPEVEPVAVPLTKLHYACYQDHRAMPAT
FT                   GNVNSIVRSVTDAFFAACVFAPIVIKRCKNALAVRWHS"
FT   gene            complement(711018..712274)
FT                   /locus_tag="ANIA_01432"
FT                   /old_locus_tag="AN1432.4"
FT                   /product="G-patch domain protein, putative (AFU_orthologue;
FT                   AFUA_8G04200)"
FT   mRNA            complement(join(711018..712102,712173..712274))
FT                   /locus_tag="ANIA_01432"
FT                   /old_locus_tag="AN1432.4"
FT                   /note="transcript_id=CADANIAT00008044"
FT   CDS_pept        complement(join(711140..712102,712173..712274))
FT                   /locus_tag="ANIA_01432"
FT                   /old_locus_tag="AN1432.4"
FT                   /product="G-patch domain protein, putative (AFU_orthologue;
FT                   AFUA_8G04200)"
FT                   /note="transcript_id=CADANIAT00008044"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008044"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008044"
FT                   /db_xref="GOA:Q5BDE8"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR025239"
FT                   /db_xref="InterPro:IPR039249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE8"
FT                   /protein_id="CBF84845.1"
FT                   /translation="MAAEEDEVDYMSMVIEEPQQKETFTQKKRRLQREAEARARVPSKA
FT                   ERAAQEAAKRDAALATSTLNPSNKGFQMMAKLGFKPGQTLGKPAGEDREKEGSGPNAQS
FT                   RTEPLNLIFKEDRGGIGLDSERKRKIREEAEEAAKKIKAEEGDYRDRVRLERETKRIEA
FT                   QIHAAQKVAERLDADENGEADLFSASNVEDKDKNEEKDEKEQEGSDEEAPATKPKAKAK
FT                   VKPTSQINILYRGLVREREEKERAIQTRHMLQTSLPTSFFPNPRLPGYEDATLDRDDHE
FT                   ALGGGRDLSTVLEQEVEEEDPELDEFNTLEPAERLRRLVEYLREKHNYCFWCKYRYDTA
FT                   EMEGCPGVTEEDHD"
FT   gene            713271..714996
FT                   /locus_tag="ANIA_01433"
FT                   /old_locus_tag="AN1433.4"
FT                   /product="triacylglycerol lipase, putative (AFU_orthologue;
FT                   AFUA_8G04210)"
FT   mRNA            join(713271..713489,713538..713891,713947..714996)
FT                   /locus_tag="ANIA_01433"
FT                   /old_locus_tag="AN1433.4"
FT                   /note="transcript_id=CADANIAT00008045"
FT   CDS_pept        join(713271..713489,713538..713891,713947..714996)
FT                   /locus_tag="ANIA_01433"
FT                   /old_locus_tag="AN1433.4"
FT                   /product="triacylglycerol lipase, putative (AFU_orthologue;
FT                   AFUA_8G04210)"
FT                   /note="transcript_id=CADANIAT00008045"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008045"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008045"
FT                   /db_xref="GOA:Q5BDE7"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE7"
FT                   /protein_id="CBF84847.1"
FT                   /translation="MLRPLAVLTALSALVSARDVVVDLGYARYRGEALSNGVAQWLGIR
FT                   YAAPPVGSLRFAAPQDPEDEYEIQDATQHGPVCIRASRYPIPEGSSEDCLFLDVYAPAR
FT                   PRRDSSRLLPVYVFIQGGGFSSNGNPYYNGSGLIQASDMNIVVVNFNYRVGPYGFLAGS
FT                   EILEGGSLNNGLRDQIQVLKWVQKHISKFGGNPDHVVIGGDSAGGASVTLLLSAYEGRD
FT                   DGLFHAAAAESQSFATMLTVDESQFAYDNLVNRTGCSDTGDTLNCLRSLDVEDLQRENI
FT                   VTPFPGAQQPPLYMYGPTIDGDLIPDYTYRLFQQGKFIHVPVIFGDVTNEGTKFVPEDL
FT                   VSDTATYVWLQSQWPALTPKHFSRIHEYYLQDVNSTRPFPNATRYWRPVSDAYGEIRYV
FT                   CPGIALNAAYAKAGIPNWNYHYAVQDPEDEASGLGVYHVVELNAIWGPDNIWWSDTISQ
FT                   PPPESYFTFNAPIVPVMQGYWTSFIRSFDPNKHRYRGSPRWETWGKQERLFVRTGETRM
FT                   ERVPADQRERCEYFISIGIDLRQ"
FT   gene            complement(715168..717961)
FT                   /locus_tag="ANIA_01434"
FT                   /old_locus_tag="AN1434.4"
FT                   /product="rRNA maturation protein (Nop14), putative
FT                   (AFU_orthologue; AFUA_8G04220)"
FT   mRNA            complement(join(715168..717621,717674..717961))
FT                   /locus_tag="ANIA_01434"
FT                   /old_locus_tag="AN1434.4"
FT                   /note="transcript_id=CADANIAT00008046"
FT   CDS_pept        complement(join(715168..717621,717674..717961))
FT                   /locus_tag="ANIA_01434"
FT                   /old_locus_tag="AN1434.4"
FT                   /product="rRNA maturation protein (Nop14), putative
FT                   (AFU_orthologue; AFUA_8G04220)"
FT                   /note="transcript_id=CADANIAT00008046"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008046"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008046"
FT                   /db_xref="GOA:Q5BDE6"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE6"
FT                   /protein_id="CBF84849.1"
FT                   /translation="MPPSQLKQLKASLRDTGLLGPQKSKKQKRQNAKTGANAQNRAQRE
FT                   SALNAIRERFNPFEIRTVSRGKFDVTTRDGGAKSASGNFRPGVTKSLGEERRRQTLLQE
FT                   MDRRNKVGGIMDRRFGENDPTMTPEERAAERFARASQKKLRKDSMFNLEEDDEEEFTLT
FT                   HKGESLSFGDEDGIRDDFQEDLDAGDMSDTEMPRKRKRFIDDPEAEEDGSQDGEDVPER
FT                   KKSKHEVMQEVIAKSKFYKAQRQMAKEDDDELREELDKGLPELFDMLRGVKPPPKQEPP
FT                   KDDLAGMNPDRAAIMQGHSQGDPEKEYDQRLKQLTFDKRSMPTDRTKTEEEKAEEEAQR
FT                   LKKLEEERIRRMRGEDVSEDEAEAAEEEEDGEESEEESLPDDAKDFGLQQPTNYSTSRP
FT                   EGVDDEDDFILDDLVETRSDVSLSFVEDDEDIIGSEEESEDEEEEDELINGITMPGEES
FT                   GNEAPAPDTQIAGDGLAYTYPCPNSHEEFLKTIKDISYEDLPTVIQRIRALHHPRLHSD
FT                   NKVKLGRFAGILVQHAAYMVEQPQRPPFAVVENVLRHIHSLAKSHPESVSLAFRAQLRE
FT                   VAADRPLSLRPGDLVILTGIATIFPTSDHFHAVSTPAHLCLARYLGQGPVNSLSDLCTG
FT                   TYAASLALQYQTISKRYMPEFLNYVLNALCILSPGEPSSKLGSFPLRQPTELLRIRPSK
FT                   PLNIRKLQFLDVSARSEIDPEDLKLSLITTLSSLLNTASDLWSSKSASVEIFNQAQAVL
FT                   QHVSSSCVDVNKKAKKAKNPLIPAAALDTLQSTLDKLSTVLSQSRLTRRPLLLHNHRPL
FT                   AVKTAIPKFEDSFNPDKHYDPNRERAEVNRLKAEYKRERKGAMRELRKDANFIAREKLR
FT                   EKKEKDAEYERKYKRLVAEVQNEEGREANAYEREKRMRQGKR"
FT   gene            complement(718225..718774)
FT                   /locus_tag="ANIA_11302"
FT                   /old_locus_tag="AN11302.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(718225..718351,718548..718574,
FT                   718640..718659,718733..718774))
FT                   /locus_tag="ANIA_11302"
FT                   /old_locus_tag="AN11302.4"
FT                   /note="transcript_id=CADANIAT00008047"
FT   CDS_pept        complement(join(718225..718351,718548..718574,
FT                   718640..718659,718733..718774))
FT                   /locus_tag="ANIA_11302"
FT                   /old_locus_tag="AN11302.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008047"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008047"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008047"
FT                   /db_xref="GOA:C8VM49"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM49"
FT                   /protein_id="CBF84851.1"
FT                   /translation="MLLEEVAKAVDKRSIYDVLCGVPAGYVFKYEKKYTIFCALINYLV
FT                   IVAVVLDLSQPVHLLEVGSNSAHGKE"
FT   gene            complement(719464..720604)
FT                   /locus_tag="ANIA_01435"
FT                   /old_locus_tag="AN1435.4"
FT                   /product="origin recognition complex subunit 3, putative
FT                   (AFU_orthologue; AFUA_8G04240)"
FT   mRNA            complement(join(719464..720442,720492..720604))
FT                   /locus_tag="ANIA_01435"
FT                   /old_locus_tag="AN1435.4"
FT                   /note="transcript_id=CADANIAT00008048"
FT   CDS_pept        complement(join(719464..720442,720492..720604))
FT                   /locus_tag="ANIA_01435"
FT                   /old_locus_tag="AN1435.4"
FT                   /product="origin recognition complex subunit 3, putative
FT                   (AFU_orthologue; AFUA_8G04240)"
FT                   /note="transcript_id=CADANIAT00008048"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008048"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008048"
FT                   /db_xref="GOA:Q5BDE5"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE5"
FT                   /protein_id="CBF84853.1"
FT                   /translation="MSHFFANPISVLLADRVGEDLQNDKLCEAIRNVPSFREYCEILLE
FT                   DSKTQQVRDLLEDDKLLLLETTRLIRAGQRSMHYMFQAVKFISILLKELNISKKVSISE
FT                   LSIRALCGELQKSPLLEDVLAAFRRLDSSRVAGLLSQFPEALRSLPDLRGVEADFRSLT
FT                   KAHEGPEPLRSEYDSQNSVIGTTIVKQRVKLDTGKAKLPEETIKYTRIINRCCTLLRSY
FT                   FVNILVFPQELPLHEAFLLDMRNPIKEVFAPRARYAIERALSNPFDYLLFTSQDTERKI
FT                   SAKQPPTAILYQLYLESGALVNMYDLWTAFYAVFESEQGDSCDERMTMALFYRALSELR
FT                   ALGMLKHSRKKLDHVAKSAWKGL"
FT   gene            722166..724751
FT                   /locus_tag="ANIA_01436"
FT                   /old_locus_tag="AN1436.4"
FT                   /product="pentatricopeptide repeat protein (AFU_orthologue;
FT                   AFUA_8G04250)"
FT   mRNA            722166..724751
FT                   /locus_tag="ANIA_01436"
FT                   /old_locus_tag="AN1436.4"
FT                   /note="transcript_id=CADANIAT00008049"
FT   CDS_pept        722166..724751
FT                   /locus_tag="ANIA_01436"
FT                   /old_locus_tag="AN1436.4"
FT                   /product="pentatricopeptide repeat protein (AFU_orthologue;
FT                   AFUA_8G04250)"
FT                   /note="transcript_id=CADANIAT00008049"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008049"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008049"
FT                   /db_xref="GOA:Q5BDE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE4"
FT                   /protein_id="CBF84855.1"
FT                   /translation="MLRPVIRGARWYQHVARSSSSAASPRSFTRAFTAAAPRLIDYGGP
FT                   NDKIKFYEQDTRRSTKRRRIDPEAEDIAEKEEVARELSQLDHELESLKEDPFGPNSSFI
FT                   QSLPEDERAIALEALRKQEARDGKDEPITFDDVFDEELDNLLKEEFEGLALEEENWMKK
FT                   KDDSLQEVIRQPYEMAFGDSEHSDYIDRFNRALKRFAADKSSEKARQDLWNWYRGCKQI
FT                   IPHFVSAIPEEAMTLLWSSQTSVGQHAARIQVLAEDALLAGRSLPTAHVLSYISSLQQL
FT                   GKTREALDQWEMHQDGLSQQKEDLEAYWKLGVQLFTAEGNPQRAQDIALAFMKNDNFQH
FT                   ARILIPIIIAWGRQSGKEADSKLWALYLQLKAMLRHKMTMDDYDQISIGLLKAGKLDLA
FT                   IAVFKDMMVTGKDSANDSTALYTAALGLAGNLQASAVSEQDVNKVSLSTLTVLPRRFEN
FT                   RFFYASWLKKLIGMGEVDSAALVVELMYERGVRPDPKHLNGLIAGWLREGSAPAREKAE
FT                   ELGWSMIKQRIDRVSKAEAKDSEQPETGRTNARIPKFMQRPMPAATIETFSILLLHYTR
FT                   RGDQEAVEHLVKNLTLSRIQPNSYFMNHLLYAELRKQDIGALWNKFQVLSSSVQPDLET
FT                   YACLWDCGKLQYDRSRTAYFAEFPTARALYSNMMTWFSYLSTRAQTTAREDFSKDLYDQ
FT                   IIRCFCLSKDLAGTLVALCSLHSTFGFHPDETTARLIILQVARLAAVPSDTPKRRLRRI
FT                   SSTPHSKANIAQVQQLVEILSDRKSATLESRGLTISSLDPHEKEMHQLEIMTDLLRIVM
FT                   SRADTSPNQTPDPNRVEEQLCTVAEEMGVPGIYLGPRLDDENAGLVSMR"
FT   gene            726129..729671
FT                   /locus_tag="ANIA_01437"
FT                   /old_locus_tag="AN1437.4"
FT                   /product="C2H2 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G04300)"
FT   mRNA            726129..729671
FT                   /locus_tag="ANIA_01437"
FT                   /old_locus_tag="AN1437.4"
FT                   /note="transcript_id=CADANIAT00008050"
FT   CDS_pept        726129..729671
FT                   /locus_tag="ANIA_01437"
FT                   /old_locus_tag="AN1437.4"
FT                   /product="C2H2 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G04300)"
FT                   /note="transcript_id=CADANIAT00008050"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008050"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008050"
FT                   /db_xref="GOA:Q5BDE3"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE3"
FT                   /protein_id="CBF84857.1"
FT                   /translation="MSAVSPQFVQSDSNDRNLDPELSNPFLTENDPEEAEFQKFTIRLT
FT                   PVDDRGSAWTGSTSSQDHSINNTSTTGNHEGYGTTYSEFLSPVDEWASDISGHTSPADL
FT                   MIPGVWPVIATSPQNVTASSPTQSGPSPSSPPASINPSQLLTPVLTNHPSPASDTRSVG
FT                   SPRIPRAQQPPVPRLKTTLLDDNLGPGPVSESVTTISPIVKVESYSRGDSPVRDSFSTN
FT                   RRPSQSSIHLSPGGASNASGEDATIEDDRHSVSRSADGAWVPNVLTGQAGLAPDAREDV
FT                   YVPSPNELDSQRKLAERNADIYTWSEAVSEAHSEAGDDYLCFQRGRTDYHGTRRRAKST
FT                   GDPSLDYFSLKFTPDRSEIRGPGLVLHETSDYSDDETESSAPVSVKEERLVQEAFEMTP
FT                   PEPQSAETGEPQAHQFLGSPPWRDIELDRSPQTTRMQPVSSTQAMVEYQRRARETDAIS
FT                   RVATWGTRDLDANSIRSFQMMSLNENGKEKKHERRNSFLKYLPQKKGNLLKRQRQKTDL
FT                   STMQPVHEGEAQDTESKAAPQRKDSFPHRLSLPFTPKTTNYSISGAVMATTRQMAAIGG
FT                   KDSLSVVSPSTTTTTTTKPWNTLKVRGRSRSEVPRAPGLFELMTTHGGPPVPNISYTSE
FT                   PVENKEAKHARPQHDAAEEDDDDDSEEKLIMEFPIPKELPIPTLEGFKTQILRLNPRIE
FT                   PALIDRFAHEQVRRYKRLIEIKQTHARDVNHRKCKAGKFCFALGGTAKLLPPRLSAQDG
FT                   DSHTQFQIPRPGEEEESSEDLGETTMLAHFPQGVPHPPPQVKLLPAEFECMVCYHVKKF
FT                   QKPSDWTKHIYEDVQPFTCTFPDCTDPKSFKRKADWVRHESERHRQLEWWECSLADCRH
FT                   KCYRKDNFVQHLVREHKMPEPKVKKPRNRELSDGASNDPTSLEVQEEINREREINGLWK
FT                   LVESCHFETARNPREEPCRFCGNVCTNWKKLTVHLAKHMEQLAIPILGLVKERDFPYTV
FT                   NIGSSGNPDNFSGQVPIAQKDSDFDPRLDTGVTEGPGTADNFTQAPYSNSHPGSSEPIM
FT                   LPFNTGASYLPNASMPLDSTAPNPAARFEGVTPYTAHGGGVAGLAGDQTRLMAMHQHQN
FT                   SVTYPPFNARPRLTVPNQDMRVLPEYNSFSMSPTEMQYDPQTTAYVSSGAENHYPYQGP
FT                   IASAMPYDSGYQGQ"
FT   gene            731106..732874
FT                   /locus_tag="ANIA_01438"
FT                   /old_locus_tag="AN1438.4"
FT                   /product="C2H2 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G04290)"
FT   mRNA            join(731106..731781,731892..732101,732157..732874)
FT                   /locus_tag="ANIA_01438"
FT                   /old_locus_tag="AN1438.4"
FT                   /note="transcript_id=CADANIAT00008051"
FT   CDS_pept        join(731420..731781,731892..732101,732157..732763)
FT                   /locus_tag="ANIA_01438"
FT                   /old_locus_tag="AN1438.4"
FT                   /product="C2H2 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G04290)"
FT                   /note="transcript_id=CADANIAT00008051"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008051"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008051"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM53"
FT                   /protein_id="CBF84858.1"
FT                   /translation="MVQELGEFDRRCSASHYSEPSETGSQYNGLHSSDSGYSTRSCTTR
FT                   SIATSYAVGSACSPRLTPQEYEHGEKTAPVGAELAHHYEPMDIVGPPESPSIFGHEVIK
FT                   CDYPKCPWTGKCPSDKRRKEGFGTINDLARHKKCVHKKEPERGPKVLYMCFGRNCPRSS
FT                   KKWPRLDNFRQHLARMHNNEDADELLRRSREWYENLKSKDTVSIHTDNMPEQATLSQVR
FT                   PESGIMVQSASNDLQDPLAAIHTAFQAANSSMLSLDPVREHSMLDIDHTRAIELAELKL
FT                   GPALEQNPSQPANPRHDKMDNMISEAAVSVINAMTKMINNHQRRRGHLGEDDITEQDGE
FT                   LSDRNRDILQKILVTASELLSGSPGPGNSNPLEKTSNRSDRASWSQCEFCPE"
FT   gene            complement(733658..734371)
FT                   /locus_tag="ANIA_01439"
FT                   /old_locus_tag="AN1439.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(733658..733698,733844..733953,
FT                   734007..734133,734197..734371))
FT                   /locus_tag="ANIA_01439"
FT                   /old_locus_tag="AN1439.4"
FT                   /note="transcript_id=CADANIAT00008052"
FT   CDS_pept        complement(join(733895..733953,734007..734133,
FT                   734197..734334))
FT                   /locus_tag="ANIA_01439"
FT                   /old_locus_tag="AN1439.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008052"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008052"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008052"
FT                   /db_xref="GOA:Q5BDE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDE1"
FT                   /protein_id="CBF84860.1"
FT                   /translation="MPPRLNFNCSRALFRRNLTTTRTRLNTGMPPHPPTQQPETSAYKE
FT                   GMSRYKVFASPFAKVFLGAVFTYQVIYWTWVKLEMEEVKVEKNQQLAALETEARELTGT
FT                   GKK"
FT   gene            735711..740796
FT                   /locus_tag="ANIA_10191"
FT                   /old_locus_tag="AN10191.4"
FT                   /product="AAA family ATPase, putative (AFU_orthologue;
FT                   AFUA_8G04270)"
FT   mRNA            join(735711..737742,737792..740796)
FT                   /locus_tag="ANIA_10191"
FT                   /old_locus_tag="AN10191.4"
FT                   /note="transcript_id=CADANIAT00008053"
FT   CDS_pept        join(735711..737742,737792..740655)
FT                   /locus_tag="ANIA_10191"
FT                   /old_locus_tag="AN10191.4"
FT                   /product="AAA family ATPase, putative (AFU_orthologue;
FT                   AFUA_8G04270)"
FT                   /note="transcript_id=CADANIAT00008053"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008053"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008053"
FT                   /db_xref="GOA:C8VM55"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM55"
FT                   /protein_id="CBF84862.1"
FT                   /translation="MARIKRSLEEIANKSDSDDDDYSDHPVRNSRRSASKSKSRKKNRP
FT                   TKKRARRDSDDDIVSDEDEISEFDDEFDFEGSPEEEDVDAPRTARGTVARRAATNRPVY
FT                   NEGSDSIEDEEEEDEEDVVPSPKKVVKLKVNALKRQAFSDNPTGTRRTTRRNRDPSEDI
FT                   YALTNSGRHVQTVQKGTHSPEAERGRRSSRGSKRAPEVEGEADEADAKMEDPEVIEETL
FT                   TEIKTSQLEIQESAPNSFRDDDGQDAPAEDEGFVPESENGEGNTKVDEDDDDDDDDDEG
FT                   PTTRRRNRPNRNQNTQEATQQDEEENGLRRSSRKRPKSSQRKDDEESDFEPEEDDTHDE
FT                   DELSQSGKSQGSPRKTSQAHDDDYESSTGRRPGLRKRASRSRGESEAVDIAEELAEELQ
FT                   DLRGGRPRRRAQQEIVYEKPRRSRKNVDYRIIRPDLVLPIEEAENEVNESPSRRGRGGG
FT                   GSTWQRSLFPTYGPFGGGGPSAILGPPGAHAATGGVDSDSSDDEGMQHPKGSISGPAGG
FT                   NLPLPGVFGAQTHSTDAVQGHSGTPANLGRVKDKQALADADPLGVDMIVNFDNVGGLQG
FT                   HIDQLKEMVSLPLLYPEIFQRFHIVPPRGVLFHGPPGTGKTLLARALANSVSSEGRKVT
FT                   FYMRKGADALSKWVGEAERQLRLLFEEARKTQPSIIFFDEIDGLAPVRSSKQEQIHASI
FT                   VSTLLALMDGMDGRGQVIVIGATNRPDSIDPALRRPGRFDREFYFPLPNTEGRRAILDI
FT                   HTKGWDPPLPNSIKDELAEITKGYGGADLRALCTEAALNAVQRRYPQIYKSDKKLLIDP
FT                   RTIEVAPKDFMLAIKNITPSSERSTGSGASKLPKTVEPLLRQPLAELKSILLEILPQRK
FT                   RLTALEEAQYEDSVESSMGFQREQMQQEFERSRVFRPRLLLRGALGMGQQYLAGALLHH
FT                   FEGLHVQAFDLPTLLSDSTRTPEAAVIQLFAEVKRHKPSVIYIPGLQNWSQTVGQAVIS
FT                   TFMGLLRSIPPTDPVLLLGVLESSEDIDATLVRNLFGYSKKNIFELSPPGQEARYEYFA
FT                   KVIDLIKASPSHLPDPDNRKKRQLEELEVAPPPPPPEKPPLSKEELKAQKKKDYQTLNL
FT                   LKIRIQPIMDQIKKYKRFRTGVIDESQIRYLWEEEDPNIVTSDLPIEQRTTFRPFEKAQ
FT                   DKHGVPGLRETVSGKFFYNLEIVTIEKRLSNGYYKRPKDFLADIKRIAKDARQLNDQER
FT                   LLRANELLSNVEVDIATIEQTEPALVAECENVYLRELEREKIAIEKAKKAQEEEDAIAY
FT                   GAANRVPRGNTDSDPTSGPVVLGASFPDLGPQIPGRPVTPTRRSTVSFMTNGYHRGDGS
FT                   DLNDSNATNGSHETHPDGDGDTYMTNSDQSAGRDTQVSSFGPSAQPKPAYSMTAPSQQV
FT                   RRESGLSSFSQRGPMTPMAPGSQPADYINEASTTQTTSDKKSSEQSSHPHHYTQSPVVI
FT                   HGTRQDYPDLTLYPDRVSQEEHLPDTQQGDSSQPSPPQLRESQVVRAEVQSQPKSQPPV
FT                   PLFDAASRQPTALQALLNEEDESPKLIIDHEYVRNLHKEMAQRTSGCSVEQLEQINSAL
FT                   MDVLWHTRCDWNRSKVAAGIQHAFNDVLEDMQAVQEIGPISQKTQDQLHSMY"
FT   gene            740982..741889
FT                   /locus_tag="ANIA_10204"
FT                   /old_locus_tag="AN10204.4"
FT                   /product="nucleoside-diphosphate-sugar epimerase family
FT                   protein (AFU_orthologue; AFUA_6G11740)"
FT   mRNA            join(740982..741245,741398..741889)
FT                   /locus_tag="ANIA_10204"
FT                   /old_locus_tag="AN10204.4"
FT                   /note="transcript_id=CADANIAT00008054"
FT   CDS_pept        join(740982..741245,741398..741889)
FT                   /locus_tag="ANIA_10204"
FT                   /old_locus_tag="AN10204.4"
FT                   /product="nucleoside-diphosphate-sugar epimerase family
FT                   protein (AFU_orthologue; AFUA_6G11740)"
FT                   /note="transcript_id=CADANIAT00008054"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008054"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008054"
FT                   /db_xref="GOA:C8VM56"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM56"
FT                   /protein_id="CBF84864.1"
FT                   /translation="MFYTIPEYSRRSWLFMTAVTNQLIPLPRNASFEILAATRNSQSPS
FT                   AQSLSRLSSNIKLVEVNLDDPAAIFHNAHRAEQIPIWGVFSVQTSVDRGGEAKSPNNPT
FT                   RIPHFIHKHNIEHHLIQQAKVNDMQWLILRPTAFYENLVPRFFGIIFATCFKMALKGKP
FT                   LQLVATSGIGYFAAEGFLNPKKYAGRGLSLAGDELTYDQFVEIFEQKTEQTIPSTFRPL
FT                   CSLLLTLIKDMGYMFKWFMTKGTGRILLS"
FT   gene            742080..744258
FT                   /pseudo
FT                   /locus_tag="ANIA_01441"
FT                   /old_locus_tag="AN1441.4"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        742080..744258
FT                   /pseudo
FT                   /locus_tag="ANIA_01441"
FT                   /old_locus_tag="AN1441.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00010580"
FT   gene            745005..746378
FT                   /locus_tag="ANIA_01442"
FT                   /old_locus_tag="AN1442.4"
FT                   /product="translocation protein (Sec66), putative
FT                   (AFU_orthologue; AFUA_8G04260)"
FT   mRNA            join(745005..745320,745386..745690,745763..746378)
FT                   /locus_tag="ANIA_01442"
FT                   /old_locus_tag="AN1442.4"
FT                   /note="transcript_id=CADANIAT00008055"
FT   CDS_pept        join(745221..745320,745386..745690,745763..746176)
FT                   /locus_tag="ANIA_01442"
FT                   /old_locus_tag="AN1442.4"
FT                   /product="translocation protein (Sec66), putative
FT                   (AFU_orthologue; AFUA_8G04260)"
FT                   /note="transcript_id=CADANIAT00008055"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008055"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008055"
FT                   /db_xref="GOA:Q5BDD8"
FT                   /db_xref="InterPro:IPR018624"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD8"
FT                   /protein_id="CBF84867.1"
FT                   /translation="MVDWVTLIVPFAYLSVLIGSLATFSSLYRKRKARKATSLEPWFPS
FT                   HLQRDIYFSLLHLDPPASATEKKVAVPESVLKAALLRRAQEDIRRVMTLRSQKQALSVL
FT                   LQRGSVGDDLWQRFLRAEKEMEDEVRDVVTEANAYAPNWGQVIFQSANEMVNNEIVRER
FT                   LDKHQKKLDEEKAWWEKKKASIQEGFMKELDAEKPGTVTTAAAATAAPEVAEGTQVAVG
FT                   SKASASAAAPPAPTVTESDDDAVLVEADDQAGSAGQKSPGGGKKKKKGKK"
FT   gene            complement(746827..750981)
FT                   /locus_tag="ANIA_01443"
FT                   /old_locus_tag="AN1443.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(746827..747790,748016..750981))
FT                   /locus_tag="ANIA_01443"
FT                   /old_locus_tag="AN1443.4"
FT                   /note="transcript_id=CADANIAT00008056"
FT   CDS_pept        complement(join(746827..747790,748016..750981))
FT                   /locus_tag="ANIA_01443"
FT                   /old_locus_tag="AN1443.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008056"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008056"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008056"
FT                   /db_xref="GOA:Q5BDD7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD7"
FT                   /protein_id="CBF84868.1"
FT                   /translation="MAKSGKKNKKGVKKGKSQEDAPAPQPEVPSTEPEQQQPAADTPQP
FT                   EVPSTGPEQQQLAADTPQPEEAPELPTASTTGEEPNPLAKSEVTTQVVPEIVPDLKPVL
FT                   ESAPEREPEPEQTQNIEQSQTPSDPDIPSQTPLEDNDFTEITKHDTSSNQPPGMIDTQI
FT                   EHIQEPSHDDLGVWEQLDTAEAEKNHDDTPIEQSNSVDQSEQSPITAPQSPTFTFAPET
FT                   STTEPTETWSAWEENDLTKASPAEEETATPKNDDHNSHVFTNPSGEIASTEPASESAQT
FT                   SDLAPAPASQPEVELPLESELAKEAEPIQKPEPVKEPEPAAEPETFFSEPVEPIEVPEP
FT                   VQKPETATSPEPVREPEPVQEPEVAITPEPVEEPEPVQVPEAVTAPESAIEPEPLATVE
FT                   PAMGAEHTMEPAQEVTPPASKPQSPAPATASPSYKSASPMQRAVSPAAISVADTVDAPH
FT                   AFPPPPAAPTPPPASPKTQDVPPLKDASYPTPRAAPPTPPSASPQYNSSYPTDQAYSPR
FT                   QKSSPSHNTRKPSSPIPKISSPLAHAYTSPVMSPHTTSVPPMPPSFPPSVSHSYATAYQ
FT                   SPAMSTAGYFPPQYGYYQPTSHPHHTPRGPMAPNGPYPGLRDPGYPNEHDRSGRGGPMV
FT                   PPDQEDARELLDRIQDAIPDINRLLGSYKHTKTKLQSREAEFKQMESQHKQALMHKDFF
FT                   IEALQNQLRKTANESAEEATKLKNMINELRMELGNMEEKRKDMEEKLADSEASISSLEE
FT                   KKTGLEEQIKKLNEQIEEERVAHSQELDRQRAEMEAEKEEALKTQKQELTELFEEIKAE
FT                   DEKAAAEALAAREAELLEQQEAMKIEYEQQKQQMQNSHDTLQAEFDTKLAELATTQGDL
FT                   EKKHQELEDTRHAHVEQVESLENQHQEKITEMERAWTEEKTGLETQLSEKSEELANSER
FT                   ENKRLEEDLLSKEKQLQLSVDNMRLTINNLDNDCDRLRKTLHSLGEATDLKNTKGDTFF
FT                   LDCFGQLQRLIVTLSKEHFSYLPIDPPQEVLSKLPPELPSFLDNTPASRELRSAYVQHV
FT                   VSKILTYRIFHPFLFTLGRRYDKADILFQMLSMDIRRKSVRREAFWRQQTLKAAYTTSD
FT                   AKESINVVAAVIVDEISNSLKHFADPRRMDGLLTSIRKIVKLAAETWRHARVERELIIA
FT                   ALPAPEDGSVPGEDWEEYGVPKENSSGRTSPKTADFARHVVLRPFPRIIREAAHEDFLG
FT                   DEGKASPCTYSRGSVLYSDSPIILARLQELAGKTTDAPVRREDSPPATGRLSRASTYYE
FT                   PPSPRIPYAQDTLIEGATGPNFGTA"
FT   gene            752352..753119
FT                   /locus_tag="ANIA_01444"
FT                   /old_locus_tag="AN1444.4"
FT                   /product="NADH-ubiquinone oxidoreductase 178 kDa subunit,
FT                   putative (AFU_orthologue; AFUA_8G04320)"
FT   mRNA            join(752352..752488,752566..752810,752869..753119)
FT                   /locus_tag="ANIA_01444"
FT                   /old_locus_tag="AN1444.4"
FT                   /note="transcript_id=CADANIAT00008057"
FT   CDS_pept        join(752372..752488,752566..752810,752869..753025)
FT                   /locus_tag="ANIA_01444"
FT                   /old_locus_tag="AN1444.4"
FT                   /product="NADH-ubiquinone oxidoreductase 178 kDa subunit,
FT                   putative (AFU_orthologue; AFUA_8G04320)"
FT                   /note="transcript_id=CADANIAT00008057"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008057"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008057"
FT                   /db_xref="GOA:Q5BDD6"
FT                   /db_xref="InterPro:IPR034444"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD6"
FT                   /protein_id="CBF84870.1"
FT                   /translation="MILARRSVASARLLLRNQQPRRFDSHAAHHAEPVNESFGRSFYVA
FT                   VGTFASCFALYQFTKPGKVADSQSALTRLIEKWTPSEKVFEERNALHTAAAERAARDRH
FT                   LFLSQAPSEVYELKSPESSFHPGHPYNVIAGSKADLSEVIAHYERKNQKIEEARVARMQ
FT                   DGKVVSIYD"
FT   gene            complement(753251..754625)
FT                   /locus_tag="ANIA_01445"
FT                   /old_locus_tag="AN1445.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(753251..753931,754022..754363,
FT                   754464..754625))
FT                   /locus_tag="ANIA_01445"
FT                   /old_locus_tag="AN1445.4"
FT                   /note="transcript_id=CADANIAT00008058"
FT   CDS_pept        complement(join(753251..753931,754022..754363,
FT                   754464..754625))
FT                   /locus_tag="ANIA_01445"
FT                   /old_locus_tag="AN1445.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008058"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008058"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008058"
FT                   /db_xref="GOA:Q5BDD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD5"
FT                   /protein_id="CBF84871.1"
FT                   /translation="MASKFSFGFSGDDIDIDLDENELDDATESGHQDAGTASTLPELVK
FT                   AQKHEIDEWLSMLPSQISYNTCTISPFQEKGLGQGASASTDIGANTVTVARRDVFDIRA
FT                   QLMVEDSAEEQNGELIAGLEKGDITPNFYEGGFKTWECSIDLAGLVVGEGVGLEDEGED
FT                   RHVIELGSGTAVPSLAVFAQLLARTETDGTTSKPAEKKKQTHFTFADYNSAVLRLVTVP
FT                   NLLLTWNHFTTHRKSAQPSDGQSEDKAESQEEMLDITPDLVERFQSDLAHRGITVSFIS
FT                   GAWSPSFVELVFSSPELAGYRTLILASETIYSPASLAAFSETLLMLLRRSSQSNHASRA
FT                   LVAAKKVYFGVGGGVDEFLTILRSVADGNVDVGERMDVKSAGVGRTILEVSAST"
FT   gene            complement(754937..756775)
FT                   /locus_tag="ANIA_01446"
FT                   /old_locus_tag="AN1446.4"
FT                   /product="Cystathionine gamma-lyase (EC 4.4.1.1)
FT                   [Source:UniProtKB/TrEMBL;Acc:B2LXT6]"
FT   mRNA            complement(join(754937..755723,755775..756222,
FT                   756275..756360,756418..756775))
FT                   /locus_tag="ANIA_01446"
FT                   /old_locus_tag="AN1446.4"
FT                   /note="transcript_id=CADANIAT00008059"
FT   CDS_pept        complement(join(755142..755723,755775..756222,
FT                   756275..756360,756418..756561))
FT                   /locus_tag="ANIA_01446"
FT                   /old_locus_tag="AN1446.4"
FT                   /product="Cystathionine gamma-lyase (EC 4.4.1.1)
FT                   [Source:UniProtKB/TrEMBL;Acc:B2LXT6]"
FT                   /note="transcript_id=CADANIAT00008059"
FT                   /db_xref="GOA:C8VM61"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM61"
FT                   /protein_id="CBF84873.1"
FT                   /translation="MTMMAGHPDLPSNGQNGDSNTHQQRQFATLAVHAGAPHDPTTGAV
FT                   IAPISLSTTFAQESVGKPVGLYEYTRSSNPNRDNFEEAVASLEHAKYALAFSSGSATTA
FT                   TILHSLAPGSHVVSVSDVYGGTHRYFTKVAAAHGVNVSFSSCLELDVEKLIRPNETKLV
FT                   WIETPSNPTLALVDIRKVAAVAHRHGVLVVVDNTFMSPYVQNPLDHGADVVIHSVTKYI
FT                   NGHSDVLMGVAAFNSDELKERFTFLQNAIGAVPSPFDCWLAHRGLKTLHLRAREATANA
FT                   TAVALALESSPHVISVNYPGLNSHPNREIAVKQHRKGMGGGMLSFRIKGGHKAAHLFCE
FT                   YTKIFTLAESLGGVESLCEVPSSMTHAGIPKEEREAAGVYDDLVRMSCGIEDVEDLTAD
FT                   TMQALERAVAASQALENGSA"
FT   gene            complement(757013..758423)
FT                   /locus_tag="ANIA_01447"
FT                   /old_locus_tag="AN1447.4"
FT                   /product="DNA-directed RNA polymerase III subunit 22.9 kDa,
FT                   putative (AFU_orthologue; AFUA_8G04350)"
FT   mRNA            complement(join(757013..757064,757194..757234,
FT                   757459..757633,757680..757743,757796..757882,
FT                   757947..758043,758117..758215,758271..758423))
FT                   /locus_tag="ANIA_01447"
FT                   /old_locus_tag="AN1447.4"
FT                   /note="transcript_id=CADANIAT00008060"
FT   CDS_pept        complement(join(757013..757064,757194..757234,
FT                   757459..757633,757680..757743,757796..757882,
FT                   757947..758043,758117..758215,758271..758282))
FT                   /locus_tag="ANIA_01447"
FT                   /old_locus_tag="AN1447.4"
FT                   /product="DNA-directed RNA polymerase III subunit 22.9 kDa,
FT                   putative (AFU_orthologue; AFUA_8G04350)"
FT                   /note="transcript_id=CADANIAT00008060"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008060"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008060"
FT                   /db_xref="GOA:Q5BDD3"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD3"
FT                   /protein_id="CBF84875.1"
FT                   /translation="MFILTTISDLIQISPEDFSKYSSVAIEDNINEKYANKVIQKIGLC
FT                   IGFYDLLESSDGLIGHGTGLVNVNVKFRLIVFRPFRGEIVLGKISSATENGIKIGVEFF
FT                   NDILVPPDLLLDGARFDYQDQVWIWENEEGTFYFDVGEVVRFRVEMEEWHDQIPNAPDL
FT                   GDGAPIDRKPPYSIIRGRTLSSPSGSYIRAILMYGLGYRRNEIGQ"
FT   gene            758636..760749
FT                   /locus_tag="ANIA_01448"
FT                   /old_locus_tag="AN1448.4"
FT                   /product="CCCH zinc finger protein (AFU_orthologue;
FT                   AFUA_8G04360)"
FT   mRNA            join(758636..760439,760507..760749)
FT                   /locus_tag="ANIA_01448"
FT                   /old_locus_tag="AN1448.4"
FT                   /note="transcript_id=CADANIAT00008061"
FT   CDS_pept        join(758721..760439,760507..760749)
FT                   /locus_tag="ANIA_01448"
FT                   /old_locus_tag="AN1448.4"
FT                   /product="CCCH zinc finger protein (AFU_orthologue;
FT                   AFUA_8G04360)"
FT                   /note="transcript_id=CADANIAT00008061"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008061"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008061"
FT                   /db_xref="GOA:Q5BDD2"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR019496"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR039136"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD2"
FT                   /protein_id="CBF84877.1"
FT                   /translation="MNPQGFSFPPPPPPPPTQHPPQQQYAHNNAFTPYGQNHHGQRGGR
FT                   GGGQFRGRGRGYGNRGRGGHFMSSDANHSGGYAAAHAGYAPMTHSGYPAQHMPNQQTGI
FT                   PTPHYTQSSSQAFSNAVTGSTFASTSHYPQPAVNGTAYQHQSSYGTTYATPTQQSPPYT
FT                   QTHPAHQNATPSVQPTMMGPPIRWGFEGTGHSGSFPGLQRPSQRGPRQNNTYNNQSSPG
FT                   KHANKRDHTSAFGKPQSTAPRFPAPPPVPSFGNPLPLKPPTPVDSQRKPKKKKRKHNQL
FT                   GLTPKTEEHESSEEEDDADEETRLASGGPGTGVALQITYKGRTSNLQTSADIAAWIAER
FT                   KKRFPTQAKIEEKKKAMEEAKKAKKAREEAQRQQREARKSAATRAKDQEKKEQTRVALD
FT                   PADAAAKAKMKAEKLRRKLLKEEKRIAQAEADAERARKMDGVQEDSVPTEREADQPEKK
FT                   DSAANEQAVGDLASDASDDSDWTSSSGSDLSSSDSDESSDDDDDDSAPEQATSRREGPE
FT                   RVAPPARDEKKRICRHFARNGRCPRGKTCKFAHEKPDRGTKAQPVENKGRKGLLEALLD
FT                   RQKEDENRKLMETIIWLGENGLLDEPAAQQDVFSTDPTRQTDESTGPLDASDIQLGNVS
FT                   TSGSVGEQCHPSEGTARV"
FT   gene            762364..763783
FT                   /locus_tag="ANIA_01449"
FT                   /old_locus_tag="AN1449.4"
FT                   /product="GPI anchored protein, putative (AFU_orthologue;
FT                   AFUA_8G04370)"
FT   mRNA            join(762364..762867,762926..763783)
FT                   /locus_tag="ANIA_01449"
FT                   /old_locus_tag="AN1449.4"
FT                   /note="transcript_id=CADANIAT00008062"
FT   CDS_pept        join(762660..762867,762926..763416)
FT                   /locus_tag="ANIA_01449"
FT                   /old_locus_tag="AN1449.4"
FT                   /product="GPI anchored protein, putative (AFU_orthologue;
FT                   AFUA_8G04370)"
FT                   /note="transcript_id=CADANIAT00008062"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008062"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008062"
FT                   /db_xref="GOA:Q5BDD1"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD1"
FT                   /protein_id="CBF84879.1"
FT                   /translation="MRSVFFFALSAVATLVAARENAFNIPKNGYSFTAGEATTLSWEPS
FT                   TEGTVTLKLQHGEVLTSDSGTTIASSIPNSGSFTWSVPSDIEDYSDYTIEIISDSDPDA
FT                   TNYLPRFSVEGAEEVTTTSSTTSTETTTTTTTTETSSTTTETTLTTTTTTTTESTTSPT
FT                   PTSTTETPSKTPASATSTESSSTSTSSESATDTPTSVPNVNGEDGDNAGMSNRVSGGLL
FT                   VLALGVAALV"
FT   gene            complement(764610..765835)
FT                   /locus_tag="ANIA_01450"
FT                   /old_locus_tag="AN1450.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(764610..765612,765698..765835))
FT                   /locus_tag="ANIA_01450"
FT                   /old_locus_tag="AN1450.4"
FT                   /note="transcript_id=CADANIAT00008063"
FT   CDS_pept        complement(join(764818..765612,765698..765835))
FT                   /locus_tag="ANIA_01450"
FT                   /old_locus_tag="AN1450.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008063"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008063"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008063"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDD0"
FT                   /protein_id="CBF84880.1"
FT                   /translation="MAKLDQDKTCHLHHAADVTRALIEGLVKMDQVHACRGQVTAANLD
FT                   QTRSWTVRIQDTDSLNEMEVMTPRLILCTGSSPTKTPIPVDAHGIQRLDLDVVLKPSEL
FT                   ASALPQNQPTTVAVVGASHSAVLALLNLYDLARTSHSHLRIKWFTRHPLRYAEYMDGWI
FT                   LRDNTGLKGRAADFARQQLEDSVLPTSEAGRYITKIDCAGGQSKETAQYQRHLPSCTHI
FT                   TQAIGYTRDPLPELSINRSPLSPDDLQWDSSFGGFTDRHGRVIPGLHGAGIAFPERVVD
FT                   PYGNVEHAVGFFKFMKFLKRVTPQWAATA"
FT   gene            complement(767215..768430)
FT                   /locus_tag="ANIA_01451"
FT                   /old_locus_tag="AN1451.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(767215..767809,767884..768430))
FT                   /locus_tag="ANIA_01451"
FT                   /old_locus_tag="AN1451.4"
FT                   /note="transcript_id=CADANIAT00008064"
FT   CDS_pept        complement(join(767258..767809,767884..768204))
FT                   /locus_tag="ANIA_01451"
FT                   /old_locus_tag="AN1451.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008064"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008064"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008064"
FT                   /db_xref="GOA:Q5BDC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDC9"
FT                   /protein_id="CBF84882.1"
FT                   /translation="MFVRLPFRGRHPMRPAPSRSNEPPEGETEYQQLENQFYPSISDAL
FT                   RVRHLLLWKVQPEGLPAEVVDMIVDAAEYWPSTKVKLDKARRIEKDVDQAVLCTSPLCY
FT                   DEKSLDTPQPKLLPHRTVHPCRKIVFSILSHDQGGYTERHLAGPNNQSPYEHTCTWFDA
FT                   EVIHQAHKPSQKSAINGKMNPTDMRPQHFGPNDPLLLPRNNALQRNRTRIYEAKRHNII
FT                   WHYLDDVAADSQEAEDIARETGRGRDTVGGKQVREMEIGDSIMIWARARFPGWRNYVDD
FT                   VSVQVFWAV"
FT   gene            complement(768719..770441)
FT                   /locus_tag="ANIA_01452"
FT                   /old_locus_tag="AN1452.4"
FT                   /product="Nucleolar protein 12
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDC8]"
FT   mRNA            complement(join(768719..770161,770234..770441))
FT                   /locus_tag="ANIA_01452"
FT                   /old_locus_tag="AN1452.4"
FT                   /note="transcript_id=CADANIAT00008065"
FT   CDS_pept        complement(join(768719..770161,770234..770353))
FT                   /locus_tag="ANIA_01452"
FT                   /old_locus_tag="AN1452.4"
FT                   /product="Nucleolar protein 12
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDC8]"
FT                   /note="transcript_id=CADANIAT00008065"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008065"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008065"
FT                   /db_xref="GOA:Q5BDC8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034777"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BDC8"
FT                   /protein_id="CBF84884.1"
FT                   /translation="MGKKSKSQKEAPATESAGSLPFLGGNVSVDPSLASLFEQSAGPVK
FT                   VPEVPRLGAAPKTKITDVEKDEEESSSAGNDSASEDQFMEDAPESPDAAEEAVQAVPEP
FT                   PSRKRKRAAGEDLEESYMRRLAKEEQKEQKKRRAERSSSLEEESEDGEKESPQSEDGES
FT                   EDEGADIPKHEALAGAANDDDELSKSNRTVFLGNVSTKAITSKSAKKELMKHLSSFLST
FT                   LPESTGPHKIDSIRFRSTAFASGGKIPKRAAFAKQEIHDDTTPSTNAYAVYSTAQAAKK
FT                   APAALNGTVVLDRHLRVDNVAHPAKVDHKRCVFVGNLDFIDNETGTEEGEKKKKNRPPA
FT                   DVEEGLWRTFNAHTKASQSGPAGRGNVESVRVVRDRSTRVGKGFAYVQFYDQNCVEEAL
FT                   LLNDKRFPPLLPRKLRVVRAKKVAKKSVETTGAPKGSDRTLQGRAGKLLGRSSEARLKA
FT                   AAKKSISQSSLVFEGNRATADGSSRIRVRTKSRGSKAKKDSRSKKRAAAYKAAGGKKAK
FT                   IGK"
FT   gene            771679..773929
FT                   /locus_tag="ANIA_01453"
FT                   /old_locus_tag="AN1453.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(771679..772237,772269..772559,772615..772681,
FT                   772743..773229,773300..773929)
FT                   /locus_tag="ANIA_01453"
FT                   /old_locus_tag="AN1453.4"
FT                   /note="transcript_id=CADANIAT00008066"
FT   CDS_pept        join(771679..772237,772269..772559,772615..772681,
FT                   772743..773229,773300..773929)
FT                   /locus_tag="ANIA_01453"
FT                   /old_locus_tag="AN1453.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008066"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008066"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008066"
FT                   /db_xref="GOA:Q5BDC7"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="InterPro:IPR033487"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDC7"
FT                   /protein_id="CBF84886.1"
FT                   /translation="MEVAETREPTTVGAPNGTDETVVNGDQNLFYQDSLLDDGRSSSLS
FT                   EIDDVLENMPSDYESPKPEKIATENDSEAETERIDDSPNNYRTRTNIVLSATSYGPSPS
FT                   KLVHSTTYDDVEEDDVHPADESPSKPRSKNDRTVDSVEEVQEPDDSNLSDSAGKKRKRP
FT                   ESGDELISELDEDDFPPHKRRGSNLALTPEPVEEEVPKVNQEDTLADDIPESDLPSAPT
FT                   KSKRTRKGKRKGRKTRDVDDDAESGAVEMGAEVDDTPADEDAADRPDDADDGEAAAKLE
FT                   EESKRTSAMDSLAVLEREFATLRDKIYDERISKLNRELDMLKGPNPTHPELLRQLDCIK
FT                   GYRDAKIKYEHTLFQYRLKSLLNKSQAERAQAHSTYFQRARDIREHHSSAISKQFYSIQ
FT                   HDRFKTDDVSPQHYIPFPTRRSQQIAHQTAYNQEVSVLAGVAKYVGFPAAPSLSSARPA
FT                   ELDEDLEKMGISFETKAPASHHQSTIPRATIPSMSSNVHPTSAEEAFLEQTPWANPQHP
FT                   YHQHQNLSHRPQNRIMDNSRMSAFATPAGQMRVVDVNAPNGSASTIAENSSANNTPYGL
FT                   EQDNSTAATKPYLDYDARLRSLSSSPTDVRKPHPAMYTSLDHRPPQGIPRNPGYSSPPS
FT                   RLVFGSAPKQDTSPSISSKPVNSLHQPAAMLGSTSQNQMAAR"
FT   gene            complement(775464..777748)
FT                   /gene="nudI"
FT                   /locus_tag="ANIA_01454"
FT                   /old_locus_tag="AN1454.4"
FT                   /product="Cytoplasmic dynein intermediate chain
FT                   [Source:UniProtKB/TrEMBL;Acc:Q8X179]"
FT   mRNA            complement(join(775464..776694,776751..777548,
FT                   777608..777748))
FT                   /gene="nudI"
FT                   /locus_tag="ANIA_01454"
FT                   /old_locus_tag="AN1454.4"
FT                   /note="transcript_id=CADANIAT00008067"
FT   CDS_pept        complement(join(775561..776694,776751..777548,
FT                   777608..777745))
FT                   /gene="nudI"
FT                   /locus_tag="ANIA_01454"
FT                   /old_locus_tag="AN1454.4"
FT                   /product="Cytoplasmic dynein intermediate chain
FT                   [Source:UniProtKB/TrEMBL;Acc:Q8X179]"
FT                   /note="transcript_id=CADANIAT00008067"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008067"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008067"
FT                   /db_xref="GOA:Q5BDC6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDC6"
FT                   /protein_id="CBF84888.1"
FT                   /translation="MSSAANQQRKAEILAKKAKLAELKRQRELRQKEFSQSRASTGDAS
FT                   EVVSPVPSRSDSRAELDDLISRLVDRPGSAAVSGADGLSRKGSRPNSVLSASQLSGDNT
FT                   EALSPPTRPLSQSIAVQTVGTEPFVAIPELQPAPEAKPEVVTYNKGVQTDDLRQGEQDA
FT                   ASVDSDAGETPDFKSSSKKQRERDEEIRKKLREEIEEELRATQESAKNESGADASIRYP
FT                   LRQLDDDELKAVTSSEDFLDFVERSAKVIERALDEEYDVLADYELGGMDAELEDDDEHG
FT                   KKKRGIKEVCQFWDERWSKKRMISDICFSPKFPELVLASYTKNPSAPHEPDGLVQIWNQ
FT                   HLHSRPEYVFHSTSDILTAKFSPFHPNIIVGGSYSGQVLLWDTRSSRAGGGAPVQKTPL
FT                   TGAGHTHPVYSISIVGTQNAHNIITASTDGVVCGWTVDMLSQPQEYLELSTPPPSKTED
FT                   LAPTTISFPQSDPTFFIVGTEEGGIYPCHRYDRAGAKAGTDHRLAYRGHAAPIMSTAFH
FT                   PARGPVDLGDLMLSSSLDWSVKLWRIRPPAATAPAATSGITDTQVVTPILDINREDVVY
FT                   DARWSPHRPGVFSLVDGAGNLEVWDLYTDTEVPAVRTTPSKGRAGVLSRSLNKVAWEER
FT                   EGRRLATGGLDGVVTVFEVGRGLSGTPDDVPSEEWTGMKRLVGKLEQKDKDRMS"
FT   gene            777909..778640
FT                   /locus_tag="ANIA_11303"
FT                   /old_locus_tag="AN11303.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(777909..778051,778124..778307,778399..778640)
FT                   /locus_tag="ANIA_11303"
FT                   /old_locus_tag="AN11303.4"
FT                   /note="transcript_id=CADANIAT00008068"
FT   CDS_pept        join(778028..778051,778124..778307,778399..778469)
FT                   /locus_tag="ANIA_11303"
FT                   /old_locus_tag="AN11303.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008068"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008068"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008068"
FT                   /db_xref="GOA:C8VMC2"
FT                   /db_xref="InterPro:IPR008386"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMC2"
FT                   /protein_id="CBF84890.1"
FT                   /translation="MAASQGVNVLRYSALVAGLVYGFYHQSSITAANRRAEAEREYARQ
FT                   ERLIEQAKAEWKKKTQPQDSKSTGVITDPEDPKFDLEAFLKLKAGEA"
FT   gene            complement(778940..779695)
FT                   /locus_tag="ANIA_10208"
FT                   /old_locus_tag="AN10208.4"
FT                   /product="COP9 signalosome complex subunit 8 (CSN complex
FT                   subunit 8) [Source:UniProtKB/Swiss-Prot;Acc:P0C624]"
FT   mRNA            complement(join(778940..779172,779174..779203,
FT                   779259..779437,779499..779695))
FT                   /locus_tag="ANIA_10208"
FT                   /old_locus_tag="AN10208.4"
FT                   /note="transcript_id=CADANIAT00008069"
FT   CDS_pept        complement(join(778940..779172,779174..779203,
FT                   779259..779437,779499..779695))
FT                   /locus_tag="ANIA_10208"
FT                   /old_locus_tag="AN10208.4"
FT                   /product="COP9 signalosome complex subunit 8 (CSN complex
FT                   subunit 8) [Source:UniProtKB/Swiss-Prot;Acc:P0C624]"
FT                   /note="transcript_id=CADANIAT00008069"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008069"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008069"
FT                   /db_xref="GOA:P0C624"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR033464"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C624"
FT                   /protein_id="CBF84891.1"
FT                   /translation="MDLPPLSLDQLSAVITAGPTPTDLYTSLSAYEEQACLLSATDPSE
FT                   KDLLLEFYTAFFFSHLLTDQICEARALTRRIPREISRLDAMQTCSLLLRAVWQSKHTEI
FT                   YKILRELPWPGRSQPLVQRYESYFQEKTLVEMSNSYETIRIAAAATYLGLDPAAVEGDI
FT                   IEKFTACGWKWDSEKQLLHPKPVVTAPPKDDSLQNELSRVMALISNQGS"
FT   gene            780014..782617
FT                   /locus_tag="ANIA_01455"
FT                   /old_locus_tag="AN1455.4"
FT                   /product="hypothetical protein similar to oligosaccharyl
FT                   transferase (Eurofung)"
FT   mRNA            join(780014..780143,780217..780240,780340..780420,
FT                   780522..781115,781165..782290,782347..782617)
FT                   /locus_tag="ANIA_01455"
FT                   /old_locus_tag="AN1455.4"
FT                   /note="transcript_id=CADANIAT00008070"
FT   CDS_pept        join(780014..780143,780217..780240,780340..780420,
FT                   780522..781115,781165..782290,782347..782617)
FT                   /locus_tag="ANIA_01455"
FT                   /old_locus_tag="AN1455.4"
FT                   /product="hypothetical protein similar to oligosaccharyl
FT                   transferase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008070"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008070"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008070"
FT                   /db_xref="GOA:C8VMC4"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMC4"
FT                   /protein_id="CBF84893.1"
FT                   /translation="MAESPVDVLLKGSSGRSARGLLRIIILVTIAAAAVSSRLFSVIRF
FT                   ESIIHEFDPWFNFRATKYLVQNGFYDFWDWFDDRTWHPLGRVTGGTLYPGLMVTSGVIY
FT                   HILRFLTFPVDIRNICVLLAPGFSGLTAFAMYLLTNEMSSSPSAGLLAAAFMGIAPGYI
FT                   SRSVAGSYDNEAIAIFLLVFTFFLWIKAVKNGSIMWGALAALFYGYMVSAWGGYVFITN
FT                   LIPLHVFVLLCMGRYSPRLYISYTTWYALGTLASMQIPFVGFLPIRNSDHMSALGVFGL
FT                   LQLVAFAEFVRSYIPGKQFQRLLTASIILITGLAFAGLVVLSMSGIIAPWSGRFYSLWD
FT                   TGYAKIHIPIIASVSEHQPTAWPSFFFDLNFLIWLFPAGVYMCFRDLRDEHVFVIIYAV
FT                   LASYFAGVMVRLMLTLTPIVCVAAALVLSYILDTYLKTSPGPVTRGRSNDESSEGLRSA
FT                   RSPEVGITSYFSKAVTTSAAIVYLLLFVAHCTWVTSNAYSSPSVVLASRMPDGSQFIID
FT                   DYREAYYWLRQNTPANAKIMSWWDYGYQIGGMADRPTLVDNNTWNNTHIATVGKAMSSR
FT                   EEVSYPILRQHDVDYVLVVFGGLLGYSGDDINKFLWMVRIAEGIWPDEVKERDFFTARG
FT                   EYRVDDQATPTMRNSLMYKMSYHNFNKLFPMGQATDRVRGAKLPAESPQLSTLEEAFTS
FT                   ENWIIRIYKVKDLDNLGRDHSNAVAFDRGNKRKKASKRKGPRVLRSE"
FT   gene            complement(783169..783649)
FT                   /locus_tag="ANIA_11304"
FT                   /old_locus_tag="AN11304.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(783169..783263,783336..783460,
FT                   783576..783649))
FT                   /locus_tag="ANIA_11304"
FT                   /old_locus_tag="AN11304.4"
FT                   /note="transcript_id=CADANIAT00008071"
FT   CDS_pept        complement(join(783169..783263,783336..783460,
FT                   783576..783589))
FT                   /locus_tag="ANIA_11304"
FT                   /old_locus_tag="AN11304.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008071"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008071"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008071"
FT                   /db_xref="GOA:C8VMC5"
FT                   /db_xref="InterPro:IPR018628"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMC5"
FT                   /protein_id="CBF84895.1"
FT                   /translation="MPAGIFNSTYYGKDYRAGAALLRARRPYLFKNAATGLGLCMFTIG
FT                   VYAYTIRAVGQDEFSDVKVPDAPAAAPQQSKQ"
FT   gene            784455..787186
FT                   /locus_tag="ANIA_01456"
FT                   /old_locus_tag="AN1456.4"
FT                   /product="mRNA cleavage and polyadenylation specificity
FT                   factor complex subunit (Pta1), putative (AFU_orthologue;
FT                   AFUA_8G04420)"
FT   mRNA            join(784455..784792,784949..785114,785172..785302,
FT                   785369..785572,785621..785969,786019..786839,
FT                   786893..786963,787020..787186)
FT                   /locus_tag="ANIA_01456"
FT                   /old_locus_tag="AN1456.4"
FT                   /note="transcript_id=CADANIAT00008072"
FT   CDS_pept        join(784455..784792,784949..785114,785172..785302,
FT                   785369..785572,785621..785969,786019..786839,
FT                   786893..786963,787020..787186)
FT                   /locus_tag="ANIA_01456"
FT                   /old_locus_tag="AN1456.4"
FT                   /product="mRNA cleavage and polyadenylation specificity
FT                   factor complex subunit (Pta1), putative (AFU_orthologue;
FT                   AFUA_8G04420)"
FT                   /note="transcript_id=CADANIAT00008072"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008072"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008072"
FT                   /db_xref="GOA:C8VMC6"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR021850"
FT                   /db_xref="InterPro:IPR032460"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMC6"
FT                   /protein_id="CBF84897.1"
FT                   /translation="MAQSGDQVTDQIAQLNAARNLVLGDAAFYPQIVNGVLPIIGAHAR
FT                   VELRRWGTEFLAETFASPAFATAPKEQLAINVLQTVRSILELPEGDQLVLQNITQTAAS
FT                   LYPLVFRHIINHPEDKQSWEHIEAIKQDLLRRWDSFPCPVKVCCIKFAQRVVLTQTHGP
FT                   IADPRRPDKNETSLAIVPRNHAILSLPNLEAESSGLLDRILSIFQEDASDPVLVNATLN
FT                   CLAVVIRTRQSIGNKIINAILNFFPARHMRLPVTPAVRIGVKSMERTARAVFINIMKRN
FT                   PSHPLAGKMQQHIERLMQSRIEQVDDTSRKRGLPTEPTDGLDAAKRARLDAETPPIIKV
FT                   PPLPPGRISFAQLFTLTEDSGLSSFDVKQLPADLVVKIAVPLLARVDQSLLGQAVDAIR
FT                   MRYQTVQKQQMTQPQLAAEEDDDDYEPEYQPMDIPASAADETGAVLAAVQEEQTDLVSL
FT                   GPFVLPRPPPLTEEQAAEAGRSAVARVFGMLGSTTLTPNPVKGQGQRLGFSRLAGSTFD
FT                   RDAWVTLLTRLATRAPAGLEGPKQETDSLGRKKPTISDTIRESLYRYILEDFRGRVNIG
FT                   IMWLNEEWYNDRLQMKVASSNRTDEDEEISVPLHYDHWVLRLLDGFLPYLDSRDNKVFI
FT                   RFLSEIPEVTIHIAKRIASLAKDPERVNLCVQSFMYLIMFRPPAREICLDALEEVYQNY
FT                   EESRPSAGKVLSRWRPQRVEQLQAEQTTLVNRTVDNTTITNGSRDPRTAHVAAS"
FT   gene            complement(787787..789644)
FT                   /locus_tag="ANIA_01457"
FT                   /old_locus_tag="AN1457.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_8G04470)"
FT   mRNA            complement(join(787787..787833,787906..787932,
FT                   788024..788073,788222..788586,788643..789644))
FT                   /locus_tag="ANIA_01457"
FT                   /old_locus_tag="AN1457.4"
FT                   /note="transcript_id=CADANIAT00008073"
FT   CDS_pept        complement(join(787787..787833,787906..787932,
FT                   788024..788073,788222..788586,788643..789644))
FT                   /locus_tag="ANIA_01457"
FT                   /old_locus_tag="AN1457.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_8G04470)"
FT                   /note="transcript_id=CADANIAT00008073"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008073"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008073"
FT                   /db_xref="GOA:Q5BDC3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDC3"
FT                   /protein_id="CBF84899.1"
FT                   /translation="MLQKDGQQLPSAKPASALELAIFSSDSPPLQHSNAEGSPTLPEWV
FT                   RLESRIRRKTDLRLCSIAGILCSLNLLDSGILASASVTTLLSDLDLQGQRYSVSIFIFT
FT                   VASIVFQLPCTVAVRYVGPRLWFATITFCFGLITLCTAFVQTWRQMIAVRILLGIFMSG
FT                   IYPGLTYLVSTWYTRQEQQLRFAFLQSGEVAALATGYIVNYGLNQLHGKAGLEGWRWMY
FT                   LVQGLITCVIGIATYWWMVDFPENARKSFHFLTETEAKVAVQRIQADRGDVVLDPFEWR
FT                   KVLVNFTDPKLYGFACMYFCLNIVSTSLNYFLPQIIESGLGFSSNESILLSTPPYYWAV
FT                   LPVLLTSLIGDTFRIRGPLITFNALCLIAGYLMFGLPSSTQVTVRYVGTFLATGAYVSN
FT                   WAALNAFMANNIVGQWKRATTAAAVAACNGLGSIAGSYIVRQSEAPEYQTAVWVSIGVL
FT                   YTKYKADREGAPEHGWVPVYILVDNDDIQPESKEWPSI"
FT   gene            791494..792926
FT                   /locus_tag="ANIA_01458"
FT                   /old_locus_tag="AN1458.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            791494..792926
FT                   /locus_tag="ANIA_01458"
FT                   /old_locus_tag="AN1458.4"
FT                   /note="transcript_id=CADANIAT00008074"
FT   CDS_pept        791665..792756
FT                   /locus_tag="ANIA_01458"
FT                   /old_locus_tag="AN1458.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008074"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008074"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008074"
FT                   /db_xref="GOA:C8VMC8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMC8"
FT                   /protein_id="CBF84901.1"
FT                   /translation="MVEFIPPPDPRDLLPPLLACLPTAFVSQKPPPALLPLLSPILRQR
FT                   VQILSSVSTSSSESWLRLLCWDSEKGERLQSLIDGASFEPHPVSGEIELPDDIPVTYRR
FT                   LDEETLQSRVLIPEYELKVVYLWCPKEESPGWRIAEVLPHQGLGEDDGVWSSTIGDANT
FT                   HAKEKLVEDALKAAERDDHIAPQEEDDDDDDYWARYDATPGRTPSVKNSAPPALTSMLQ
FT                   HHGPSESSYFSQYDDVQPVMDNHDPDEEHPELGPSSLGGDILTELAKRNTDSESHEHMN
FT                   QTNGASLNHPRPESATSSNPEAVSRLEQEAENQSAYEIGVKQHIGSNIKSLFRLAKATG
FT                   ISRADFQSLVKTELDLLNLSDDD"
FT   gene            793210..795679
FT                   /locus_tag="ANIA_01459"
FT                   /old_locus_tag="AN1459.4"
FT                   /product="mannosyltransferase PMTI (AFU_orthologue;
FT                   AFUA_8G04500)"
FT   mRNA            join(793210..793486,793540..795184,795234..795679)
FT                   /locus_tag="ANIA_01459"
FT                   /old_locus_tag="AN1459.4"
FT                   /note="transcript_id=CADANIAT00008075"
FT   CDS_pept        join(793256..793486,793540..795184,795234..795679)
FT                   /locus_tag="ANIA_01459"
FT                   /old_locus_tag="AN1459.4"
FT                   /product="mannosyltransferase PMTI (AFU_orthologue;
FT                   AFUA_8G04500)"
FT                   /note="transcript_id=CADANIAT00008075"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008075"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008075"
FT                   /db_xref="GOA:Q5BDC1"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDC1"
FT                   /protein_id="CBF84903.1"
FT                   /translation="MSSSPSLRKRGGKREDTPVPSDRSFAPSASQLGAASRSSEWDYRL
FT                   AITILTVLAFITRFYKISYPDQVVFDEVHFGKFASYYLRRTYFFDVHPPFAKLLLAFTG
FT                   WLVGYDGHFLFENIGDSYIDNKVPYVALRAMPAVLGALTIPVVFLIMWESGYSLPACVL
FT                   ASGLVLFDNAHVGEDRLILLDSTLVITMALSILCYIRFYKLRHEPFGRKWWKWLLLTGV
FT                   SLSCVISTKYVGVFTFVTIGSAVMVDLWNLLDIRRQGGALTMFEWTKHFAARFFSLIVV
FT                   PFFFYLFWFQVHFAILTHSGPGDDFMTPAFQETLSDNAMAAQSVSIEYFDTITMRHKDT
FT                   KVFLHSHSDTYPLRYDDGRISSQGQQVTGYPYNDTNNHWQIIPTVPLDETDEKSRKVRN
FT                   GDIVQLRHVATDTILLTHDVASPYYPTNQEFTTVSHELADGKRHNDTLFEIRVEHGKSK
FT                   QEFRTLSSQFKLVHVPTKVAMWTHTTPLPDWAYKQAEINGNKNVLQSSNIWYVEAIESL
FT                   EEDSPRLKKEERKVKHLPFWRKYIELQRAMFFHNNALTSSHPYASEPFQWPFLLRGVSF
FT                   WTKSDTREQIYFLGNPVGWWISSSLLAVFAGVIGADQLSLRRGVDAVEEIWGPGSRSRL
FT                   YNSTGFLFLCWAAHYFPFWLMGRQRFLHHYLPAHVASALVTGALIEFIFNIQPISVPAT
FT                   IPVAADDPTGKGKTRRFVTARERMGVKSIVAGWIASLTILAATIWGFWFFAPLTYGTPG
FT                   LDVAQVNARKWLGYDLHFAK"
FT   gene            complement(795963..797192)
FT                   /locus_tag="ANIA_01460"
FT                   /old_locus_tag="AN1460.4"
FT                   /product="pirin, putative (AFU_orthologue; AFUA_8G04510)"
FT   mRNA            complement(join(795963..796015,796146..797192))
FT                   /locus_tag="ANIA_01460"
FT                   /old_locus_tag="AN1460.4"
FT                   /note="transcript_id=CADANIAT00008076"
FT   CDS_pept        complement(join(795963..796015,796146..797025))
FT                   /locus_tag="ANIA_01460"
FT                   /old_locus_tag="AN1460.4"
FT                   /product="pirin, putative (AFU_orthologue; AFUA_8G04510)"
FT                   /note="transcript_id=CADANIAT00008076"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008076"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008076"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDC0"
FT                   /protein_id="CBF84905.1"
FT                   /translation="MSVPRAIRTVFLAIEQAEGAGARVRRSIGTPKLRNFSPFLMLDHF
FT                   TIGKGAGFPDHPHRGQETITYLLSGGVDHEDFAGNKGTIGPGDLQFMTAGKGIMHAEMP
FT                   HENEDGSPNVGMQLWVDLPKKLKMCEPRYRDLRASEIPVATVDQGRVTVKVISGQSHGV
FT                   DSVRDLAYTPVWLLDVAIKPGGRITQILPVGWNAFAYTLAGTTVFGSNNSTQLVKQFHN
FT                   VVFEQSGDHVEASVPDNAEEDSRFILVAGQPLDQKVVQYGPFVLTSQEEVYQAMLDYQT
FT                   ASNGFERVRGWEKYVWIIMMTTSNTSPHS"
FT   gene            797718..799475
FT                   /locus_tag="ANIA_01461"
FT                   /old_locus_tag="AN1461.4"
FT                   /product="Protein OS-9 homolog Precursor
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDB9]"
FT   mRNA            join(797718..798006,798060..799475)
FT                   /locus_tag="ANIA_01461"
FT                   /old_locus_tag="AN1461.4"
FT                   /note="transcript_id=CADANIAT00008077"
FT   CDS_pept        join(797893..798006,798060..799475)
FT                   /locus_tag="ANIA_01461"
FT                   /old_locus_tag="AN1461.4"
FT                   /product="Protein OS-9 homolog Precursor
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDB9]"
FT                   /note="transcript_id=CADANIAT00008077"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008077"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008077"
FT                   /db_xref="GOA:Q5BDB9"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="InterPro:IPR012913"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BDB9"
FT                   /protein_id="CBF84906.1"
FT                   /translation="MRRQSRIVASLLVLACASSGAFAHRKFNVHDDLLAYPQFRIKFPD
FT                   GFILESQARAFLEQAPYSSPDLNDISEQTPLKDESEESIRDGSSGEKAKFSYEELSLEG
FT                   QRYLCQIPVVEDGDSNRTKVEVNEEEERKELARATDRGLELLREMEGKCLYYISGWWSY
FT                   SFCYMNQIKQFHALPSGGGVPNYPPMEDHTTHSFILGRFPQEEGQDEGKGAKSGKSSTE
FT                   LAELQTKGGSRYLVQRLESGDQCDLTGKNRKIEVQFHCNPQSTDRIAWIKELYTCSYLM
FT                   LIYTPRLCNDVAFLPPQQEEVHTIECREILTPEEVTGWQAMHEYQLSQQLVESAEAPKH
FT                   QVIGGIEVGAQRLVGTEGKRIEKGRVASIGEEKVDVVAKRVNGEVQLLSAEELKKFDLD
FT                   EAKIEELRKKLEEWAKGKDWTLEIVTGNGAYLRGVVDTDEDEEDGYENEEGETDKREQR
FT                   ENTQETTGQPGQPGHQEETESGQAGHPMDDRSEDGEDPDVDGSEEIFKDEL"
FT   gene            800254..803963
FT                   /locus_tag="ANIA_01462"
FT                   /old_locus_tag="AN1462.4"
FT                   /product="cytoskeleton assembly control protein Sla1,
FT                   putative (AFU_orthologue; AFUA_8G04520)"
FT   mRNA            join(800254..800451,800623..801342,801380..801970,
FT                   802009..802057,802106..803890,803938..803963)
FT                   /locus_tag="ANIA_01462"
FT                   /old_locus_tag="AN1462.4"
FT                   /note="transcript_id=CADANIAT00008078"
FT   CDS_pept        join(800254..800451,800623..801342,801380..801970,
FT                   802009..802057,802106..803890,803938..803963)
FT                   /locus_tag="ANIA_01462"
FT                   /old_locus_tag="AN1462.4"
FT                   /product="cytoskeleton assembly control protein Sla1,
FT                   putative (AFU_orthologue; AFUA_8G04520)"
FT                   /note="transcript_id=CADANIAT00008078"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008078"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008078"
FT                   /db_xref="GOA:Q5BDB8"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007131"
FT                   /db_xref="InterPro:IPR013182"
FT                   /db_xref="InterPro:IPR029922"
FT                   /db_xref="InterPro:IPR035800"
FT                   /db_xref="InterPro:IPR035821"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR038159"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB8"
FT                   /protein_id="CBF84908.1"
FT                   /translation="MGFIGVYTAIYDYQPQAQGELELREGDLLYILEKSDEDDWWKAKK
FT                   KADREDEDEPEGLVPNNYVEEATPIHTAKALYDYTRQTDEEVSFSEDANLVVYDTSDPD
FT                   WTLVGVNGDFGFAPSNYIDILDDSVAHAAPAQTSASPEPPSAAAASPASPAPAPAPPSL
FT                   PQRPEPAPAEEPSSPVSSSPSDAVQNPAAAAIASILHKQHASSESPRDVPPPPQPQPPS
FT                   EPQYREPSPPPPQLPRRPPSEQLTSPVHLESPTFAPSPVSHPRHASIRENDGGPRESPP
FT                   YNRVGRTAPRSPSGYHIYNINEMVEGSTSPPGTIFISPEDDGDVQEWSAEKLTHYSIEG
FT                   KHVFIDLVRPSKSVDFHAGAKDTAREIVSALGEISGAFRAEGLREVIAAGSGGGGAQKK
FT                   GTILYDFMAQGDDEVTVGVGDEVVIVDDTKSEEWWMVRRIKNGKEGVVPSSYVEVTGFV
FT                   SPPSTTTPAESGLSAVERNRLEEARLAKEATRKSVSEAAAPRSPTIKPQHHKKDSKSSQ
FT                   RSKPDPAKVRTWIDRSKAFTVEAQFIGLQDGKIHLHKTNGIKIAVPIPKMSFEDLEYVE
FT                   KVTGISLDEDKPLSDIRRRSQRIESDKADKARSSSEGKSGATFQQSDYDWFDFFLKAGV
FT                   GPHQCERYAQNFAKDSMDESILPDITPENLRTLGLKEGDILRVMRYLDNMLGRTGNKSK
FT                   LRNVSFGGEEVMGDGEESGGLFAGPGGALRNNTRKSRPAPAVQTNDVVDPKVFEQKDTA
FT                   KPDKPPSSGTPPPASAAAGDKPVQKGFDDDAWEVKTPKQPAAPATAVSSPPPAAAPATT
FT                   SPPAQPSITGAMADLSLLQAPLQPTLAQPTSTPAPAQSPPATQPIQAQPTAIPAPQPQQ
FT                   PGASPNFFAQVAQVGQQQPMQTGFQQSRQRPQAPQVMGQNSLIPPPPQRPLSAPQNMPQ
FT                   QQPFGLPQLQPQLTGLPQQGPQIAAPGQSLAEINQQRFQPSFQPQQTGFMAPNQFQNGL
FT                   MPQPTGFQPQSQFGIQQQQTGFGLAPQPTGFGGFGAPPQQPMPTGINSVLPPPLQPQPT
FT                   GMNGSGSMAYSPSPPPIPPIPQQQTLAPLQAQKTGPAPPVRFGVKPDAPKKLAPQPTGL
FT                   KANLSQATPTNPFGF"
FT   gene            808460..809868
FT                   /locus_tag="ANIA_01463"
FT                   /old_locus_tag="AN1463.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(808460..808514,808570..808954,809003..809164,
FT                   809213..809365,809444..809566,809649..809868)
FT                   /locus_tag="ANIA_01463"
FT                   /old_locus_tag="AN1463.4"
FT                   /note="transcript_id=CADANIAT00008079"
FT   CDS_pept        join(808460..808514,808570..808954,809003..809164,
FT                   809213..809365,809444..809566,809649..809868)
FT                   /locus_tag="ANIA_01463"
FT                   /old_locus_tag="AN1463.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008079"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008079"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB7"
FT                   /protein_id="CBF84910.1"
FT                   /translation="MQLFAHLLRVATALLLPIGTVAQECSSRENYTARNQTEIDTITQN
FT                   CTTIVGELGLVDWSGPLTLPNITRIRSIRVYSGDITAIELPALTYLGSDLLLTNLPSLR
FT                   RVSLPELQHIEGLYVDLVGNAPELHIPRLTNASSIYLRGNFSDQSFHSLRNVEKKLDIC
FT                   NAVSCGYYSRMNAFTSMRLSFPSLERAGSLIVGGNVSSLSLPELTTLTCNDCDWVALHL
FT                   KLYGSSRLPVNLPKLANTNGSLYIRGDIDSISLPSLREYNRELIMTPYEPLDITLPVER
FT                   AEDFSFTGNVSSLTDFTRIYINSDLDFDCDALWKDLEQTSGPLNESSKEEYFQCSVGVS
FT                   WQPGGSQAATAVAALGLGFVMGLLI"
FT   gene            complement(810314..812768)
FT                   /locus_tag="ANIA_10192"
FT                   /old_locus_tag="AN10192.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(810314..812768)
FT                   /locus_tag="ANIA_10192"
FT                   /old_locus_tag="AN10192.4"
FT                   /note="transcript_id=CADANIAT00008080"
FT   CDS_pept        complement(810314..812581)
FT                   /locus_tag="ANIA_10192"
FT                   /old_locus_tag="AN10192.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008080"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008080"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008080"
FT                   /db_xref="GOA:C8VMD4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMD4"
FT                   /protein_id="CBF84912.1"
FT                   /translation="MPRASTAAGARLRCRRACDSCKRRKQKCNGEQPCTICIQRRKEAE
FT                   CHFSDKPARLLRPGNDPKEAMLLSEHLVSTPQRRTAMDHLLNSLEDTSANLEQQVEEDK
FT                   DGGAAPVPKVARLLRDGQGKFMYIGDSASLSFLQSVRRIVSQSIGRCEFTEDTSRHSML
FT                   EAFQSSSATQNGPLAQPPSNDEAQRLARQYVLATSPLLDLFDLEEFHPRLANWIGNPTG
FT                   DEDTVSSIFYLVLAIGAQVSDTNQAQAERYFVSGRQLAFSAFTETPSLYTIQSYVLISM
FT                   YMLGACRRNGAFMNLGIALRAAYAVGIHRRDANSLFTTRERRARERVWKSLRMMDLFLS
FT                   ASLGRPPATSDFDYDLREDEVSRKESHLPQDQVSTTVISLCRIFERVLTEVYMRQVVSI
FT                   NLAENISNQHRAWVRTLPTFLQLQRDRLESRTLEESLAAAHVFGSYYWSIILLTRPFLI
FT                   FWVSQYVKSKKGSAGAPESRNGTSRLSLFADACVYSALRGLDIVEGLARYEALPRRLPF
FT                   LINSVFNSAVVLGAAFFADYDNLLPLGEGMNKAERFLELFVPHDPHSCRFLQIIRYLRA
FT                   AVSEYVGRRSRQWMERRSRQVEQLFGQVGPASADELSPTPDTIPSARRPGEIAAPSPLS
FT                   PNKLPQADNPIPSQHPDLTTLAPHDSSIWDALCGTTTAGLPFDSAISTLTTTGIPVNFS
FT                   PGGSMGMPLAGAGASASASRRAGAETGDGDGHTPLSDMILSDNGLLYMAEDLPVFGLWD
FT                   ET"
FT   gene            complement(812959..814369)
FT                   /locus_tag="ANIA_10197"
FT                   /old_locus_tag="AN10197.4"
FT                   /product="sulfonate biosynthesis enzyme, putative
FT                   (AFU_orthologue; AFUA_8G04550)"
FT   mRNA            complement(join(812959..813690,813743..813860,
FT                   813915..813952,814017..814369))
FT                   /locus_tag="ANIA_10197"
FT                   /old_locus_tag="AN10197.4"
FT                   /note="transcript_id=CADANIAT00008081"
FT   CDS_pept        complement(join(813061..813690,813743..813860,
FT                   813915..813952,814017..814259))
FT                   /locus_tag="ANIA_10197"
FT                   /old_locus_tag="AN10197.4"
FT                   /product="sulfonate biosynthesis enzyme, putative
FT                   (AFU_orthologue; AFUA_8G04550)"
FT                   /note="transcript_id=CADANIAT00008081"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008081"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008081"
FT                   /db_xref="GOA:C8VMD5"
FT                   /db_xref="InterPro:IPR003830"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036112"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMD5"
FT                   /protein_id="CBF84913.1"
FT                   /translation="MLSPITRATALSSGKAQGSTFQRAAAPMMWSKGFSTTAPGSKKAA
FT                   ILLQDKSNGFGFARSNPRPKKPRSQGVTEIRGPYYTVMGKRYLADILETMGTHVDGLKF
FT                   AGGSFSLFPEKPLRELIDLAHEHSVYVSTGGWAEHLLTHPDPTSVFDKYLTKCEDLGFV
FT                   MLNLVPFRVLTLHHRFDVIELSSGFLSIPEDDWLRLVDKVHSYGLKAKPELGIQFGAGG
FT                   DTSAAGLESLGTSDPGKLVNLGRKFLDAGVERLMIESEGITENVKSWRTDVVSKIMKEL
FT                   PPERVMFEAADPQVYTWYIREFGIDVNLFVDHSQIVQLSGLRHGIWGTADTFGRLVSFR
FT                   AE"
FT   gene            815738..817882
FT                   /locus_tag="ANIA_01465"
FT                   /old_locus_tag="AN1465.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_8G04560)"
FT   mRNA            join(815738..816362,816442..816976,817028..817882)
FT                   /locus_tag="ANIA_01465"
FT                   /old_locus_tag="AN1465.4"
FT                   /note="transcript_id=CADANIAT00008082"
FT   CDS_pept        join(815973..816362,816442..816976,817028..817434)
FT                   /locus_tag="ANIA_01465"
FT                   /old_locus_tag="AN1465.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_8G04560)"
FT                   /note="transcript_id=CADANIAT00008082"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008082"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008082"
FT                   /db_xref="GOA:Q5BDB5"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB5"
FT                   /protein_id="CBF84915.1"
FT                   /translation="MGAGAILEPLVVIVLLFGGTWINRTAGSFPPSRRARRKSVDRYRG
FT                   VSPDSIESGLCSPTSKDGLLKDRPLSPASSHCGHESWRKRRIGILLWTTEVTSPNTVVF
FT                   QDRLLSRLLRKLPFLAECWYWALVYWTYQLGRAFTAVTLQEGTVDVARKHALKLIEIEQ
FT                   ALGLFWEVPIQQFFLRHPLLMKWTNWIYSFIHIPGTIAFLVWLYYYTITRNHSDEPQSG
FT                   KPRGTASGSPAGPLLYQARRRTLAVCNLLAFVVFTLWPCMPPRLLSDEKVQGPEGKLAR
FT                   SFGFVDTVHGAEGAGSVWTENRFCNQYAAMPSLHFGYSLMIGLTIMTIPLPAHHRVSTR
FT                   VRIGPFGAQIPSRQRLVCLFLGFAYPFMILAAIVATANHFILDAVAGAIVCTLGWKFNS
FT                   VLLNLLPVEDYFLWLVRIHKPEPAEMAGPLDLEEWTDEIEAETA"
FT   gene            818564..821209
FT                   /locus_tag="ANIA_01466"
FT                   /old_locus_tag="AN1466.4"
FT                   /product="PWWP domain protein (AFU_orthologue;
FT                   AFUA_8G04570)"
FT   mRNA            join(818564..818699,818749..819230,819349..819826,
FT                   819890..820250,820300..820522,820572..821209)
FT                   /locus_tag="ANIA_01466"
FT                   /old_locus_tag="AN1466.4"
FT                   /note="transcript_id=CADANIAT00008083"
FT   CDS_pept        join(819065..819230,819349..819826,819890..820250,
FT                   820300..820522,820572..821209)
FT                   /locus_tag="ANIA_01466"
FT                   /old_locus_tag="AN1466.4"
FT                   /product="PWWP domain protein (AFU_orthologue;
FT                   AFUA_8G04570)"
FT                   /note="transcript_id=CADANIAT00008083"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008083"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008083"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR035441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB4"
FT                   /protein_id="CBF84917.1"
FT                   /translation="MAEANTNSPAPAPDSGEAPVERASAELKASPQESASEPTKENTKK
FT                   DANGADGKPAESAPAQDDKKESSDDTADKTEAPAEPAEAKKSDEGAAASADAEPAAAPE
FT                   ANGAPSSTKKASSKRKSTGGDTKSKLNRKKSMSRITHLDAKAGEYYLARLRSFPPWPAV
FT                   ICDEEILPQSLLSSRPVTARRPDGTYREDYADGGKRVAERTFPVMFLQTNEFAWIPNTD
FT                   LSPLDPAACKDISEKGKSKALVAAYNVAAENHDLAYFKNMLADHQAAIQQEEEEREAQE
FT                   AAKAAAKAAKEAKKNKRKSMEVRDDVEMEDADEEKQPKSSKKRKKDAEAEGDDKPAKTP
FT                   KTGTKLKLTTPKNPAEEKKASGSAKAKQSTSKKGKKAAASEDSDESSPAPKEPEPKVNL
FT                   EEAKKKREREVLFIRHRLQKGFISRDHPPKEEEMSQMSGYFTKLEKLNDLEVSIIRETK
FT                   IHKVLRMIIKLPNIPRDEEFDFRKRALDILSKWKNVLDSDRATPSQEKEKEKEEKPKSN
FT                   GVHKEKEGSAEAPVKASESKSEKEDDTKLDTPDQDTPMPDADEKTEEAPAPAKGEDEKV
FT                   ESADAAGETGKSEKKETETDTEKPAEDKAEDKKADEKTAEAETAA"
FT   gene            complement(822684..824385)
FT                   /locus_tag="ANIA_01467"
FT                   /old_locus_tag="AN1467.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(822684..824385)
FT                   /locus_tag="ANIA_01467"
FT                   /old_locus_tag="AN1467.4"
FT                   /note="transcript_id=CADANIAT00008084"
FT   CDS_pept        complement(822856..824208)
FT                   /locus_tag="ANIA_01467"
FT                   /old_locus_tag="AN1467.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008084"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008084"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008084"
FT                   /db_xref="GOA:Q5BDB3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB3"
FT                   /protein_id="CBF84919.1"
FT                   /translation="MILSVRPSRACGSAGSSLQAIARENLTGILWSPAARSQSLRRLPQ
FT                   DRPPQPLQRTRLPFLQVHSSRAFHSTPKRDSYTPRISYRVAASSSGKSRRFLPTKNAYN
FT                   FNPELHDALGVAVDTQDPATKRKRRPDSGEDAFFVSTVGRRRDPSKDNTIAFAVADGVG
FT                   GWAESRVDPADFSHALCDYMAQTALDWDGPAEQLRAKYLLQAGYDRVVADETIPAGGST
FT                   ASVGIGLDDGRIELANLGDSGSVLLRQAAVHHYSIPQTHGFNTPYQLSIIPKRMRQQAS
FT                   IFGGGFLEDFPRDANTTTLHMHHGDVLMLATDGVFDNLNNQDILKLVTGRMIYTGAWRA
FT                   STSPNTGIIPADRETLDRLTGAEGVATLVPSAMPKSTSNKSTIVSNPNNHIYTLQSLLA
FT                   ASIAGEAKLASLDPRRDSPFAKEAQRYYPGDHYRGGKVDDIAVLVIIAVEE"
FT   gene            825023..826781
FT                   /locus_tag="ANIA_01468"
FT                   /old_locus_tag="AN1468.4"
FT                   /product="pre-mRNA splicing factor, putative
FT                   (AFU_orthologue; AFUA_8G04590)"
FT   mRNA            join(825023..825064,825184..825217,825292..826781)
FT                   /locus_tag="ANIA_01468"
FT                   /old_locus_tag="AN1468.4"
FT                   /note="transcript_id=CADANIAT00008085"
FT   CDS_pept        join(825023..825064,825184..825217,825292..826781)
FT                   /locus_tag="ANIA_01468"
FT                   /old_locus_tag="AN1468.4"
FT                   /product="pre-mRNA splicing factor, putative
FT                   (AFU_orthologue; AFUA_8G04590)"
FT                   /note="transcript_id=CADANIAT00008085"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008085"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008085"
FT                   /db_xref="GOA:Q5BDB2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR014906"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027106"
FT                   /db_xref="InterPro:IPR036285"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB2"
FT                   /protein_id="CBF84921.1"
FT                   /translation="MMHPARQAYVEEAEEMDTGINLADLPVDRDYVIPSSAAGIPAEKA
FT                   SAIISQFERKRRAAAMAVPTDDTRVRARLRELGEPITLFGEGPADRRDRLRELLTDIAE
FT                   KQEAAAAEDIEMAEAGGEEDEGEQQEEFYTEGSDELLKARKAIARFSLPRAKARVARQR
FT                   EESTIPLRTHIKHRKAIKEKLHNFDLYGSQIAGDRPVSICRFAPDGQTIATGNWGGGIR
FT                   LLGVPNLEEKLSVKGHTDRVGGLSWFPGATLPESNVSESAVNFVSGGGEGNVCLWSLDK
FT                   DQPLATLEGHSGRVCRTEFHPSGKYIASASYDTTWRLWDVETTAELQLQEGHSREVYTV
FT                   AFNNDGSLLASGGLDSIGRVWDLRTGRTVMILEGHIREIFGLDWGVDGYRVLSGSGDGW
FT                   VKCWDLRQVKNTGGIGAHKSVVSDVRWYKGSESASFLPTTEGQPGRMDVDGATAPVQPR
FT                   KSGTFFVSSGFDKNVNIFSADDWSLIKTLSGHSGNVLSADISNNAQWIASCGHDRTVKL
FT                   WGIE"
FT   gene            827175..828014
FT                   /locus_tag="ANIA_01469"
FT                   /old_locus_tag="AN1469.4"
FT                   /product="DnaJ domain protein (AFU_orthologue;
FT                   AFUA_8G04610)"
FT   mRNA            827175..828014
FT                   /locus_tag="ANIA_01469"
FT                   /old_locus_tag="AN1469.4"
FT                   /note="transcript_id=CADANIAT00008086"
FT   CDS_pept        827175..828014
FT                   /locus_tag="ANIA_01469"
FT                   /old_locus_tag="AN1469.4"
FT                   /product="DnaJ domain protein (AFU_orthologue;
FT                   AFUA_8G04610)"
FT                   /note="transcript_id=CADANIAT00008086"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008086"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008086"
FT                   /db_xref="GOA:Q5BDB1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB1"
FT                   /protein_id="CBF84923.1"
FT                   /translation="MATSLRAQRAFQRLTVSSTVQSQARPIHTTTRKLSTPTACFLCRL
FT                   RPSRPNRRTSAIFPSALFAQRTFTSTPSTLNSASSETLPVPNAPDTTNYYTIFPQTLPN
FT                   GPPPSSPFTIDVQALRREFFSLQNTLHPDKYPPGPTKTAAESLSAIINEAYRTLSDPLL
FT                   RAQYLLREFHGIDVTAEDGSGAGAQPLDPELLMEVMDVQEAIEEVGEGQEAVEKIAVMK
FT                   KENDERVKGCVQALAEAFDKGDVEGARGECVRLKFWVSVADGLREWEPGMGGIRLIH"
FT   gene            829465..831071
FT                   /locus_tag="ANIA_01470"
FT                   /old_locus_tag="AN1470.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(829465..829473,829671..831071)
FT                   /locus_tag="ANIA_01470"
FT                   /old_locus_tag="AN1470.4"
FT                   /note="transcript_id=CADANIAT00008087"
FT   CDS_pept        join(829465..829473,829671..831071)
FT                   /locus_tag="ANIA_01470"
FT                   /old_locus_tag="AN1470.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008087"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008087"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008087"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDB0"
FT                   /protein_id="CBF84924.1"
FT                   /translation="MEPSGLARHVSKPLDHLINSGKTRESKHQIAILEDEDVETFVAFC
FT                   EYAYTGNYAVPPPGSRENEIEPVSINHALNGAYPDTGSTSPAASWEKSPPKPKVPSEAC
FT                   PGNPDDSNDRDGVGDGDVEPRRDPSQQSSSKDRHVYHSTKSEYTAQNPVATPHDSDNSP
FT                   APWAEDPPTRGRRRRRGKKDQQGVTQDATSKLTPPCTPPGAAQVEPDMPAAEPSEEFPV
FT                   LPGAEQSTSQSPERPGRTLSNGANGSGFGGIRNQREESLTKSRVRPVIDTSFANQQFSP
FT                   RHEKGTTNLWEEFTGIDDSGFRPSFRTRSPNPPAGITLPYLIFHAKLYVFATRYLIPGL
FT                   AHLCLQKLHYDLLNLAFPDPDPENQYEEQLVLTTTKARMIVDLLNYTYTKTTRLEPITP
FT                   SSATQLRDNELRRLVVHYAACKVRDLAVYCPPVEPIAGAAFYPEQPSARGFRALLDTLP
FT                   ELASDLIYRMI"
FT   gene            complement(832418..832986)
FT                   /locus_tag="ANIA_01471"
FT                   /old_locus_tag="AN1471.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(832418..832426,832630..832986))
FT                   /locus_tag="ANIA_01471"
FT                   /old_locus_tag="AN1471.4"
FT                   /note="transcript_id=CADANIAT00008088"
FT   CDS_pept        complement(join(832418..832426,832630..832986))
FT                   /locus_tag="ANIA_01471"
FT                   /old_locus_tag="AN1471.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008088"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008088"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008088"
FT                   /db_xref="GOA:Q5BDA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA9"
FT                   /protein_id="CBF84926.1"
FT                   /translation="MAPVCSASRLGDYGSVPSSTRQPAKTEIDNASSTGSSTAKLCGTD
FT                   PGAWAVATENETGGKEPSETIGDDWSSGYTLRTEHRARFNSQQPLTNPMRHNAPLIRPI
FT                   DFLGLWPEPDLRTRLVT"
FT   gene            835141..836328
FT                   /locus_tag="ANIA_01472"
FT                   /old_locus_tag="AN1472.4"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein, putative (AFU_orthologue; AFUA_8G04630)"
FT   mRNA            835141..836328
FT                   /locus_tag="ANIA_01472"
FT                   /old_locus_tag="AN1472.4"
FT                   /note="transcript_id=CADANIAT00008089"
FT   CDS_pept        835141..836328
FT                   /locus_tag="ANIA_01472"
FT                   /old_locus_tag="AN1472.4"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein, putative (AFU_orthologue; AFUA_8G04630)"
FT                   /note="transcript_id=CADANIAT00008089"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008089"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008089"
FT                   /db_xref="GOA:Q5BDA8"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR030185"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA8"
FT                   /protein_id="CBF84928.1"
FT                   /translation="MFENVPLPQSPRSETSTIVGEEVEMKKGVQMTICERLHHFTWAWF
FT                   TLTMSTGGLALLISNQPFQFQGLREIGLAVYIIDLLFFALCCFLMALRFFLHGGFLKSL
FT                   RHEREGFFFPTFWLSVATIISGLYKFFGEDADESFQLALEVLFWIYCACTLTLAVVQYY
FT                   FVFSSHTYHLQTMMPSWILPIFPVMLSGTIASVIAEQQPARSAIPIVCAGITFQGLGFS
FT                   VAFMMYSHYIGRLMQAGLPHREHRPGMFICVGPPAFTALALVGMTAGLPEQFEILHDES
FT                   SIQDARIMTLIAVSAAVFLWALSLWFFCIAVIAVIRERPTAFHLSWWAMVFPNTGFTLA
FT                   TITLGNWLDSTGIKGVATAMSIGIICMFLFVLVSHVRAVIRQDIMYPGKDEDVSE"
FT   gene            838664..839060
FT                   /locus_tag="ANIA_01473"
FT                   /old_locus_tag="AN1473.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(838664..838677,838868..838929,839023..839060)
FT                   /locus_tag="ANIA_01473"
FT                   /old_locus_tag="AN1473.4"
FT                   /note="transcript_id=CADANIAT00008090"
FT   CDS_pept        join(838664..838677,838868..838929,839023..839060)
FT                   /locus_tag="ANIA_01473"
FT                   /old_locus_tag="AN1473.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008090"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008090"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008090"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA7"
FT                   /protein_id="CBF84930.1"
FT                   /translation="MTRDFRTRVGAESRLEVDRPVRVGPGKPVKPSEPPPL"
FT   gene            complement(839525..840757)
FT                   /locus_tag="ANIA_01474"
FT                   /old_locus_tag="AN1474.4"
FT                   /product="RNA-3'-phosphate cyclase family protein
FT                   (AFU_orthologue; AFUA_8G04640)"
FT   mRNA            complement(839525..840757)
FT                   /locus_tag="ANIA_01474"
FT                   /old_locus_tag="AN1474.4"
FT                   /note="transcript_id=CADANIAT00008091"
FT   CDS_pept        complement(839525..840736)
FT                   /locus_tag="ANIA_01474"
FT                   /old_locus_tag="AN1474.4"
FT                   /product="RNA-3'-phosphate cyclase family protein
FT                   (AFU_orthologue; AFUA_8G04640)"
FT                   /note="transcript_id=CADANIAT00008091"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008091"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008091"
FT                   /db_xref="GOA:Q5BDA6"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR016443"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA6"
FT                   /protein_id="CBF84932.1"
FT                   /translation="MATTSQPPIKLTGHKNFVYRLVFSTLTGRTIHISQIRPSSPTNPG
FT                   LASHEISFLRLLEAVTNGSQMEISYTGTIIVYKPGLITGTASGVGASSGSVIRHEIPAG
FT                   CTRGVSYFLIPLCLLAPFSKAPIKVLFTGPGVITSSTPTGDMSVDSVRTAILPLFNQFG
FT                   IFNNIELRVLRRSNLGPNGRGGGGEVQLVFGHQVRLPKTLHLMNAGRIKRVRGVAYSVG
FT                   VSASNNARMIDTCRGVLNPLVPDTYIFSDVSSAPLVPAPERNNPSAKKKIGLGFGLSLV
FT                   AESSTGCLFSADVACPPSGGQPPEDIGKQCAYQLLETISKGGCVAPAAFPIMIGLMTMG
FT                   SEDVGRIQVGRDIIGDESSIQLARDLMKFGAPGWGLRDAGDESNDVIISVVGRGIGNVG
FT                   RKVA"
FT   gene            840949..842298
FT                   /locus_tag="ANIA_11252"
FT                   /old_locus_tag="AN11252.4"
FT                   /product="3-hydroxyanthranilate 3,4-dioxygenase Bna1,
FT                   putative (AFU_orthologue; AFUA_8G04650)"
FT   mRNA            join(840949..841024,841149..842298)
FT                   /locus_tag="ANIA_11252"
FT                   /old_locus_tag="AN11252.4"
FT                   /note="transcript_id=CADANIAT00008092"
FT   CDS_pept        join(840993..841024,841149..841701)
FT                   /locus_tag="ANIA_11252"
FT                   /old_locus_tag="AN11252.4"
FT                   /product="3-hydroxyanthranilate 3,4-dioxygenase Bna1,
FT                   putative (AFU_orthologue; AFUA_8G04650)"
FT                   /note="transcript_id=CADANIAT00008092"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008092"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008092"
FT                   /db_xref="GOA:C8VME6"
FT                   /db_xref="InterPro:IPR010329"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C8VME6"
FT                   /protein_id="CBF84934.1"
FT                   /translation="MLPPALNIPKWLEANSHLLQPPVNNYCVYHPSSPATSGYTVMIVG
FT                   GPNARTDYHINSTPEFFYQYRGSMLLKTVDTSTNPPTFQDIPIHEGSLFLLPANTPHCP
FT                   VRFKDTVGVVMEQPRPGNAEDAMRWYCRKEGCGEVVWEKRFVCTDLGTQVKEVVEEFAG
FT                   DEGKRTCKACGTIAESRFKEGEVVQPPKIPE"
FT   gene            complement(842209..844215)
FT                   /locus_tag="ANIA_01475"
FT                   /old_locus_tag="AN1475.4"
FT                   /product="Clip 170 homolog (Eurofung)"
FT   mRNA            complement(842209..844215)
FT                   /locus_tag="ANIA_01475"
FT                   /old_locus_tag="AN1475.4"
FT                   /note="transcript_id=CADANIAT00008093"
FT   CDS_pept        complement(842209..844215)
FT                   /locus_tag="ANIA_01475"
FT                   /old_locus_tag="AN1475.4"
FT                   /product="Clip 170 homolog (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008093"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008093"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008093"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR032108"
FT                   /db_xref="InterPro:IPR036859"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA5"
FT                   /protein_id="CBF84936.1"
FT                   /translation="MAPLDEIQVGDVVNVPGGMHGTVRFVGVVAGKPGRFAGIELAPEH
FT                   AKRGKNSGDVDGKKYFATAMPGSGIFVPLNNNKYVTRRTVSNPPTTPSRPVNFSKSVGP
FT                   GVSVPRPPRMRRPSLPRSESPRVTAPPKLSLSGLRTPSAASKTPTNGFSRSPVKAPSRA
FT                   SDRPPSRFSVEDGPTSARTSDYGRNSMGAEISDLKEQVKALEKQLLDRDQQLEEQANTL
FT                   SDFQRTLEELEGSDALSIRAQLREKNERIAQLTMEFDMHRADFRSTLDTLEVAASETER
FT                   VYEQRIDELMQQNKELQDRGEDVEAVARQLKQLEELVSELEEGLEDARRGEAEARAEVE
FT                   FLRGEVERTKLELKKERESSGLSRESRMSPDGHFSRELEQKDDEIRGLKAIIHSLSRGE
FT                   PDLHALQQNGFGARPDHNADHVADLEQRVQEYERANEHKTYRIEELERELQQLQANENG
FT                   RTRSSTVTQSNAQHKPTGSAGKISNGHTINHAHRLSDRTVVPGDWQDEAPQDGLYPAYP
FT                   SHGRGTSDTSARLETMHESDAQESDTRSEDGGSLWCEICETGGHDILSCTNMFGADAKN
FT                   NKPAPAPEEQPSHEDSSADEKPSAHSPSSSRSQNAPSQKTGRDVVLEGLRGVGLTSSMA
FT                   PVAGKASGIIDETKWCALCERDGHESIDCPFDD"
FT   gene            845543..846901
FT                   /locus_tag="ANIA_10193"
FT                   /old_locus_tag="AN10193.4"
FT                   /product="serine/threonine protein kinase, putative
FT                   (AFU_orthologue; AFUA_8G04670)"
FT   mRNA            join(845543..845662,845716..846325,846372..846901)
FT                   /locus_tag="ANIA_10193"
FT                   /old_locus_tag="AN10193.4"
FT                   /note="transcript_id=CADANIAT00008094"
FT   CDS_pept        join(845543..845662,845716..846325,846372..846901)
FT                   /locus_tag="ANIA_10193"
FT                   /old_locus_tag="AN10193.4"
FT                   /product="serine/threonine protein kinase, putative
FT                   (AFU_orthologue; AFUA_8G04670)"
FT                   /note="transcript_id=CADANIAT00008094"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008094"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008094"
FT                   /db_xref="GOA:C8VME8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C8VME8"
FT                   /protein_id="CBF84937.1"
FT                   /translation="MAQYFFDLLYNFTDCMCCFPSSPQLKINNRSFKLLRLLGEGGFSY
FT                   VYLVQDKSTSELFALKKIRCPFGQESVSQALKEVEAYSLFTSEKNIIHSIDHCVSTESG
FT                   SKFRSDGGEAGSKTVYILLPYYQRGNLQDAINANLVNQTRFPEKRLMVLMLGVAQALRA
FT                   MHQYRVKSGSGPTRKAKAVRKEGAEADVEMRKGKGKRRGSQPAGEEDSENEPLMDDEVT
FT                   QSQEGYEDGNLRPYAHRDIKPGNIMIDDDGQSPILMDLGSLAPSPIAITSRSLALAVQD
FT                   TAAEHSTMPYRAPELFDVKTGSIIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLS
FT                   MCVLGGDWRFPDEKSGATKGKGKASEQQKQDSAASISSPVKEVVRRCLQVEPADRPDID
FT                   ELIQMLKEVIRELPDDDVVG"
FT   gene            847440..849426
FT                   /locus_tag="ANIA_10207"
FT                   /old_locus_tag="AN10207.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_8G04702)"
FT   mRNA            join(847440..847639,847694..847901,847954..848118,
FT                   848163..848631,848646..848751,848799..848852,
FT                   848907..849426)
FT                   /locus_tag="ANIA_10207"
FT                   /old_locus_tag="AN10207.4"
FT                   /note="transcript_id=CADANIAT00008095"
FT   CDS_pept        join(847440..847639,847694..847901,847954..848118,
FT                   848163..848631,848646..848751,848799..848852,
FT                   848907..849426)
FT                   /locus_tag="ANIA_10207"
FT                   /old_locus_tag="AN10207.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_8G04702)"
FT                   /note="transcript_id=CADANIAT00008095"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008095"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008095"
FT                   /db_xref="GOA:C8VME9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8VME9"
FT                   /protein_id="CBF84939.1"
FT                   /translation="MLQTPIIDRDAIPGTFTLIDENHVLTTRHLDSGDRDIVLVPEPSD
FT                   DPDNPLNWSPRRKLLSTVCVSAYTLFAGIASANVYSVLTQLSEETKVSVNTLNEGTGYM
FT                   FLLAGWGLLFWQPLALQYGKRITYLLSLAGMVCTSAWGYVFYSLWSNHAKVDSPYVQSN
FT                   GEWIARSIITGFFLAPIEALPEVSVTDVYFTHERGTYMGLYAFFLAGSNYFAPVICGFI
FT                   AEYHGWRWVFYWPAIFCGAAMVVLFFLMEETNYARQRPSIADRAVEVSASENDNRKDNE
FT                   KDPMQSTPSTQSRSDPEVGVMYTKKAYMQKLSILGPHQARNNMLRRTWQTVYYLSWPVI
FT                   FYAGCVLTRLTFPRFSYGSYLIWFNVLNATASLILGSAPYGFSSSMVGLSYLACCLGVI
FT                   LGSLFTGRFSDYLTIKLARRNAGVMEAEHRLYPFSLCLILVPSSLILWGVGAAHGIHWF
FT                   GLLVAMCLLAIANTAGITLSVNYLVDSYRELSGDAMATVILVRNTMSFAIGYGITPWVE
FT                   RLGYRDCFVSAAFVGMACSAVFLVMVKWGKGCRVRSRERYWGVVEENWERGMGGGH"
FT   gene            complement(851283..852782)
FT                   /locus_tag="ANIA_01477"
FT                   /old_locus_tag="AN1477.4"
FT                   /product="beta-1,4-xylosidase (Eurofung)"
FT   mRNA            complement(join(851283..851452,851509..852782))
FT                   /locus_tag="ANIA_01477"
FT                   /old_locus_tag="AN1477.4"
FT                   /note="transcript_id=CADANIAT00008096"
FT   CDS_pept        complement(join(851283..851452,851509..852553))
FT                   /locus_tag="ANIA_01477"
FT                   /old_locus_tag="AN1477.4"
FT                   /product="beta-1,4-xylosidase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008096"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008096"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008096"
FT                   /db_xref="GOA:Q5BDA3"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA3"
FT                   /protein_id="CBF84941.1"
FT                   /translation="MPQSNPKPLISHLYTADPSAHVFNQKLYIYPSHDRESSIPFNDNG
FT                   DQYDMADYHVFSIDTLAPLTSTSTENVKVEVKDHGPVLKTEQVPWASKQLWAPDAAERN
FT                   GKYYLYFPARDHEGLFRIGVAVGNAPDGPFVAEETWLKGTFSVDPAVFVEDVRDGHEDQ
FT                   DGDGKEAYIYFGGLWGGQLEKWVRSEDGEEGGEGWVYDKDAKEPTGPGAPAREPLVAKL
FT                   SRSMTELASPVRPLVILDESGQPLAGDDHDRRFFEASWMHKYKGVYYFSYSTGDTHYLV
FT                   YATGSSPWGPFTYRGRILEPVLGWTTHHSIAEFEGRWWLFYHDCEISGGQSHLRNVKVR
FT                   EIGYKEDGRLGLCKTPSGTSSFMLEFNCPRQTGQGCIDSLLEFAAPRGISESGGATIRI
FT                   ATMNY"
FT   gene            complement(853194..854396)
FT                   /locus_tag="ANIA_10199"
FT                   /old_locus_tag="AN10199.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(853194..854396)
FT                   /locus_tag="ANIA_10199"
FT                   /old_locus_tag="AN10199.4"
FT                   /note="transcript_id=CADANIAT00008097"
FT   CDS_pept        complement(853194..854396)
FT                   /locus_tag="ANIA_10199"
FT                   /old_locus_tag="AN10199.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008097"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008097"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008097"
FT                   /db_xref="GOA:C8VMF1"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMF1"
FT                   /protein_id="CBF84943.1"
FT                   /translation="MDNHKKDKFSHCPESHPIPPRTPTLSPSRDEPNGLPLPDHIDEML
FT                   ENAQQSPIESEIMGERLHRAEQIEIEQQEGQPKLEPQSWCPPSSAGESRELPTAAAAID
FT                   HMIEHPRNSRCEAEEIRKLLQGRGEITRLAQQAKRIVSNTRNRWLAIGQHIHRDPKHQD
FT                   TLSEGLNRLEAVRQGIEDCTRRIEARLRQYHTQERQQRLRRRLQRRQQRRQVQQITSYL
FT                   QQSGFDLGLELSYDGPSQSASNSVLEFHPEFQNKIAHLARKLHPLVSYSTGLIHPYFPK
FT                   SVLAFNLLTSAQLDALALHFHQVYPPRRETFLYPLPIKPWLATNGFLRDLGVDTEVKRR
FT                   RFGRFIGLKGCESPVKTRSDEGSVVEQVERDWERRYRNALAVQMRNVEESYMFMDGLDN
FT                   V"
FT   gene            complement(854474..857229)
FT                   /locus_tag="ANIA_10198"
FT                   /old_locus_tag="AN10198.4"
FT                   /product="oligopeptidase family protein (AFU_orthologue;
FT                   AFUA_8G04730)"
FT   mRNA            complement(join(854474..856973,857037..857229))
FT                   /locus_tag="ANIA_10198"
FT                   /old_locus_tag="AN10198.4"
FT                   /note="transcript_id=CADANIAT00008098"
FT   CDS_pept        complement(join(854816..856973,857037..857068))
FT                   /locus_tag="ANIA_10198"
FT                   /old_locus_tag="AN10198.4"
FT                   /product="oligopeptidase family protein (AFU_orthologue;
FT                   AFUA_8G04730)"
FT                   /note="transcript_id=CADANIAT00008098"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008098"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008098"
FT                   /db_xref="GOA:C8VMF2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMF2"
FT                   /protein_id="CBF84945.1"
FT                   /translation="MTIRSMKFTPEVLLGAPRRSGAVPNSTGTLAVYTQTTYSFESHSK
FT                   TNEIRVLDLKTGRSALITNDPGASSPQWIDNTDQLIWLKSKGNGNTSLIIGDARQADRT
FT                   YTAGTVPGPVSDLKVTVIESGKIGFAVAGKSNPDGTLYNPQDAKAPHSTGKLYTSLFVR
FT                   HWDSYIEPQRNAIFFGLLQRAPLSPATRQAGKYSVSGITNLIAVCGLTGVESPIPPFGG
FT                   GGDFAVSPSAIVFVARDPDVNPALHTACSCYYCPMFSWTGVSAVESRICRVQGLEGAMS
FT                   SPVLSSDGSSIAVLAMRQDGYESDKNRILYVPNPWSGEMIEAFASANGKGLWNLSPSGL
FT                   TFSNDDNYLYIQAEEYGRGVLFRLPVANIRHSTPNMLKKITSSGYVTDVHPVTSKSSHL
FT                   LISSNSLVDNSIWTVVDPANPADAHVISSIGHGGAAFGLSAAQVDEIWYRGAEDTPIHA
FT                   WVVKPSNFRPGSKYPLAFLVHGGPQGAWNDQWSTRWNPAVFAEQGYVVITPNPRGSTGY
FT                   GQEFTDAIRGSWGGLPYIDLEKGFDYIEKNLKYVDTNRAVALGASYGGYMMNWIQGQPL
FT                   GRRFRALVTHDGVFSTTSLLATEELYFPLHDLKGVQWIVPENWAQWDPSRHLDKWQTPH
FT                   LIIHNEKDYRLTIAEGLSAFNVLQMKGIDSAFLTFPDENHWVLNPENALMWHYTIFNWI
FT                   NKHVGLPAASERFEQFSGNEKVALQNRLAKVSLSN"
FT   gene            complement(857323..864123)
FT                   /locus_tag="ANIA_10194"
FT                   /old_locus_tag="AN10194.4"
FT                   /product="pre-mRNA splicing helicase, putative
FT                   (AFU_orthologue; AFUA_8G04740)"
FT   mRNA            complement(join(857323..857965,858020..864123))
FT                   /locus_tag="ANIA_10194"
FT                   /old_locus_tag="AN10194.4"
FT                   /note="transcript_id=CADANIAT00008099"
FT   CDS_pept        complement(join(857443..857965,858020..864123))
FT                   /locus_tag="ANIA_10194"
FT                   /old_locus_tag="AN10194.4"
FT                   /product="pre-mRNA splicing helicase, putative
FT                   (AFU_orthologue; AFUA_8G04740)"
FT                   /note="transcript_id=CADANIAT00008099"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008099"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008099"
FT                   /db_xref="GOA:C8VMF3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMF3"
FT                   /protein_id="CBF84947.1"
FT                   /translation="MADQNISQYKYSAMSNLVLQADRRFISRVNDEATGDPESLAGRIS
FT                   IREMGSRIARDDAPKSKKKAVGPVDIERGAIREGEDVLAREQKKRQKGQPAQLRGQGIL
FT                   SAADALIEGLKYRPRTPATRATYDLILTLTASRLGDVSHEVVRSAADAVLEVLKDEEMK
FT                   DFDKKREIDDLLGTSLDPKEFNELVNLGKKITDYDAQDEDEEMGDGVTGEDEAELDERQ
FT                   GVAVVFDEDEDEDRMGTMDEIHDEDESDDEDEEQQESDSGEGAAKEAPEDLPTEEMVID
FT                   GGASADGEQQKKGLIVSARDIDAYWLQRQIGAAYSDAHIQQEKATQALEIMEGKTEDGS
FT                   PRSLRDVENDLMELFDYDFPDLVAKLVTNRDKVVWTTRWRRVAEDADARNLVESEMVEA
FT                   GHRGILDEIRGKTVSRDNDSGRPEKRIKMDLMDVDLPKAPAAAEEKKTADGGLVRGLQP
FT                   KRLINLENLVFHQGNHLMTNPNVKLPQGSTKRTFKGYEEIHVPQPKSKQEPGERKVAIS
FT                   ELPEWARIGFGDAKELNRIQTKCYPSAFQDDGNMLVCAPTGSGKTNVAMLSILREVGKN
FT                   RNSQTGEIMLDDFKIVYISPLKALVQEQVENFGRRLAPYGIKVAELTGDRQLTKQQIAE
FT                   TQVIVTTPEKFDVITRKASETSYTKLVRLIIIDEIHLLHDERGPVIESIVSRTIRQVEQ
FT                   TGDAVRIVGLSATLPNYRDVASFLRVDPAKGLFHFDGSYRPCPLKQEFIGVTDKKPIKQ
FT                   LKIMNDICYNKVIEHVGQNRNQMLIFVHSRKETAKTAKYLRDKALEMETIGQILKSDSA
FT                   SRAILAEEAESVNDAALKDILPYGFGIHHAGLSLADRDSVQALFKDGSIQVLVCTATLA
FT                   WGVNLPAHTVIIKGTQVYSPEKGSWVELSPQDVLQMLGRAGRPQYDTYGEGIIITTQAE
FT                   IQYYLSLMNQQLPIESQLVSKLADNMNAEIVLGNIRTRDEGVDWLGYTYLFVRMLRSPG
FT                   LYSVGADYENDDALEQKRVDLVHSAAVLLEKAGLVKYDKKTGRLQSTELGRIASHYYIG
FT                   HNSMLTYNQHLQPSIGNIELFRIFALSDEFKYIPVRQDEKLELAKMLGRVPVPVKEGID
FT                   EPHAKINVLLQAYISRLKLEGLALMADLVYVTQSAGRILRALFEICLRRGWASVAKNAL
FT                   DLCKMAERRMWPTMSPLRQFPRCPRDILQKSERIDVPWGSYFDLDPPRMGELLGMPRAG
FT                   KTVCDLVSKFPRLEVQAQVQPITRSMLRVELTITPNFVWDEELHGTAQDFWIMVEDCDG
FT                   EEILFHDQFVLRKDYAESEMNEHLVEFTVPITEPMPPNYFISLVSDRWMHSETRIAVSF
FT                   QKLILPERFPPHTPLLDMQRAPVKALKRDEYQRLYPDWEYFNKIQTQTFKTLFESDDNV
FT                   FIGAPTGSGKTVCAELAILRHWAKEDSGRAVYVAPFQELIDSRLEDWKKRLSGLAGGKS
FT                   IAKLTGEMTADLKILAGSDLVLATPTQWDVLSRQWQKRKNVRAVELFVADELHMLGGYG
FT                   GYVYEVVVSRMHSIALQTESGMRIVGLSVPLSNARDIGEWIGASKHTIYNFSPHARPVP
FT                   LELHIQSFSIPHFPSLMLAMARPAYLSILQLSADKPALIFVPNRKQTRATAIDLLTACS
FT                   IDDDEDRFLHADIEELQPLLGRVHERTLAESLSHGIGYYHEALSQTDKRIVSHLYNIGA
FT                   IQVVIASRDVCWELNLTGHLVVVMGTQFFEGREHRYIDYPISEILQMFGKASRPGQDKV
FT                   GRGVLMVPTVKREYYKKFLNEALPVESHLQLYMHDAFVTEISQGTIASTQDSVDWLTYT
FT                   YFYRRLLANPSFYGLTDISHEGLSTFLSELVENTLKELSEAKIIDLDEEDDSVSPLNAA
FT                   SIGAYYNISYITMQTFLLSLSARTKLKGILEIVTAATEFESVQMRRHEEHILRRVYDRV
FT                   PVKTSQVAFDSPHFKSFVLLQAHFSRMQLPIDLAKDQEVIVSKALNLLSACVDILASEG
FT                   HMNAMNAMEMSQMVVQAMWDRDSPLKQIPHFGPEAIKVANEYNINDIFEFMDAMDPSEN
FT                   KDYNTLVKRLNLDNKQLAQAAAFTNNKYPILELDFEVEDPENITAGEPAYLKIKVEREV
FT                   DEDEEFDTTVHAPFYPGQKMENWWLVVGDEKTRNLLAIKRVTIGRKLELRLDYTVPTPG
FT                   EHELTLYLMCDSYVGVDQAPTFTVRAAEGMEEDESEEEE"
FT   gene            864548..867579
FT                   /locus_tag="ANIA_01479"
FT                   /old_locus_tag="AN1479.4"
FT                   /product="DNA-binding protein of the mitochondria
FT                   (Eurofung)"
FT   mRNA            join(864548..864907,864952..865741,865955..867579)
FT                   /locus_tag="ANIA_01479"
FT                   /old_locus_tag="AN1479.4"
FT                   /note="transcript_id=CADANIAT00008100"
FT   CDS_pept        join(864548..864907,864952..865741,865955..867579)
FT                   /locus_tag="ANIA_01479"
FT                   /old_locus_tag="AN1479.4"
FT                   /product="DNA-binding protein of the mitochondria
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008100"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008100"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008100"
FT                   /db_xref="GOA:Q5BDA1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA1"
FT                   /protein_id="CBF84949.1"
FT                   /translation="MPVNGSRLPYLVQSQARSLARPNTILPYRCLVHRTICHHAQPRRV
FT                   AAPQLTTVFHNQRRSAKTKSTVKLKDLPQGAVKLEPYQDVVEDTPRYPTVVQGHRNNMQ
FT                   KFKNCVVLTRVGGFYELYFEQAEELAPLLNLKLATKKTSAGPVPMAGFPFFQLDRFLKI
FT                   LVQDLNKFVAISEEFAISAEEKARSGMLFDRKVARVITPGTLIDEKFMDPSENNFLMAI
FT                   YLNPSDLGMHARGSDESSYQHILTSASQNVGLAWLDLSTGDFYTQSTTAQMLPSAIARI
FT                   GAREILVDQRLQDLAGQELQLLIGHEHRLMTCFSFPEKISPVSDWASMLEAPLPSTSID
FT                   AFSQEEVAAGYSLLEYIRVQLQGLNLKLQPPRRRHLNESMSIDLQLLKRSYDAQRLVQK
FT                   FTLGKGDADDLICLSKSIEASKNVKRLLSAASNASSEYSRKSLQKMVDQLYLDGPTLLA
FT                   DKILSAIDEEGLLQKQRIEEDTAAEAAILAQEVTLNEGAAADLASLPKKVREKTTERTA
FT                   TDESSPDETWIMRRDASPALKELHRTLDELQNEKSKLGQYLRDSVGSSAITLKWTPGLG
FT                   HICHVKGAKVSQQQLEDIGVTRNVSSTKSTRSFYLPAWTELGGRMDQIKVQIRQEEQAI
FT                   FEQLRREVILNLVKIRRNASVMDELDVACSFATLAAEQQLVRPILTEGTNYKIIGGRHP
FT                   TVKLGLEEQGRRFVSNDCFLGESERIWLITGPNMAGKSTFLRQNALITILAQVGSFVPA
FT                   DYAEIGIVDQIFSRIGAADDLFRDQSTFMVEMLETAAILKQATARSFVIMDEVGRGTTP
FT                   EDGTAVSFACLHHLHYRNQCRTLFATHFHGLADMTQEFPALGRYCTDVKETTEGRFSFV
FT                   HKLRKGINRESHALKVAQLAGLPSETLELARSVRDSIRGEASRLTTAAFSSAS"
FT   gene            complement(867684..868451)
FT                   /locus_tag="ANIA_01480"
FT                   /old_locus_tag="AN1480.4"
FT                   /product="ureidoglycolate hydrolase, putative
FT                   (AFU_orthologue; AFUA_8G04760)"
FT   mRNA            complement(867684..868451)
FT                   /locus_tag="ANIA_01480"
FT                   /old_locus_tag="AN1480.4"
FT                   /note="transcript_id=CADANIAT00008101"
FT   CDS_pept        complement(867684..868451)
FT                   /locus_tag="ANIA_01480"
FT                   /old_locus_tag="AN1480.4"
FT                   /product="ureidoglycolate hydrolase, putative
FT                   (AFU_orthologue; AFUA_8G04760)"
FT                   /note="transcript_id=CADANIAT00008101"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008101"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008101"
FT                   /db_xref="GOA:Q5BDA0"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDA0"
FT                   /protein_id="CBF84950.1"
FT                   /translation="MPPPTLLASPSLSITPEPLTRDAFAPFGTAVIPPLPRSVTTAPNP
FT                   LSSHPKHPLVTFPVAANQLSALKYSPISPLINNYPSQCPSNQPSEARMSMFSCFPRTLR
FT                   AVTSTGEGKVGGAQKVVFDVGILERHPYTSQTFSPLGLSSDDKSAYYLVIVAPTLLGQT
FT                   ATARTEAGESVSIRDPPNLSKLRAFVASGEHAVTYGPGTWHAPMVVVGECKVDFVVTQF
FT                   VNGVAAEDCQEVCFGEGIVVDLSERQQRAQAKL"
FT   gene            complement(869728..871665)
FT                   /locus_tag="ANIA_01481"
FT                   /old_locus_tag="AN1481.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_5G14490)"
FT   mRNA            complement(join(869728..870456,870515..870974,
FT                   871024..871361,871421..871665))
FT                   /locus_tag="ANIA_01481"
FT                   /old_locus_tag="AN1481.4"
FT                   /note="transcript_id=CADANIAT00008102"
FT   CDS_pept        complement(join(869728..870456,870515..870974,
FT                   871024..871361,871421..871612))
FT                   /locus_tag="ANIA_01481"
FT                   /old_locus_tag="AN1481.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_5G14490)"
FT                   /note="transcript_id=CADANIAT00008102"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008102"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008102"
FT                   /db_xref="GOA:Q5BD99"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD99"
FT                   /protein_id="CBF84952.1"
FT                   /translation="MVSATAPEIQMDEIASQTAPSQRGSENKPEECITQARCSSHTVEH
FT                   EAPKSRGSWRIGAILIALALSLFISALDQTIVATATPTISADLHSGGGYVWIGGAYLLA
FT                   NAASGNIWANLSDIWGRKPILLLAVALLFVSSIVCATAVDMAMLIVGRSFQGVAGGGLI
FT                   QLILITISDLFSVRLRSLFMGLMECTWTVAGALGPVLGGVFTESISWRWIFWINLPVCG
FT                   TAFVLLILFLDVHNPRTPMLEGIKAVDWFGSLSILAISVMILLGLDFGGDTFPWDSPKV
FT                   ICLIVFGALMSVAFIYSEKRLAKYPLMPLHIFTSRSNIACFLVDFTHGFAFLGAEYYLP
FT                   LYFQSAKAASPFHSGLLILPFILTESFTSLAVGIVIHRTGRYQEVIWLGMALVLLGTGL
FT                   FIDYSTSTSLGKIIGYQIISGFGCGLLFFPPLLALQSNIPTKDTATATATFGFVRNVAM
FT                   ALSVVLGGVVFQNSMGLKRDLLEDAGLSSALQEDFTGAEAAANALAVKDITDSLQREAV
FT                   ETAFAWSIRNIWILYTALAAVGLVASFFITKRQLSKEHVETKTGLKEKEKNTAEV"
FT   gene            872468..874819
FT                   /locus_tag="ANIA_01482"
FT                   /old_locus_tag="AN1482.4"
FT                   /product="acetoacetyl-CoA synthase (AFU_orthologue;
FT                   AFUA_8G04770)"
FT   mRNA            join(872468..872575,872624..874112,874201..874541,
FT                   874630..874771,874803..874819)
FT                   /locus_tag="ANIA_01482"
FT                   /old_locus_tag="AN1482.4"
FT                   /note="transcript_id=CADANIAT00008103"
FT   CDS_pept        join(872468..872575,872624..874112,874201..874541,
FT                   874630..874771,874803..874819)
FT                   /locus_tag="ANIA_01482"
FT                   /old_locus_tag="AN1482.4"
FT                   /product="acetoacetyl-CoA synthase (AFU_orthologue;
FT                   AFUA_8G04770)"
FT                   /note="transcript_id=CADANIAT00008103"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008103"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008103"
FT                   /db_xref="GOA:Q5BD98"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD98"
FT                   /protein_id="CBF84954.1"
FT                   /translation="MAAEIPRKLWEHPNPRATAMWAFKESLEKEKNVSLPTYYDLYTWS
FT                   VTNRAAFWDFSWRYFPIIHEGSYTIVVDESARIDSIPSWFKGVRLNFAENMLFTAEKSP
FT                   AGTQLITTAGKEDSKIVATQVREGAAEPAISVTWSQLRQRTGKLLQALKAAGLAKGDRV
FT                   AVVASNSIDTLVVFLATTALGGLFSSASTDTGVKGILDRLVQIKPKFVFFDDAAVYNGK
FT                   HIDLRPKITDVINGLKDTSEFKSLITLPRFPDHPVDVTSLPKTQPLAQLLATAPSDKLE
FT                   FVRVGFRDPFLVAFSSGTTGKPKPIVHGVGGYLLNSNKESRLHRSHGPNSVTLQFTTTG
FT                   WIMYMSAISGLLFGGHTILYDGSPFFPNPKILIRLLGRYRVTHFGTSPRYLHELRKNGI
FT                   SPRTEEDLRSLVGVTSTGMVLPDSLAEWFYDAGFPPHVQLANISGGTDLAACFGLENPI
FT                   TPLYLGGCQGLPLGIPVEVYDQADEGASGVKGTPVPDGIPGELVATAAFPTMPVKFLGE
FT                   DGEKKYFDSYFARFDNVWTHGDFISIHPITKQIFFLGRSDGVLNPSGIRFGSAEIYNVI
FT                   ETQFANEIVDSLAVGQRRPQDSDESVILFLLMKPGFKVTKALIERVKEAIRKALSARHV
FT                   PKYVFETPEIPTTVNLKKVELPVKQIVSGKKIKPSGTLLNPESLEYYYQFADVERLAET
FT                   VSAS"
FT   gene            complement(875188..876366)
FT                   /locus_tag="ANIA_01483"
FT                   /old_locus_tag="AN1483.4"
FT                   /product="peroxisomal membrane protein (PmpP24), putative
FT                   (AFU_orthologue; AFUA_8G04780)"
FT   mRNA            complement(join(875188..875231,875300..875510,
FT                   875567..875780,875882..875908,875973..876088,
FT                   876140..876366))
FT                   /locus_tag="ANIA_01483"
FT                   /old_locus_tag="AN1483.4"
FT                   /note="transcript_id=CADANIAT00008104"
FT   CDS_pept        complement(join(875188..875231,875300..875510,
FT                   875567..875780,875882..875908,875973..876088,
FT                   876140..876154))
FT                   /locus_tag="ANIA_01483"
FT                   /old_locus_tag="AN1483.4"
FT                   /product="peroxisomal membrane protein (PmpP24), putative
FT                   (AFU_orthologue; AFUA_8G04780)"
FT                   /note="transcript_id=CADANIAT00008104"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008104"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008104"
FT                   /db_xref="InterPro:IPR019531"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD97"
FT                   /protein_id="CBF84956.1"
FT                   /translation="MDALVSRLDALVTNADLAPLLSLVKGIRNGAVYGAKVRFPHALVM
FT                   IFLFRSGTIREKVKLVLNATRQHARNLAVFCFIYKSSMIVLRNLNPAGVGKEGHYDSFL
FT                   AGLLGGYAVFGRHKSSITQQIVIYIFARVVLGFAKLSVQPGMHPLSSLIGPEARKQIES
FT                   NAWAVFASLSWASVMYLFRWHPEVLMSSLRSNIPTQITGTRSATS"
FT   gene            complement(876522..877643)
FT                   /locus_tag="ANIA_10200"
FT                   /old_locus_tag="AN10200.4"
FT                   /product="ribosome biogenesis protein, putative
FT                   (AFU_orthologue; AFUA_8G04790)"
FT   mRNA            complement(join(876522..877512,877621..877643))
FT                   /locus_tag="ANIA_10200"
FT                   /old_locus_tag="AN10200.4"
FT                   /note="transcript_id=CADANIAT00008105"
FT   CDS_pept        complement(join(876531..877512,877621..877634))
FT                   /locus_tag="ANIA_10200"
FT                   /old_locus_tag="AN10200.4"
FT                   /product="ribosome biogenesis protein, putative
FT                   (AFU_orthologue; AFUA_8G04790)"
FT                   /note="transcript_id=CADANIAT00008105"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008105"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008105"
FT                   /db_xref="GOA:C8VMF9"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="InterPro:IPR039770"
FT                   /db_xref="PDB:4XD9"
FT                   /db_xref="PDB:5BY8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMF9"
FT                   /protein_id="CBF84958.1"
FT                   /translation="MLREVKPKNPRTARILKAKEPQLIEGAKRVLLLHGSKCPTPLHTV
FT                   LKVFHSLTTPHSVLFHKKNENIHPFESTESLEFLANKNDCGMVIFGSSNKKRPNCLTIA
FT                   RIFDSKVLDMAELLLLPDANGEGIPEMNRLSMHVAIGLRPLMLFSGSAWDDTTSTTHTM
FT                   LKSMLVDLFKGETSDKIDVEGLQYALMVGAEEPTAGLAPIIHLRWYKIVTKRSGHKLPR
FT                   VELEEIGPKLDFKVGRIQEAPRDVMKEAMKQGKKPNEEIKNKKNIGIDLIGDKVGRVHL
FT                   AKQDLGGLQTRKMKGLKRRAGVESDDEGDADMMDVDEVSEDEKTKRARHD"
FT   gene            complement(877842..881343)
FT                   /locus_tag="ANIA_10195"
FT                   /old_locus_tag="AN10195.4"
FT                   /product="valyl-tRNA synthetase (AFU_orthologue;
FT                   AFUA_8G04800)"
FT   mRNA            complement(join(877842..878893,878949..880043,
FT                   880096..880956,881039..881146,881212..881343))
FT                   /locus_tag="ANIA_10195"
FT                   /old_locus_tag="AN10195.4"
FT                   /note="transcript_id=CADANIAT00008106"
FT   CDS_pept        complement(join(877887..878893,878949..880043,
FT                   880096..880956,881039..881146,881212..881242))
FT                   /locus_tag="ANIA_10195"
FT                   /old_locus_tag="AN10195.4"
FT                   /product="valyl-tRNA synthetase (AFU_orthologue;
FT                   AFUA_8G04800)"
FT                   /note="transcript_id=CADANIAT00008106"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008106"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008106"
FT                   /db_xref="GOA:C8VMG0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMG0"
FT                   /protein_id="CBF84960.1"
FT                   /translation="MAQDSASMNPTGEPTGPKVDVPPVGNNGQQNAGQDGAAPKVKTEK
FT                   ELERERKKAEKLKKFQEKQAKAAAKTTTPKAEKKAPKVEKDKTADAYDPKVIEAGRYQW
FT                   WEERGLFKPEFGPDGKVKPEGYFVIPIPPPNVTGSLHMGHALTNALQDTMIRWQRMKGK
FT                   TTLWLPGMDHAGISTQSVVEKMLWKKEKKTRHDLGRKAFLERVWDWKHEYHGNIGNALR
FT                   RVGGSFDWTREAFTMDDNLSAAVTETFVRLHEEGIIYRANRLVNWCVALNTSLSNLEVE
FT                   NKEVEGRTLLDVPGYEKKVEFGVLTHFCYEIDGTKERIEIATTRPETMIGDTAARHPFI
FT                   DRLLPIVADPEVDPEFGTGAVKITPAHDFNDFNRGKAHNLEFISVLNDDGTFNKNGGPF
FT                   AGMKRFDARYKVIEMLKEKGLYVKWEHNPMKIPRCAKSNDVIEPILKPQWWMKMESLAE
FT                   PAIKAVENGEIIIRPESAEKSYFRWLRGINDWCLSRQLWWGHQAPAYFVQIEGEEGDDS
FT                   DGNLWVTGRNEEEAQKKAEAKFPGKKFTLKRDEDVLDTWFSSGLWPFSTLGWPRQTHDF
FT                   ENLYPTSVLETGWDILFFWVARMIMLGIKMTGKVPFKEVYCHSLIRDSEGRKMSKSLGN
FT                   VIDPLDVMEGIKLEDLHAKLLVGNLAEKEVATATKYQKKAFPKGIPECGADALRFSLVS
FT                   YTTGGGDIAFDIQVIHGYRKFCNKIYQATKYVLGKLGDDFKPLPTPTKTGKESLSERWI
FT                   LHKFNAAAKEVNIALEDREFSHAASTVYQYWYSQLCDVFIENSKSLLAPELPQEVQESA
FT                   KQTLYTALEGALTMIHPIMPFITEELWQRLPRRPGDNTISIMKAKFPEYKAEFDDSTAE
FT                   TAYELILNTSKAIRSILAQYDVKTKGDVIVQTYDATSHKTVSDELHIVKSLGGKTLGEL
FT                   SVLGPENTTPPSGCVVAPVGSQAAVYLRVSKEVALEQEEKGKASLKKAQETVRRQTTLI
FT                   NSAGWKEKAKPEVREQEEKKLRDAESEVARLEEQIREFEKLRLE"
FT   gene            complement(882347..883723)
FT                   /locus_tag="ANIA_01485"
FT                   /old_locus_tag="AN1485.4"
FT                   /product="casein kinase II (Eurofung)"
FT   mRNA            complement(join(882347..882439,882493..882912,
FT                   882961..883334,883396..883723))
FT                   /locus_tag="ANIA_01485"
FT                   /old_locus_tag="AN1485.4"
FT                   /note="transcript_id=CADANIAT00008107"
FT   CDS_pept        complement(join(882347..882439,882493..882912,
FT                   882961..883334,883396..883510))
FT                   /locus_tag="ANIA_01485"
FT                   /old_locus_tag="AN1485.4"
FT                   /product="casein kinase II (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008107"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008107"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008107"
FT                   /db_xref="GOA:Q5BD95"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD95"
FT                   /protein_id="CBF84962.1"
FT                   /translation="MARVYADVNKHMPRSYWDYDSVNISWGVLENYEVVRKIGRGKYSE
FT                   VFEGINIVNYQKCVIKVLKPVKKKKIKREIKILQNLAGGPNVVALLDVVRDNQSKTPSL
FT                   VFEYVNNTDFRTLYPRFSDYDVRFYIYELLKALDFCHSKGIMHRDVKPHNVMIDHEKRK
FT                   LRLIDWGLAEFYHKGTEYNVRVASRYFKGPELLVDFQEYDYSLDMWSLGAMFASMIFRK
FT                   EPFFHGNSNSDQLVKIAKVLGTEELFEYLDKYEIELDPQYDEILSRFPRKPWQSFVNAE
FT                   NQRFISDEAIDFLDKLLRYDHAERLTAQEAMAHPYFAQIRAEEAANRSTASS"
FT   gene            883988..885224
FT                   /locus_tag="ANIA_01486"
FT                   /old_locus_tag="AN1486.4"
FT                   /product="ribonuclease P complex subunit Pop2, putative
FT                   (AFU_orthologue; AFUA_8G04820)"
FT   mRNA            join(883988..884063,884159..884169,884204..885224)
FT                   /locus_tag="ANIA_01486"
FT                   /old_locus_tag="AN1486.4"
FT                   /note="transcript_id=CADANIAT00008108"
FT   CDS_pept        join(883988..884063,884159..884169,884204..885037)
FT                   /locus_tag="ANIA_01486"
FT                   /old_locus_tag="AN1486.4"
FT                   /product="ribonuclease P complex subunit Pop2, putative
FT                   (AFU_orthologue; AFUA_8G04820)"
FT                   /note="transcript_id=CADANIAT00008108"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008108"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008108"
FT                   /db_xref="GOA:Q5BD94"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD94"
FT                   /protein_id="CBF84964.1"
FT                   /translation="MYYDLNVPYSPGDPEISATLSFLAEPNLTTINGKLPPNPTPPPLP
FT                   SDAPKDLTLLTRLNIPLSDPAQNQRLTSIAQAYDLVAVRPTNEKALLNACTNAECDIIS
FT                   LDLSIRHPYHFKFKMLSAAIARGIRFEICYGPGVTGSGLEARRNLIGNAMALIRAARGR
FT                   GIIVSSEAKRALGVRAPFDVINLACVWGLSQELGKEAISAETRKVTALARLKRTSWRGI
FT                   IDVVDGGQIPPASEAAASVAIVKDTGAKLNADNNGDNLKRKASTGPEPDADGPEKPLSK
FT                   REMKRRAKKARLEAALAGTDDSPAT"
FT   gene            complement(886076..888551)
FT                   /locus_tag="ANIA_10201"
FT                   /old_locus_tag="AN10201.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(886076..886651,886712..888551))
FT                   /locus_tag="ANIA_10201"
FT                   /old_locus_tag="AN10201.4"
FT                   /note="transcript_id=CADANIAT00008109"
FT   CDS_pept        complement(join(886147..886651,886712..888246))
FT                   /locus_tag="ANIA_10201"
FT                   /old_locus_tag="AN10201.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008109"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008109"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008109"
FT                   /db_xref="GOA:C8VMG3"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMG3"
FT                   /protein_id="CBF84965.1"
FT                   /translation="MTSTAPTNQQHPPSGPSSEFSGNQPPASSGADQSTHISTSGYAPS
FT                   ENQLAGLVEAATAAAGQDVSEWAAAAAVAAAAGAAGNQHHLDGYAPDIQLDEDGFDEGG
FT                   YAGMTGARHYRGPGSTSGNEHGQSSGLARSGTKKRKRNEDALDPALAAASASLGQHHGQ
FT                   PQHQNQSQHHVHHASPYPGEGLEIRNTPPQTLADARAVGLHSAAALFRQTSTNKKYTRP
FT                   PMSKMFTSLELSPENFLHLQAAAKAYMLDDRHPERRDCVGQRGKGDTEMVKLRLWNCVR
FT                   HFLEVEGNGPRFFGEHVVNEGMPPRTYVWPRDQQKIISLVIPLLRRMVTNERQRQYAVE
FT                   TRKGGVEARRRRKTEDSIQDFRSASPPKFSSEDHLQMQADHQLPDGYSSTQHPLSASAP
FT                   PPPHSEPSVQVTELGLTDLILDGYSTDLDSISKSYDSYNHNYELDNLWSLSGLHLGDWR
FT                   GLVAAVDSHYQILHEGDYNCSGCCEDGNIGRILNSTSTADLRWRIGGDPARNEFASSIT
FT                   RDVSRVIRDNLAARQGAQNHTSLPQTQPIPPPLPFSHSSDLSNPNPPPAQSPLRLRINI
FT                   LQNGKRILPSYDLPATQGPDVTTVRQLVARKFAGELPGIPSDLNSDSNTWNASISWKFK
FT                   VWLPEGLVLIENDGDWTLALLAAEKVDWLDGELKVLVEIEDENQ"
FT   gene            complement(888718..890448)
FT                   /locus_tag="ANIA_10196"
FT                   /old_locus_tag="AN10196.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(888718..890170,890347..890448))
FT                   /locus_tag="ANIA_10196"
FT                   /old_locus_tag="AN10196.4"
FT                   /note="transcript_id=CADANIAT00008110"
FT   CDS_pept        complement(888915..890129)
FT                   /locus_tag="ANIA_10196"
FT                   /old_locus_tag="AN10196.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008110"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008110"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008110"
FT                   /db_xref="GOA:C8VMG4"
FT                   /db_xref="InterPro:IPR021838"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMG4"
FT                   /protein_id="CBF84967.1"
FT                   /translation="MATTRRFVPLLGCGFFFFCLWGLFSLSRSWTQMKVSQAVGLGELV
FT                   STPSPTPSGYWNVTEGPKQPFAPRPQYVAGIARPDGHEYTKTLVIPRTTYEDTSWTEFE
FT                   IPGWETAVYVVDDPSAPLHPPKNKGHEVMVYLSYIIEHYDELPEIIAFMHSHQFGWHND
FT                   DLLDGNAATILQRLRPERVIREGYMNLRCGWGPGCPDWLHPGTLEEDESKQEEILLARS
FT                   WGEIFPDDPIPDVLAQPCCAQFAVSRERVHAIPRARFVFYRDWVLRTELSDYISGRIWE
FT                   YLWHVIFTGQNVVCPKEHVCFCDGYGICFGGEDEYNAYRNMDSEREAWEDELKRWRSRA
FT                   AVIESARRRGTLGEKSHLSVPEPGRDIELEELIARHGELKEELLLNATIRGQDAKARAL
FT                   EVGIW"
FT   gene            complement(891083..893810)
FT                   /locus_tag="ANIA_01488"
FT                   /old_locus_tag="AN1488.4"
FT                   /product="RING finger protein (AFU_orthologue;
FT                   AFUA_8G04840)"
FT   mRNA            complement(join(891083..893415,893477..893581,
FT                   893638..893810))
FT                   /locus_tag="ANIA_01488"
FT                   /old_locus_tag="AN1488.4"
FT                   /note="transcript_id=CADANIAT00008111"
FT   CDS_pept        complement(join(891217..893415,893477..893581,
FT                   893638..893661))
FT                   /locus_tag="ANIA_01488"
FT                   /old_locus_tag="AN1488.4"
FT                   /product="RING finger protein (AFU_orthologue;
FT                   AFUA_8G04840)"
FT                   /note="transcript_id=CADANIAT00008111"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008111"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008111"
FT                   /db_xref="GOA:Q5BD92"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024766"
FT                   /db_xref="InterPro:IPR032832"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD92"
FT                   /protein_id="CBF84968.1"
FT                   /translation="MRFAAYAGASVALATGVFLKALHQRANFYSACVYLSQSSANLMIL
FT                   TNVCLLAVGFLLFWLQRLLYGPLRPIETEQLYEKAWFAVTETCLAMTIFRGELGAWFLV
FT                   MFVSLLVGKVWGWIGEGRVEFLEQQPPANPLLFHTRLVVSLLLSVMFDIFMLKYCIDTV
FT                   LEQARPDMMVMFGFEFAVLTILSTSTAARYSISLVEIYINRQQMKARIEERRQEIRAAR
FT                   EQALAEHAATEDQTANLDLPDENDINELELDIPGWEEKGRWVFYLDLLTDFLKLTVYLT
FT                   FFAILFTFYGLPIHILRDVVVTIRSFGRRIMDFARYRNATRDMNDRYPDASAEEVAREE
FT                   VCIICREEMTHWQPGDRPVSRVSERLRPKKLPCGHILHFSCLRSWLERQQNCPTCRRPV
FT                   IAPPRNQGPAGVNMGQGNGGAGQQQNMPPGNQPVNQNPPADGLPRARIYQFGPFRIGFG
FT                   AGRGDLFNNLHQQIHQGNGPWQPGMNPNPAGARQIGFGFGFGRPPLQQAPAPAAPAATQ
FT                   PVPTPTSNLPNLQNQLLQMEQQIANEINGLRIAADQLNLVRLLQTELQRLRTLQSQPLN
FT                   NQTNIPQNPSPSIPSISPTTTRPRIVSNPETAPMGAGDPRLPDGLTLPQGWTLVPLHSV
FT                   QPGLSASSNVAANASSSEAEHSAPPSEGMLNSQVPTDTESQRPSDRSDAATSGSSGLPN
FT                   WQSSPFSHSAADSTGAISQQSENLSSEAGLRAPLAPSKTEQVETPLSEHGAETRIETQT
FT                   SDSRSKGKERVATVEDAADDET"
FT   gene            894221..895872
FT                   /locus_tag="ANIA_01489"
FT                   /old_locus_tag="AN1489.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_8G04850)"
FT   mRNA            join(894221..894472,894523..895872)
FT                   /locus_tag="ANIA_01489"
FT                   /old_locus_tag="AN1489.4"
FT                   /note="transcript_id=CADANIAT00008112"
FT   CDS_pept        join(894221..894472,894523..895872)
FT                   /locus_tag="ANIA_01489"
FT                   /old_locus_tag="AN1489.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_8G04850)"
FT                   /note="transcript_id=CADANIAT00008112"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008112"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008112"
FT                   /db_xref="GOA:Q5BD91"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD91"
FT                   /protein_id="CBF84970.1"
FT                   /translation="MASQRSMFSASRIQVSTYLLAVCPFSIAFLVFINSSISFVVTDLI
FT                   GLHEGEGDAVGTLGFADELLALAACPLWGVLSDRIGVRQICTAGYTIIAVALILFVQAR
FT                   NVYPQLLLGRLLFSIGGAAVSTMVTAILPAVTGRSPRTELEEEPEPRTIVAPSSRLAGF
FT                   VGTCAGCGALISLVVLLPLPAQFQQWGLSPAKSIQYSYYTAAALALVVSGCCFVGLRNL
FT                   PGEDGKAWTSLWSPLRTEPRSFEPRKNFYSTLLSRFPYLKQFGSAIKLGLRNRDILIGY
FT                   IGGFVARASSVGISLFIPLFVNSYYHKTGLCDGQSAEGANPGDIKRSCPKAYVLASILT
FT                   GVSQLIALIAAPAFGYLSEKPRRYHLPLIVACLAGVVGYLLLALAPSPEFKGERGNPGI
FT                   FVVMALVGISQIGAIVCSLSVLSNGILSLTNSVEAAETVAGNSRAPTTGPQFDEQQPLL
FT                   AADRKQPQPSDLKGSIAGIYSLFGGAGILLLTKLGGILFDVLSSDAPFYIMAGFNGVLM
FT                   IACVVSGLIITLEASQ"
FT   gene            896389..897479
FT                   /locus_tag="ANIA_01490"
FT                   /old_locus_tag="AN1490.4"
FT                   /product="GPI anchored glycoprotein, putative
FT                   (AFU_orthologue; AFUA_8G04860)"
FT   mRNA            join(896389..896683,896752..896885,896945..897479)
FT                   /locus_tag="ANIA_01490"
FT                   /old_locus_tag="AN1490.4"
FT                   /note="transcript_id=CADANIAT00008113"
FT   CDS_pept        join(896555..896683,896752..896885,896945..897377)
FT                   /locus_tag="ANIA_01490"
FT                   /old_locus_tag="AN1490.4"
FT                   /product="GPI anchored glycoprotein, putative
FT                   (AFU_orthologue; AFUA_8G04860)"
FT                   /note="transcript_id=CADANIAT00008113"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008113"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008113"
FT                   /db_xref="GOA:C8VMG7"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMG7"
FT                   /protein_id="CBF84971.1"
FT                   /translation="MRPQTVRSLALLGGFSFAAANDIVSLILPAADEQELVGEVIGSAG
FT                   PTTTYRISCPDTVDEDECGMPTSGLTVAAAPTAFVYEYSYEDYYLRESCKHSGTTWFSC
FT                   LVTNTQSDFSFVTSTTIDEVLPYMAVTITSTAAGADAEATSSATSTSTKASDADADAET
FT                   KTNSESLSTTLSGSASVTAASSESPSSSTAAADPEETTSDNAAMPQVTGSAAQWIVSGA
FT                   GMALALALA"
FT   gene            complement(900232..902148)
FT                   /locus_tag="ANIA_01491"
FT                   /old_locus_tag="AN1491.4"
FT                   /product="COP9 signalosome complex subunit 1 (CSN complex
FT                   subunit 1) [Source:UniProtKB/Swiss-Prot;Acc:Q5BD89]"
FT   mRNA            complement(join(900232..901260,901313..901593,
FT                   901653..901697,901746..902148))
FT                   /locus_tag="ANIA_01491"
FT                   /old_locus_tag="AN1491.4"
FT                   /note="transcript_id=CADANIAT00008114"
FT   CDS_pept        complement(join(900232..901260,901313..901593,
FT                   901653..901697,901746..901887))
FT                   /locus_tag="ANIA_01491"
FT                   /old_locus_tag="AN1491.4"
FT                   /product="COP9 signalosome complex subunit 1 (CSN complex
FT                   subunit 1) [Source:UniProtKB/Swiss-Prot;Acc:Q5BD89]"
FT                   /note="transcript_id=CADANIAT00008114"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008114"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008114"
FT                   /db_xref="GOA:Q5BD89"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR019585"
FT                   /db_xref="InterPro:IPR033008"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD89"
FT                   /protein_id="CBF84973.1"
FT                   /translation="MEPMLPEAGEAALLSSYAPQASGSMGVDPDPITGLVSTSAAPLVR
FT                   VEEAPKFELESYIANYTGRTRFNRLYLIGTCSSYLAVDALKAAIAEAKSGKDVARYLRA
FT                   VQALADVAPNEPEATIDSDWVERSQKVVKAETDRLEHELRGYKNNLIKESIRMGNEELG
FT                   QHYHRIGDLTSAFKAYSRMRDFCTTPSHIASMLFKIINVAIERGDWLNVQSNVHRLRSQ
FT                   GGKPEEQAKHQPKISAAMGLSQLHSGSYLEAANSFIATDPSLGDTFNEVLTSNDVAVYG
FT                   GLCALASMDRNELQRRVLDNSSFRNFLELEPHIRRAISFFCNSKFRPCLEILEAYRADY
FT                   LLDIHLQRHVQVLYNRIRTKSIQQYLIPFNRVSLESMAKIFVLGNPTSQSSQSDSKSAF
FT                   VQELISLIQDGTLDARIDLEKHVLVSTQGDKRIEVQEAVLDSLDNYVREAHLRLLRSNI
FT                   IRAGLEVRPLGEDRRTKLEERGKKGHSAIGNLLRATGMKQ"
FT   gene            904258..905258
FT                   /locus_tag="ANIA_01492"
FT                   /old_locus_tag="AN1492.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(904258..904903,905098..905258)
FT                   /locus_tag="ANIA_01492"
FT                   /old_locus_tag="AN1492.4"
FT                   /note="transcript_id=CADANIAT00008115"
FT   CDS_pept        join(904258..904903,905098..905258)
FT                   /locus_tag="ANIA_01492"
FT                   /old_locus_tag="AN1492.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008115"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008115"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008115"
FT                   /db_xref="GOA:Q5BD88"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD88"
FT                   /protein_id="CBF84974.1"
FT                   /translation="MPFATPIKTSAGITLPVDLKEASVETASMTTAIVAHTLRGMDCMS
FT                   YKISTGFAVGSNKKLDLASNKWWLLISFDTPKNAKPTWEEDIIRDLMNRLGLPVSEAIP
FT                   PSDRDSALLQAQNGEQSSRMARIRSKIRTMQQTSRLNSLKSRLDSLTLHHEKTVRVYDD
FT                   IPFLLSYGAHDADFAIYDELCRHLQAGGETRLCGFAFTLRELQTWDKIDERLDQFSPSF
FT                   CIVALNVAILAPYSDHSCSKADGGSRFLNPGKLSLHITSSIAMQNQ"
FT   gene            complement(905219..906405)
FT                   /locus_tag="ANIA_01493"
FT                   /old_locus_tag="AN1493.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(905219..905815,905911..906005,
FT                   906064..906405))
FT                   /locus_tag="ANIA_01493"
FT                   /old_locus_tag="AN1493.4"
FT                   /note="transcript_id=CADANIAT00008116"
FT   CDS_pept        complement(join(905426..905815,905911..906005,
FT                   906064..906175))
FT                   /locus_tag="ANIA_01493"
FT                   /old_locus_tag="AN1493.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008116"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008116"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008116"
FT                   /db_xref="GOA:Q5BD87"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD87"
FT                   /protein_id="CBF84976.1"
FT                   /translation="MVLFRSVLAFASVAGLAISQDASTTTVDIQSLDDGTKKQWCIAQT
FT                   SSCPLLCLQLPGASGDPTSNTCDDDTLAYNCVCDNGQSPNASEYSQTIPYFLCTEENNN
FT                   CVAACSQGDSSCQDSCRTSNPCGAQNPKLVNTTSTNGSSTATSTTTSTTSSLAPFTGLP
FT                   DDDEGAAVRPVTDLRQVYGLFAVLGGFFAGFTILL"
FT   gene            907137..908780
FT                   /locus_tag="ANIA_09515"
FT                   /old_locus_tag="AN9515.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(907137..907199,907915..908412,908499..908551,
FT                   908637..908673,908736..908780)
FT                   /locus_tag="ANIA_09515"
FT                   /old_locus_tag="AN9515.4"
FT                   /note="transcript_id=CADANIAT00008117"
FT   CDS_pept        join(907137..907199,907915..908412,908499..908551,
FT                   908637..908673,908736..908780)
FT                   /locus_tag="ANIA_09515"
FT                   /old_locus_tag="AN9515.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008117"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008117"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008117"
FT                   /db_xref="InterPro:IPR039358"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQB5"
FT                   /protein_id="CBF84978.1"
FT                   /translation="MSWKDADAGPCPSSQKRIRGLALPPPISGSEVSKWMAPANEETGR
FT                   VPRPQPLPASPHPSSGIPSAPDRDGDAVEPADSNPGEISANPSSASSSRSQLESPNLAP
FT                   KERPVSGIVPPYWSHHRNASRASQISADGGPAITLEDHTEDPNSETSRGLWAKSVTIDD
FT                   HVVVQGKSGVGAYVVWNCKIRTLEGGTITVRMRYSYGSAIISTPSQRYPRRVFYSSFGH
FT                   LSLNLAKLV"
FT   misc_feature    907666..912647
FT                   /note="contig 1.224 1..4982(-1)"
FT   misc_feature    912648..978457
FT                   /note="contig 1.23 1215..67024(1)"
FT   gene            913046..917056
FT                   /locus_tag="ANIA_01494"
FT                   /old_locus_tag="AN1494.4"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TSM1/127kD, putative (AFU_orthologue; AFUA_8G04950)"
FT   mRNA            join(913046..915361,915409..915777,915829..916620,
FT                   916685..917056)
FT                   /locus_tag="ANIA_01494"
FT                   /old_locus_tag="AN1494.4"
FT                   /note="transcript_id=CADANIAT00008118"
FT   CDS_pept        join(913046..915361,915409..915777,915829..916620,
FT                   916685..917056)
FT                   /locus_tag="ANIA_01494"
FT                   /old_locus_tag="AN1494.4"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TSM1/127kD, putative (AFU_orthologue; AFUA_8G04950)"
FT                   /note="transcript_id=CADANIAT00008118"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008118"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008118"
FT                   /db_xref="GOA:Q5BD86"
FT                   /db_xref="InterPro:IPR037813"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD86"
FT                   /protein_id="CBF84980.1"
FT                   /translation="MPGVVDTPAGPSWPGLGFTVAHQKVELELDFASRSLKGKTEIIIH
FT                   PHYKDLRYIRLNFRQGELKRVTVSGKVPLVKYTDPYESLQLYGPHYHQRLASKLDALLK
FT                   TPSEPELTLTLPKSVRIDELDPFSVEAQDQMALRAPGLADDTEGPLSSKTAETSLPRFT
FT                   ALTVTIEFIVENIRDGIQFVGVENGDKRYPHAYTTNSLDHGTGCPLFPCVDDPSSRCTW
FT                   EIAIRCPCTLGDVFERKPRDQSVSGTGTRLRSNHDRLAPDDEALDLSVVCSGELTDDIV
FT                   DSKDSSKKTVSFASYSPLSARQIGFAVGPFEYVNLADFRESDQDEQLGQNAIPLHAFCL
FT                   PGRGDEVRNTCFPMAKAIDFFSMTYGSYPFSSYKMCFVDDAPEDTLPTACFSICSSRLL
FT                   FPEEIIDPMYDSTRAITHALAAQWIGVNIVPKEPADTWVTVGVAWYITDTFMRKLCGNN
FT                   EYRFRLKLMSDRVCDLDYERPSVYDMGNILSIDPSEAKFIALKAPLVLFILDRRLTKAS
FT                   GKATMSRIISRLFLNARMGELPNGAVTSSVFQKTCERLGHAKLDTFFNQWIYGAGCPRF
FT                   QATQRFNKKKLVVEMMIKQVQSDQPTARDLERDAFMRDVKEEIRNVYAGTIQPVFTGSM
FT                   TIRIHEADGTPYEHIVEIKEGVTKFDIPYNTKYKRLKRNKRQKERAAAVIGADGNAEVQ
FT                   EDILLYCLGDVLQSEEEMQQWRLADWSKEDEERMGQESYEWIRMDADFEWICKLSLVMP
FT                   GYMYLSQLQQDRDVVAQLESLQYMAAQREHPLISTIFLRTLMDRRYFYGIRVAAARALV
FT                   KHAKEEINWLGLFHLEKAFQELFCLPGSPMTRSNNFSDRAAYVLQLVIPEAISKVRDVS
FT                   GKTPMRVKRFLYDKLKFNDNSNNEYSDNFYVATLMKSLCHAMLGRVESRTDDLNNFDMD
FT                   AVLEAQAEEQLEKDAIAEIDRYRRMDEWSSSFQNLYSRAALYCQMQLMQAKIAEVDVMQ
FT                   FLPYTRVGTYDLLRLDAFECLVELDIFKSPELLRWFIFTMSNDPSIWLRWQLHGLFGRA
FT                   LAPVAFGRGVINEPPPPTDGLIIEQESSTEVRQADLARRQTVTGALAALKAEVSGDQVL
FT                   KECLWAACSSPIIGILELSEFTDLCRVIYDPVTSKRVTLKYPRYWAVKHHGRGRLQFYR
FT                   TNKIRTSLNPSTTSSAKRKREDGTAMPAPSSGLRVTFKQSRPNPSNHHPSTPSAKTPGP
FT                   SSGLGTPLQQRQPTKLHIPNFAAAQVHRQPPSHTPATPSTPGGGLKLKLKLGSQPKQ"
FT   gene            complement(917467..918318)
FT                   /locus_tag="ANIA_01495"
FT                   /old_locus_tag="AN1495.4"
FT                   /product="small nuclear ribonucleoprotein SmG, putative
FT                   (AFU_orthologue; AFUA_8G04960)"
FT   mRNA            complement(join(917467..917734,917828..917860,
FT                   917945..918019,918150..918221,918289..918318))
FT                   /locus_tag="ANIA_01495"
FT                   /old_locus_tag="AN1495.4"
FT                   /note="transcript_id=CADANIAT00008119"
FT   CDS_pept        complement(join(917708..917734,917828..917860,
FT                   917945..918019,918150..918221,918289..918318))
FT                   /locus_tag="ANIA_01495"
FT                   /old_locus_tag="AN1495.4"
FT                   /product="small nuclear ribonucleoprotein SmG, putative
FT                   (AFU_orthologue; AFUA_8G04960)"
FT                   /note="transcript_id=CADANIAT00008119"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008119"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008119"
FT                   /db_xref="GOA:Q5BD85"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD85"
FT                   /protein_id="CBF84982.1"
FT                   /translation="MPQAQPELKKYMEKRVFCELNGNRKVIGVLRGYDVFMNIVLDEAF
FT                   EEKPGGEKVAIGMIVIRGNSVVMLEALERISEK"
FT   gene            918517..919802
FT                   /locus_tag="ANIA_10211"
FT                   /old_locus_tag="AN10211.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(918517..918592,918664..919802)
FT                   /locus_tag="ANIA_10211"
FT                   /old_locus_tag="AN10211.4"
FT                   /note="transcript_id=CADANIAT00008120"
FT   CDS_pept        join(918517..918592,918664..919802)
FT                   /locus_tag="ANIA_10211"
FT                   /old_locus_tag="AN10211.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008120"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008120"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008120"
FT                   /db_xref="GOA:C8VMM6"
FT                   /db_xref="InterPro:IPR012890"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMM6"
FT                   /protein_id="CBF84984.1"
FT                   /translation="MSSGFANRRKPRKIGGDDGNDDEEQDTGPIIKRPVSLKVKQKSKA
FT                   RVSFGPGETSMTEGDDGESEVIVPKKHGLGRRVVEKNAFQKSTTPSALSNQLPLRVGPE
FT                   QDRPSYNEEYLNELRNLTASTPKPTADSENQNEVDVAAKFGEVTKVTAPSLIPTEAEIR
FT                   EKKARRARLAKEQDSHSLTEQDYISLEENAGDDWELVDREYDRDTRLVRDDEDFAEGFD
FT                   EYVEDGRISLGRKAEREQNRKQREAMRELIEDAEALMDEEDSDLEEKAAYEAAQTRAAM
FT                   GYGNGPVDRPKTPPKMTSLPRLSTCLDRLRMNLAVLEKSRTQMINRMEELRKEKANISV
FT                   REVEIQALIKETGDHYEKLKQEAGVTPGSEAETPGTTDFESSRGLENIGAPSTAVSKTN
FT                   SESET"
FT   gene            920012..922835
FT                   /locus_tag="ANIA_10209"
FT                   /old_locus_tag="AN10209.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(920012..920088,920159..920319,920370..920722,
FT                   920780..921058,921123..921876,922684..922835)
FT                   /locus_tag="ANIA_10209"
FT                   /old_locus_tag="AN10209.4"
FT                   /note="transcript_id=CADANIAT00008121"
FT   CDS_pept        join(920012..920088,920159..920319,920370..920722,
FT                   920780..921058,921123..921876,922684..922835)
FT                   /locus_tag="ANIA_10209"
FT                   /old_locus_tag="AN10209.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008121"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008121"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008121"
FT                   /db_xref="GOA:C8VMM7"
FT                   /db_xref="InterPro:IPR010640"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMM7"
FT                   /protein_id="CBF84986.1"
FT                   /translation="MSRTPFFSLGRWSLPRAERASIGPTQGLALIETPIDEKDGVPPHL
FT                   YRRSDATPIELFFDLFLVANLSTFTATHEINNVEALVTYIGFLGVIWFTWLQVMMFDIR
FT                   FARDSLFERICKAMQLGIMVGFASAGTRITTRVRPENVWAFQSLSLMLGGSRLLLSVQY
FT                   IVSTVLIRKRMSCASKGLYFIAAALLVSSLVHFGMYFVFGEDSAHSYVWTVWFVLFWVE
FT                   MWTVFATSCITPDIGFQDTPLNVRMGLLTLIIIGEGVISVTRLVNKTVRPGGWTRWSFV
FT                   HILGVTTNVYFIWQEYFDLTPTRTIGTFAQQIWAQLHFPFHVALVLLLEGSQILALTLD
FT                   ITLKLQYLTETILFACEEPRPDPELAVKLLCDTIADMEIEYSRGAISEQMAIHDILNDL
FT                   PNHEICPVNGTIGFTLTRNMFNDLVGNVTSALFSSMRIVPPQSAHVSTMDSSQLLRMYV
FT                   ELLGFVYVYYFLVASLAMLLFAAFGLLAQRHDKPLAMAIGVAVRIVSGIFLASLTIFAK
FT                   HFELAYSFMKSPTILYAFTFVLLGGTTEQNGSDGRLHAQRCATGLGLEAAKDTELELDR
FT                   AHALSALTWHAYRQL"
FT   gene            925032..926675
FT                   /locus_tag="ANIA_01497"
FT                   /old_locus_tag="AN1497.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(925032..926315,926366..926522,926656..926675)
FT                   /locus_tag="ANIA_01497"
FT                   /old_locus_tag="AN1497.4"
FT                   /note="transcript_id=CADANIAT00008122"
FT   CDS_pept        join(925032..926315,926366..926522,926656..926675)
FT                   /locus_tag="ANIA_01497"
FT                   /old_locus_tag="AN1497.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008122"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008122"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008122"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD83"
FT                   /protein_id="CBF84987.1"
FT                   /translation="MTERNLLSSSCLAALPDSCAAAPAMSFDTSSTIGQRSESTMRCEQ
FT                   LQIGDHGETDGQYLATSAGVLNDDFSGRDFQTSGEQYRRWHANFSSTEPAKSVRPTSQN
FT                   SFHWKLQKIDRPSTKDTFTVEELNSNSGGAPTPDLVHPIPRHSPYAVTSYFTSEKIPET
FT                   STFGKTESPLSEDKKCLVRGSNWTSDDFAFSCLLQERQSPDASSLTTLPDNYTPVTTDG
FT                   TYTDHSVSPWPSVKTQLSWDTQTANATHCKEEVAWNEPRFFPDVEQQQTHFDQFPVTTD
FT                   NIHGFPSLGHSAETYVQPSSLLDPYGSTCPGLYLNGSTITQQEQSPIPYSSSTLVFQNG
FT                   LRPDESTDSFFPSGSISYQPSHVGHMATWTNDVKNALLIEYKRQGLSYKDIKRIAGFKE
FT                   AESTLRGRFRTLTKSKEQRVRKPQWHEKDVRLLCEAVNVYSEDGRISPYSRRPVPPTKI
FT                   PWKKVAQYIWNNGGSYHFGNSTYNMNSQ"
FT   gene            complement(926980..928485)
FT                   /locus_tag="ANIA_01498"
FT                   /old_locus_tag="AN1498.4"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase, putative
FT                   (AFU_orthologue; AFUA_8G05000)"
FT   mRNA            complement(join(926980..927894,927969..928228,
FT                   928407..928485))
FT                   /locus_tag="ANIA_01498"
FT                   /old_locus_tag="AN1498.4"
FT                   /note="transcript_id=CADANIAT00008123"
FT   CDS_pept        complement(join(926980..927894,927969..928228,
FT                   928407..928485))
FT                   /locus_tag="ANIA_01498"
FT                   /old_locus_tag="AN1498.4"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase, putative
FT                   (AFU_orthologue; AFUA_8G05000)"
FT                   /note="transcript_id=CADANIAT00008123"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008123"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008123"
FT                   /db_xref="GOA:Q5BD82"
FT                   /db_xref="InterPro:IPR019200"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD82"
FT                   /protein_id="CBF84989.1"
FT                   /translation="MDEIEDAINARICSYMLLEFSMTMDLGDEDDNGLSAAILPSPTAP
FT                   RIYCPTLSNPVFSNSPRHSFKRRIHRMQLGLTESLPALVAKRFTAAKDAGHLIFSQTHL
FT                   EILRPGGVPYQLRYCPALANKPTGKPKSDEGSPKKRFDPFENPSPELLIAHFPKENPTH
FT                   FLVLNKFPVIPNHFILATTAWREQTDILEKEDLAAAYACVKAWNDGNQSGGTSSKRLFA
FT                   FFNSGYESGASQPHRHLQFIPVEAMAQDDETGTWKPLIDTVPSQPASFGSEFRRVAGIP
FT                   LANFALPLPADASAEKLHEIYLSLYKAAAVAAGVPRSQLQSSTGPAIISYNLAMTDSTM
FT                   MICPRKSVSAVVSVDDAARKDIAEAGVVELNGTLLAGTMMVKAEAEWHELRRSPDALMK
FT                   VLASIGYPHPDPRELSLL"
FT   gene            complement(929434..930381)
FT                   /locus_tag="ANIA_01499"
FT                   /old_locus_tag="AN1499.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(929434..929520,929751..930137,
FT                   930172..930276,930376..930381))
FT                   /locus_tag="ANIA_01499"
FT                   /old_locus_tag="AN1499.4"
FT                   /note="transcript_id=CADANIAT00008124"
FT   CDS_pept        complement(join(929434..929520,929751..930137,
FT                   930172..930276,930376..930381))
FT                   /locus_tag="ANIA_01499"
FT                   /old_locus_tag="AN1499.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008124"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008124"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008124"
FT                   /db_xref="GOA:Q5BD81"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD81"
FT                   /protein_id="CBF84991.1"
FT                   /translation="MSRFLRQDIQRRLLRLLTLKPFRLLPPHGPQAANDEPQCKPSLNH
FT                   YNNRPVLILALIIFIMGPRHFVRCLPDLLLYPPIRLTAPLAPSAFNLQCSTLDPQSRLL
FT                   RRRSLERTSMLTCQRPPQSPTNIEGMLSPPSAIGGVRVTLEILEGFDIDEPPRIPCQNR
FT                   FLKCEAIICLADDTRSRKKIVDGTFAKVVGA"
FT   gene            complement(930516..932957)
FT                   /locus_tag="ANIA_01500"
FT                   /old_locus_tag="AN1500.4"
FT                   /product="C2H2 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G05010)"
FT   mRNA            complement(join(930516..932166,932216..932784,
FT                   932879..932957))
FT                   /locus_tag="ANIA_01500"
FT                   /old_locus_tag="AN1500.4"
FT                   /note="transcript_id=CADANIAT00008125"
FT   CDS_pept        complement(join(930716..932166,932216..932657))
FT                   /locus_tag="ANIA_01500"
FT                   /old_locus_tag="AN1500.4"
FT                   /product="C2H2 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G05010)"
FT                   /note="transcript_id=CADANIAT00008125"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008125"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008125"
FT                   /db_xref="GOA:Q5BD80"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD80"
FT                   /protein_id="CBF84993.1"
FT                   /translation="MMALEPSRQHQGPYFQDYSIDPALVDSFSFVDSLGAYGPDLTQPS
FT                   FQNTGFGDSYTDMGKQNFPVTTSEGFLSGVSTASGPSIASASSSAMGSPYSANTQTFQE
FT                   DWVDTTHGLSHPTAVMGDLFSNESMVNTFDAEGFYQKKSDSFVDPSLIQPMQQPQLTLT
FT                   PPAISYPEQPDYNLAPTSFYPQSPEPSRFHYAENYMPKQSFPQQSNLAPPSPIPSGPHS
FT                   RPASIYDRRSSISSIHSRPSQASPAPSGAEFEGDVKEKGRCPHPDCGRVFKDLKAHMLT
FT                   HQSERPEKCPIVTCEYHIKGFARKYDKNRHTLTHYKGTMVCGFCPGSGSPAEKSFNRAD
FT                   VFKRHLTSVHGVEQTPPNCRKKSPAASSAKSVSDYCQDATGKCSTCSGTFSNAQDFYEH
FT                   LDDCVLRVVQQEEPSEAINQQRLAEVESDEEVQKTMEKHRLLDTAGSVDQYDDENDDDD
FT                   DDDSDDRRPAKSAKTGKNSRVILGANNAISKSCSNNNSKNRLTASKRRNNRDHYPQSWG
FT                   CPSRNIKMKKRVLCVFDGQRRLWKDEMMLDNEFEVRLKLPGGAGDGTNREAYITDLDVE
FT                   TLKRANGILGATEEERGAWTEGTGGQLIGQPAMLLPDFSQNQEGDVVDIDELMA"
FT   gene            complement(937408..939328)
FT                   /locus_tag="ANIA_01501"
FT                   /old_locus_tag="AN1501.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(937408..937530,937939..938094,
FT                   938375..938600,938687..938818,939204..939328))
FT                   /locus_tag="ANIA_01501"
FT                   /old_locus_tag="AN1501.4"
FT                   /note="transcript_id=CADANIAT00008126"
FT   CDS_pept        complement(join(937408..937530,937939..938094,
FT                   938375..938600,938687..938818,939204..939328))
FT                   /locus_tag="ANIA_01501"
FT                   /old_locus_tag="AN1501.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008126"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008126"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008126"
FT                   /db_xref="GOA:Q5BD79"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD79"
FT                   /protein_id="CBF84995.1"
FT                   /translation="MSSVACSWSRLSTEPLALLLPPIALLCSIVHPDSSLELLTRSRDL
FT                   DSAIVAVQDRLTRVIASTIFARDKDPYSVPIASIHGSFIRGEASPEFQAWALPVTHQEF
FT                   ASSSSLSIGEPPDPPLQCHEAPTELNPEYYHVAHSRPESPLAADKPWDSIPLALNALID
FT                   TNWGITAESKESALDRRVACQRTALNRLLRGQGMDGYAADELSWSCGENKRYRNSQSRR
FT                   MMIAVQPDCEKPQTVGSYFVLLVRILHIIRQ"
FT   gene            complement(943417..945358)
FT                   /locus_tag="ANIA_01502"
FT                   /old_locus_tag="AN1502.4"
FT                   /product="N-acetylglucosaminidasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q9HGI3]"
FT   mRNA            complement(943417..945358)
FT                   /locus_tag="ANIA_01502"
FT                   /old_locus_tag="AN1502.4"
FT                   /note="transcript_id=CADANIAT00008127"
FT   CDS_pept        complement(943464..945275)
FT                   /locus_tag="ANIA_01502"
FT                   /old_locus_tag="AN1502.4"
FT                   /product="N-acetylglucosaminidasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q9HGI3]"
FT                   /note="transcript_id=CADANIAT00008127"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008127"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008127"
FT                   /db_xref="GOA:G5EB27"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR029019"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB27"
FT                   /protein_id="CBF84996.1"
FT                   /translation="MAYFRLYAVLLAVASSVAAVKVNPLPAPRHISWGHSGPKPLSDVS
FT                   LRTERDTDDSILTNAWNRAWETIVSLEWVPAGIEAPIPEFDEFPTSTPSASAAATRSKR
FT                   ANVPIQFVDVDVEDWDADLQHGVDESYTLDAKAGSDAIDITAKTVWGALHAFTTLQQLV
FT                   ISDGNGGLILEQPVHIKDAPLYPYRGLMVDTGRNFISVRKLHEQLDGMALSKLNVLHWH
FT                   LDDTQSWPVHIDAYPEMTKDAYSARETYSHDDLRNVVAYARARGIRVIPEIDMPAHSAS
FT                   GWQQVDPDIVACANSWWSNDNWPLHTAVQPNPGQLDIINPKTYEVVQDVYEELSSIFTD
FT                   DWFHVGGDEIQPNCYNFSTYVTEWFQEDPSRTYNDLMQHWVDKAVPIFRSVSDSRRLVM
FT                   WEDVVLNTEHADDVPTDIVMQSWNNGLENINKLTERGYDVIVSSADFMYLDCGRGGYVT
FT                   NDDRYNEQTNPDPDTPSFNYGGIGGSWCGPYKTWQRIYNYDFTLNLTNAQAKHVIGATA
FT                   PLWSEQVDDVNISNLFWPRAAALAELVWSGNRDAKGNKRTTLFTQRILNFREYLLANGV
FT                   MAATVVPKYCLQHPHACDLNYDQTVLH"
FT   gene            complement(946750..947679)
FT                   /locus_tag="ANIA_01503"
FT                   /old_locus_tag="AN1503.4"
FT                   /product="Dihydrodipicolinate synthase-like protein AN1503
FT                   (DHDPS-like protein)(EC 4.-.-.-)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BD77]"
FT   mRNA            complement(946750..947679)
FT                   /locus_tag="ANIA_01503"
FT                   /old_locus_tag="AN1503.4"
FT                   /note="transcript_id=CADANIAT00008128"
FT   CDS_pept        complement(946750..947679)
FT                   /locus_tag="ANIA_01503"
FT                   /old_locus_tag="AN1503.4"
FT                   /product="Dihydrodipicolinate synthase-like protein AN1503
FT                   (DHDPS-like protein)(EC 4.-.-.-)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BD77]"
FT                   /note="transcript_id=CADANIAT00008128"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008128"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008128"
FT                   /db_xref="GOA:Q5BD77"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD77"
FT                   /protein_id="CBF84998.1"
FT                   /translation="MANRPLVPGVYVPTVAFFAENEDVDVATVEKHAAYLAKSGVAGIV
FT                   VQGSNGEAVHLDREERNLITSATRHALDSVGATSMPVIVGTGAPSTRETINLCKDAAAA
FT                   GGDYVLVLPPSYYKSLVSSAALLDHFRAVADASPIPVLIYNFPGASAGLDLSSDDILAL
FT                   SSHPNIIGTKLTCGNTGKLTRIVAQAGPSFLTFGGSCDFTLQTLIGGGAGVIAGTANII
FT                   PRACVRIMELYRAGRVEEAQKVQAIVARADWLAIKGGFVAVKSALQSYRGYGQQPRRPC
FT                   VAPSSEEAAALKEAFSESIELERQLESQ"
FT   gene            949403..952274
FT                   /locus_tag="ANIA_01504"
FT                   /old_locus_tag="AN1504.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(949403..950049,950211..951103,951164..952274)
FT                   /locus_tag="ANIA_01504"
FT                   /old_locus_tag="AN1504.4"
FT                   /note="transcript_id=CADANIAT00008129"
FT   CDS_pept        join(949403..950049,950211..951103,951164..952134)
FT                   /locus_tag="ANIA_01504"
FT                   /old_locus_tag="AN1504.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008129"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008129"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008129"
FT                   /db_xref="GOA:C8VMN5"
FT                   /db_xref="InterPro:IPR029184"
FT                   /db_xref="InterPro:IPR038988"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMN5"
FT                   /protein_id="CBF85000.1"
FT                   /translation="MRKALVITATAISGLSLAVSLYLSHQKRYLASQVRHSSERGQLSP
FT                   STPRNVSSISSDIFSSEYYTLYDYASISAPRHSLPDLEPSQLLIALLRRNMSSFASSPQ
FT                   ARLLKLAASDPETIRSFDRAHIVALDFDEGDLVCNAYRVRLRAPEKVEFEFLFGVQGRL
FT                   VVSVEVKGEDMVFHNETLMWRDKDTKNKLPLENGFANWVHELTAWWMLESGISFELTRS
FT                   GHSCHSSRIQFPLPRVISHRHRALMRPERVEEIPSRFPPLPTDPMTSTAIMPARSRSSL
FT                   RALRRDPNATNDDSAGVQPPPPKRPRLNLFPSRRRKSSPDLLDTTIDSSPSTSSTKLRR
FT                   PRPLLAHSAHTTSSPPSGSSTPHARNLRQHHTPNSSSAALYLNGGRESPDPLDTISPAP
FT                   ALKPSTITTSTPTPTSAAYRQRRLTQYLKPASEQAVKDSSKSKNTRPARGSTVPPPSDE
FT                   SAPQSLTVPSETADRAVPEKRRSLRSHDGGSRAKSELALYFPNYDQIMSLEPPKTELLS
FT                   ENTVIKLIDDLAEPLDLSSAPSSSDADAPFGNPLVNLYKCDVITLPDTQLKNESRPDIE
FT                   AGEAEEDDPLNDEFYFKAHRRHERQEKQLRNIERDRARHDQQQLDRLLDELQGHDWLRV
FT                   MGITGRSLSEQDKKLYEPKRDYFIAEISTLLQKFKIWKEEEKRRKLDKDYKSASFHSDA
FT                   AEPSYGNAKDNDRKDDDEEATAEPTSDDVDALAARQLLQEARSATAGKQPKSKLEQQEL
FT                   AQSAPPPLPGLPKPFTSFFAKPHLRAQAMSGNRKGRTRLAFGHLIPELGERDFELPGDI
FT                   LTPEAIKDCQRKRRRMKRDKASSG"
FT   gene            complement(952617..954342)
FT                   /locus_tag="ANIA_01505"
FT                   /old_locus_tag="AN1505.4"
FT                   /product="amino acid transporter (Eurofung)"
FT   mRNA            complement(join(952617..953042,953098..953312,
FT                   953368..953511,953565..953896,953978..954064,
FT                   954134..954342))
FT                   /locus_tag="ANIA_01505"
FT                   /old_locus_tag="AN1505.4"
FT                   /note="transcript_id=CADANIAT00008130"
FT   CDS_pept        complement(join(952617..953042,953098..953312,
FT                   953368..953511,953565..953896,953978..954064,
FT                   954134..954342))
FT                   /locus_tag="ANIA_01505"
FT                   /old_locus_tag="AN1505.4"
FT                   /product="amino acid transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008130"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008130"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008130"
FT                   /db_xref="GOA:Q5BD75"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD75"
FT                   /protein_id="CBF85002.1"
FT                   /translation="MAQNAESSVPYGHEESGPEKNVTTDEDSFTRDDVKKTENSPPPYT
FT                   QSPFTSDAFGDEEFAEVKYKTLKWWQCGLLMVAETVSLGVLSLPAAVAGLGFVPAIIIL
FT                   VALGLFATYTGYVIGQFKNRFPHVTNMADAGEVVAGKWGREFMGVAQMLFFVFVMASHL
FT                   LTFTVAMNTLTEHGTCSIVFGVVGMIVSFILCLPRTLEKMSWLSLVSFISIFSAVMICM
FT                   VGVGISKPGVNNTAAVVDTDLYHGFTAVTNIVFAFCGHAAFFGLAAELKDPRDFPKGLC
FT                   LLQGIDISLYLIAAVVIYRYGGADVTSPALGSASPIVSKVAYGIALPTILIAGVIYGHV
FT                   AAKYIYIRIFRGTDRMHKRDAVAIGSWVVIALCLWILAWIIAEAIPVFSNLLSLITALF
FT                   ASWFTYGLSGIFWLFMNKGLWFKNWKKISLTMVNLLAIGVACVLCGMGLWVSGKALHDN
FT                   PSSASFSCANNA"
FT   gene            955600..957387
FT                   /locus_tag="ANIA_01506"
FT                   /old_locus_tag="AN1506.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_8G05090)"
FT   mRNA            join(955600..955765,955829..956443,956517..956732,
FT                   956793..956876,956940..957387)
FT                   /locus_tag="ANIA_01506"
FT                   /old_locus_tag="AN1506.4"
FT                   /note="transcript_id=CADANIAT00008131"
FT   CDS_pept        join(955600..955765,955829..956443,956517..956732,
FT                   956793..956876,956940..957112)
FT                   /locus_tag="ANIA_01506"
FT                   /old_locus_tag="AN1506.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_8G05090)"
FT                   /note="transcript_id=CADANIAT00008131"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008131"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008131"
FT                   /db_xref="GOA:C8VMN7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMN7"
FT                   /protein_id="CBF85004.1"
FT                   /translation="MTLAEHDDLSPHSEGTTTPDENEPNSPVEGTYNDAREVYGKIAST
FT                   NFSILCGGFNDAALGPLIPYIQPWFHVGLLEISYIYLVSFAGSFSASFANIHICSHLGT
FT                   GGTLLLGIAIQCTGFTLMFWAPSFPFFLVAFLFTGFGCGLANAQANSFTVTVRNSHRWL
FT                   GILHAMYGMGTILAPLVANSIAAHLSRWQIYYLISLGLGATNAAFAAWAFRHGLFKPNS
FT                   EGAKEAAGRELRETLAHRSLWFLTMFFFLYSGAEITLGVGVRHGDPEKVGYVASVFWCG
FT                   FTFGRVALADVTHRFGERRMVFIYIALALAFQLMFWLIPNILINAISVCLLGFFIGPFY
FT                   PVGLYVLTQVVPQELHLGAIGFAASFGSVGCAAFPFLTGAIASRAGVEVLQPIMIGLLI
FT                   GIAFFWAVVPKPKRIRLT"
FT   gene            complement(957522..958211)
FT                   /locus_tag="ANIA_01507"
FT                   /old_locus_tag="AN1507.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(957522..958130,958179..958211))
FT                   /locus_tag="ANIA_01507"
FT                   /old_locus_tag="AN1507.4"
FT                   /note="transcript_id=CADANIAT00008132"
FT   CDS_pept        complement(join(957522..958130,958179..958211))
FT                   /locus_tag="ANIA_01507"
FT                   /old_locus_tag="AN1507.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008132"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008132"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008132"
FT                   /db_xref="GOA:Q5BD73"
FT                   /db_xref="InterPro:IPR024526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD73"
FT                   /protein_id="CBF85006.1"
FT                   /translation="MAHVHIPTVTLEDLQAFQAKHFPATVKPQPLQSTSYPTHDAYNED
FT                   FYANADEEDVDDEDDDLGYYPDGVKRTLTDEQIRIFRHSEIHALLREKQIKQENEEYEK
FT                   GLGGKTEAQPEAGAQVHTSLDERDGAISAPPKDVAKAVAGRKRCADKVGCDAGADEPVL
FT                   KRKPTSDSGAPSEVQLDYNEESAAAPTTASQSRATRATPFMGRRIISYDD"
FT   gene            complement(958450..959647)
FT                   /locus_tag="ANIA_01508"
FT                   /old_locus_tag="AN1508.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(958450..959065,959096..959184,
FT                   959232..959344,959395..959647))
FT                   /locus_tag="ANIA_01508"
FT                   /old_locus_tag="AN1508.4"
FT                   /note="transcript_id=CADANIAT00008133"
FT   CDS_pept        complement(join(958666..959065,959096..959184,
FT                   959232..959344,959395..959647))
FT                   /locus_tag="ANIA_01508"
FT                   /old_locus_tag="AN1508.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008133"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008133"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008133"
FT                   /db_xref="GOA:Q5BD72"
FT                   /db_xref="InterPro:IPR027521"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD72"
FT                   /protein_id="CBF85007.1"
FT                   /translation="MALVQYSDSESDSEKEAPPRKINKPSQNLSHNPASTLPPLPASFH
FT                   DLYASSVKVSVRDDPSLHGGRKRVIPHVEGNWPTHIYLEWYPSKKELEILGNIIRQAEH
FT                   MFRAEQAKLNSFLYSDLGNGGEAAVYGHIWSGTKWLWHLTVCAICPSVFEVQIDSLDWV
FT                   SNFERTRWFYVLRVKRPEGDGLNRLLHISNRSLGLFNQPPLYAPLFNSKSGTQPSIRVS
FT                   KPTSTGDYTECFHISIAWSLEEPSAEEKKSMESIDIQRLKALKIKFDCLKAKIGNNVSS
FT                   IPL"
FT   gene            961970..963256
FT                   /locus_tag="ANIA_01509"
FT                   /old_locus_tag="AN1509.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(961970..962101,962157..962813,962867..963256)
FT                   /locus_tag="ANIA_01509"
FT                   /old_locus_tag="AN1509.4"
FT                   /note="transcript_id=CADANIAT00008134"
FT   CDS_pept        join(962232..962813,962867..962983)
FT                   /locus_tag="ANIA_01509"
FT                   /old_locus_tag="AN1509.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008134"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008134"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008134"
FT                   /db_xref="GOA:Q5BD71"
FT                   /db_xref="InterPro:IPR013226"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD71"
FT                   /protein_id="CBF85009.1"
FT                   /translation="MQQYQMDHAYPMPGSQSPKSISSASLGSGSPYQRFLSPSPSPTRS
FT                   TRRRSRTTSVLPADYAYADILFDASQHNRGRRSRRSGLNARRSQLVKPDVIDRMDTAAQ
FT                   FSYHHEGPYDAVYPERNRISIHSPLDALRESNEEALKATPRHMIADAIGRRRPLDGVAF
FT                   YPPGYTDPEGQTYDYEEGPNLMADCCLFPRQRFTDEDFRNDPFTNTPVKPFAPLRNVFR
FT                   RTPRKHRNTA"
FT   gene            964419..966695
FT                   /locus_tag="ANIA_01510"
FT                   /old_locus_tag="AN1510.4"
FT                   /product="oxidoreductin (AFU_orthologue; AFUA_8G05140)"
FT   mRNA            join(964419..964775,964832..966405,966461..966695)
FT                   /locus_tag="ANIA_01510"
FT                   /old_locus_tag="AN1510.4"
FT                   /note="transcript_id=CADANIAT00008135"
FT   CDS_pept        join(964668..964775,964832..966405,966461..966593)
FT                   /locus_tag="ANIA_01510"
FT                   /old_locus_tag="AN1510.4"
FT                   /product="oxidoreductin (AFU_orthologue; AFUA_8G05140)"
FT                   /note="transcript_id=CADANIAT00008135"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008135"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008135"
FT                   /db_xref="GOA:C8VMP1"
FT                   /db_xref="InterPro:IPR007266"
FT                   /db_xref="InterPro:IPR037192"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMP1"
FT                   /protein_id="CBF85011.1"
FT                   /translation="MRSAAKFFYLAVFGFMSQANADKHGEKSMHGYDTCAIDHNAVVSD
FT                   ACVSYHTIDALNDQIYSLLQSITQETDFFSYYRLNLFNKVCPFWSESEGMCGNIACAVN
FT                   TIDSEEDIPLTWRAEELSKLEGPKAGHPGRQQQHERPRDKPLQGMLGEDVGESCVVEYD
FT                   DECDERDYCVPEDEGSSGKGDYVSLVDNPERFTGYAGAGANQVWDAIYRENCFLKPVPE
FT                   LEQSSFTPLGGLQAIQDFQNVLQKESKRPDLLPLDNECVEKRVFHRLISGMHASISTHL
FT                   CWDYLNQTTGQWHPNLQCFKERLHNHPERISNLYFNYALVARAVSKLRKHLEGYTYCLG
FT                   DPAQDQDTKEKISLLTSTLAERPQIFDENVMFQDPGAIDLKEDFRNRFRNVSRLMDCVG
FT                   CDKCRLWGKLQVNGYGTALKVLFEYDETKNGENPPLRRTELVALINTLGRISHSIAAVR
FT                   SFHRAMEVTDGQVFAIPAGSTAGQSRAGGKKVRRLVKNGGSTFYYEDDTAEDYQYISQQ
FT                   RPWERQRVKREGDTIIDDFKAEFSVVWDTLIFVLKSWVNIPWTFWEIGVLEANRLWSYW
FT                   LGLPVPPRAWRIQLPQRPPPPIVVRDEL"
FT   gene            966870..968616
FT                   /locus_tag="ANIA_01511"
FT                   /old_locus_tag="AN1511.4"
FT                   /product="microbody (peroxisome) biogenesis protein peroxin
FT                   13 (Eurofung)"
FT   mRNA            join(966870..967052,967114..967617,967667..968616)
FT                   /locus_tag="ANIA_01511"
FT                   /old_locus_tag="AN1511.4"
FT                   /note="transcript_id=CADANIAT00008136"
FT   CDS_pept        join(967001..967052,967114..967617,967667..968421)
FT                   /locus_tag="ANIA_01511"
FT                   /old_locus_tag="AN1511.4"
FT                   /product="microbody (peroxisome) biogenesis protein peroxin
FT                   13 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008136"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008136"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008136"
FT                   /db_xref="GOA:Q5BD69"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007223"
FT                   /db_xref="InterPro:IPR035463"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD69"
FT                   /protein_id="CBF85013.1"
FT                   /translation="MASVSPPKPWERAGATAGTALSSPATTSTAMSSTSTTSAAPTAGT
FT                   STTSATAPPSLPSRPSTLSTVANQNASNYSPYGASRFGASPYGGYGGYGSYSSPYSRFG
FT                   GMGSMYGGYGGYGGMYSGMGGYGGMYGGGMPGDPNDPNSLTNSFNQSTQATFQMIESIV
FT                   GAFGGFAQMLESTYMATHSSFFAMVSVAEQFGNLRNTLGSALGIFTLIRWFKTLIAKIT
FT                   GRPPPADATALTPAAFAAFMGGRATLPDGSPAPPRPSRKPFLMFLVALFGLPYLMGKLI
FT                   KSLARSQEAQRQKIMMTANGEQQGVLDPSKLDFCRVLYDYTPESQETNGIDLAVKKGDI
FT                   VAVLSKSDPMGNASEWWRCRARDGRVGYLPGPYLETIQRKPQQQALTSGSEAGSRSNTM
FT                   QSQTQVGNEVAAGQKPELKGKMGDISAESFQKSAFYS"
FT   gene            complement(968773..970866)
FT                   /locus_tag="ANIA_10210"
FT                   /old_locus_tag="AN10210.4"
FT                   /product="acetamidase, putative (AFU_orthologue;
FT                   AFUA_8G05220)"
FT   mRNA            complement(join(968773..968888,969008..969302,
FT                   969359..969534,969598..969878,969947..970170,
FT                   970234..970346,970425..970866))
FT                   /locus_tag="ANIA_10210"
FT                   /old_locus_tag="AN10210.4"
FT                   /note="transcript_id=CADANIAT00008137"
FT   CDS_pept        complement(join(968773..968888,969008..969302,
FT                   969359..969534,969598..969878,969947..970170,
FT                   970234..970346,970425..970866))
FT                   /locus_tag="ANIA_10210"
FT                   /old_locus_tag="AN10210.4"
FT                   /product="acetamidase, putative (AFU_orthologue;
FT                   AFUA_8G05220)"
FT                   /note="transcript_id=CADANIAT00008137"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008137"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008137"
FT                   /db_xref="GOA:C8VMP3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMP3"
FT                   /protein_id="CBF85015.1"
FT                   /translation="MTEPHWKSIAHQKRLTQLQSIPSPWRLSSSSISSTSPKSPIEIIQ
FT                   TCGILSPQELRWTEVNDITELVCLLASRSVTSVQLTTAFCKRAAVAQQLTGCLTEIFFD
FT                   RALQRAKFLDEEFERTGKVTGPLHGVPVSIKDRFDVEGFDTTIGWVGLANKPAAKSDSV
FT                   VQLLESMGAVLYVKTNVPQSLMMSDSYNHVFGQSVNAFNTKLISGGSSGGEGALVGAGG
FT                   SVLGIGTDIGGSIRVPSNLQGLYSLCPTTGRIPWNCSFMHQHYLVPPVAGPMARSVSTI
FT                   EYFMQSLLDSNPWNLDPGCIPIPWRRETAAFPDPTRKLKLGIVYDDGVVRPQPPVMRLM
FT                   RELARELTNAGHEVVEWDTSLHRTGTTLWTRSILADGGYHCRQLCSLVDEPLIQGMVVG
FT                   TSADELSSVEKEKLEEEKYAFQESYLAQWVASGIDALLLPVTPWLGYKPKQWVQSNQWL
FT                   GYTALFNLLNYAAVTAPIGKADGELDHPVAGIDNEWKGYAPRNKADRFNYDQYDIDLVK
FT                   GMPVTVQIVGGRYGEEKAVAVAKVVDTLFGR"
FT   gene            complement(971084..972696)
FT                   /locus_tag="ANIA_10212"
FT                   /old_locus_tag="AN10212.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(971084..971293,971343..972313,
FT                   972381..972696))
FT                   /locus_tag="ANIA_10212"
FT                   /old_locus_tag="AN10212.4"
FT                   /note="transcript_id=CADANIAT00008138"
FT   CDS_pept        complement(join(971084..971293,971343..972313,
FT                   972381..972696))
FT                   /locus_tag="ANIA_10212"
FT                   /old_locus_tag="AN10212.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008138"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008138"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008138"
FT                   /db_xref="GOA:C8VMP4"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMP4"
FT                   /protein_id="CBF85017.1"
FT                   /translation="MDSPVLNQLFRQLFRHPACQSVRPSPSSHTFRLSRSQQQCRPFLT
FT                   RRSAAKRKSTDDGLNWTKRGDYPKNIDEELKTYPLMAAKDLRHRQDRPRQVQMLTREFI
FT                   DDSLYNPHYGYFSKHATIFSPGEPFDFNNIEDGPAFHRLLGERYTEFEDMLDEKQPDEA
FT                   RQLWHTPTELFRPYYGETIARYLVSNYKLTLYPYHDLIIYEMGAGNGTMMINILDFIRD
FT                   TDYEVYQRTKFRIIEISPALAGLQMKNLTDSLYAAGHLDHVEIINKSIFEWDTYVHSPC
FT                   FFLALEVFDNFAHDAIRYDTKTEMPQQGGVLIDGDGEFHEFWTPKLDPLASRFLRVRQA
FT                   AARREFPSPLGPRLARQIRGTLPFQKPYTMPEYIPTRLMQFFDILDNYFPGHRLLASDF
FT                   SSLPDAIPGINAPVVQTRYKRRTVPVSTPFVHQGYFDIFFPTDFNVVEDIYRAITGKLT
FT                   QVASHEDFVRRWAYVEDTETRSGENPLLTWYKNASMLMTV"
FT   gene            972915..974403
FT                   /locus_tag="ANIA_01513"
FT                   /old_locus_tag="AN1513.4"
FT                   /product="hypothetical transmembrane protein (Eurofung)"
FT   mRNA            join(972915..973202,973260..973319,973366..973484,
FT                   973533..974179,974231..974403)
FT                   /locus_tag="ANIA_01513"
FT                   /old_locus_tag="AN1513.4"
FT                   /note="transcript_id=CADANIAT00008139"
FT   CDS_pept        join(972915..973202,973260..973319,973366..973484,
FT                   973533..974179,974231..974403)
FT                   /locus_tag="ANIA_01513"
FT                   /old_locus_tag="AN1513.4"
FT                   /product="hypothetical transmembrane protein (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008139"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008139"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008139"
FT                   /db_xref="GOA:Q5BD67"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD67"
FT                   /protein_id="CBF85019.1"
FT                   /translation="MPDHSHIYIGSAFVAGVVLTIAFKDLFYPEIEERIRDYRARHSSK
FT                   SYQNASVDSLAVRHGPPAIVDGIEGCIGNTPLLRIKSLSEATGCEILAKAEFLNGAGQS
FT                   SKDRVALSMIELAEERGLMTPHSGDTIYEGTSGSTGISLATLARAKGYLAHICMPSDQA
FT                   IEKSNLLLKLGAIVDRVPPAPIVEKDNFVNRARALAQAHTNSTASESSVGTASQRGRGY
FT                   FADQFENEANWRAHYNGTGPEIYAQCNGSLDAFVAGAGTGGTISGVALYLKPRIPNMTV
FT                   VVADPQGSGLYNRVRYGVMFDTKEKEGTRRRRQVDTIVEGIGINRVTANFEAGRELVDD
FT                   AVRVTDAQALAMARWLVEKDGIFAGSSSAVNCFAAVKTALKLGPGHRIVTMLSDSGSRH
FT                   LSRFWAKAGNVGGAVDTKLEDVLNAKEDQ"
FT   gene            complement(974629..976368)
FT                   /locus_tag="ANIA_01514"
FT                   /old_locus_tag="AN1514.4"
FT                   /product="Myb-like DNA-binding domain protein
FT                   (AFU_orthologue; AFUA_8G05190)"
FT   mRNA            complement(974629..976368)
FT                   /locus_tag="ANIA_01514"
FT                   /old_locus_tag="AN1514.4"
FT                   /note="transcript_id=CADANIAT00008140"
FT   CDS_pept        complement(974629..976368)
FT                   /locus_tag="ANIA_01514"
FT                   /old_locus_tag="AN1514.4"
FT                   /product="Myb-like DNA-binding domain protein
FT                   (AFU_orthologue; AFUA_8G05190)"
FT                   /note="transcript_id=CADANIAT00008140"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008140"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008140"
FT                   /db_xref="GOA:Q5BD66"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR018465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD66"
FT                   /protein_id="CBF85020.1"
FT                   /translation="MGSPLKRKRLYLWSGADDEYETSDIDLQEARTQNDLRLKSIFEGI
FT                   FEKYGRDFTDVGDEIDLQTGKITVNNGHIDALEVEGNGYGDWLSDARPQAPRHVLAERT
FT                   DYEGKPARLALDADAWGAEDTALEGDHDLQHPGRRTVHLLSHMRPGSRRGLGETTETDS
FT                   DQGAAGDGEDRATSEAEDDRSSVDSLLGTALSIPAQKVGKTTKGETGTEKAIPPHDGSH
FT                   QYQAAHTERLDETVDPIWRVPEISAKFTTPTLPSRPRPNPKPVINNAVRSQSPPGASSV
FT                   WALSGTRKRDTDVVKKIKQKGSPKRRVKHHSSPDAVWDWSFADAPDGSESDDPLQEDYV
FT                   PSPTPKDSVYIREKRKGPFSAGAAQKTCSFCKRIFSRKAYDMHLKDVLANPADNEHDSV
FT                   ELKRQLATVTGDGTTESAPGATNRSPAPAGLIVRITNTPREPDSEAGQRTNHESTPTGS
FT                   KRARTVLGPQEARLIIQMRHIQGMKWKEISDHFPQKKPANIQAWHHVHWKQRKANPPRL
FT                   SGPWSKAELEKLEILKDQPELTWPGIRAEFPGRLLAEIEFKLLQLWAGDNVSQPLRSAS
FT                   PAD"
FT   gene            976888..978564
FT                   /locus_tag="ANIA_10213"
FT                   /old_locus_tag="AN10213.4"
FT                   /product="autophagy protein Apg6, putative (AFU_orthologue;
FT                   AFUA_8G05170)"
FT   mRNA            join(976888..976972,977039..978564)
FT                   /locus_tag="ANIA_10213"
FT                   /old_locus_tag="AN10213.4"
FT                   /note="transcript_id=CADANIAT00008141"
FT   CDS_pept        join(976888..976972,977039..978564)
FT                   /locus_tag="ANIA_10213"
FT                   /old_locus_tag="AN10213.4"
FT                   /product="autophagy protein Apg6, putative (AFU_orthologue;
FT                   AFUA_8G05170)"
FT                   /note="transcript_id=CADANIAT00008141"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008141"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008141"
FT                   /db_xref="GOA:C8VMP7"
FT                   /db_xref="InterPro:IPR007243"
FT                   /db_xref="InterPro:IPR038274"
FT                   /db_xref="InterPro:IPR040455"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMP7"
FT                   /protein_id="CBF85022.1"
FT                   /translation="MYCQKCRTPLKLDGSLEALNPAAFDLLIGSTGKAVPDPSTGSSRL
FT                   SYPQERRDLYDRVSKNASSPVYRRSIPAPRQSGGSSATPSRLGRGDSGNMSFVMLTESQ
FT                   LGPSHTIPGVNGDSASSKGKRASGVQGDDSGADNGSFAEQVERTCRLFEIISARSDIDH
FT                   PICTECTDMLVEGLQQRLAEATKERDAYITFLRNLNSSVPTQEEVETAEKSLKETLEAE
FT                   EAAYAELVALEKENAALDEEIARLEEESRQLDYEEEKFWRDRNAFSLVLADFQNERDAL
FT                   NMKYDHDSRQLERLQRTNVYNDAFCIGHDGYFGTINGLRLGRLANPSVEWPEINAAWGQ
FT                   TALLLATIAEKLNFQFQGYRLRPMGSMSRIDKIEYPRPSPAQSTVEGASNAHQPAAPKI
FT                   TSLDLFSSGDLPLHIPWLHRRFDAGMVAFLECLRQLGEFVEKTPVRSSRRDQAGAVLPG
FT                   LKLPYAIKRDKIGDASIKLGFNQNDETWTRACKYTLTCCKFLLAHASNIASAGSTNSAA
FT                   VTAATVAEQARVAPSPTNK"
FT   misc_feature    978458..984153
FT                   /note="contig 1.213 1..5696(-1)"
FT   misc_feature    984154..1027452
FT                   /note="contig 1.24 227..43525(1)"
FT   gene            988148..989393
FT                   /locus_tag="ANIA_01515"
FT                   /old_locus_tag="AN1515.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(988148..988412,988466..989393)
FT                   /locus_tag="ANIA_01515"
FT                   /old_locus_tag="AN1515.4"
FT                   /note="transcript_id=CADANIAT00008142"
FT   CDS_pept        join(988148..988412,988466..989115)
FT                   /locus_tag="ANIA_01515"
FT                   /old_locus_tag="AN1515.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008142"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008142"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008142"
FT                   /db_xref="GOA:C8VMP8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMP8"
FT                   /protein_id="CBF85024.1"
FT                   /translation="MLRDLLRDLVKFVPWAALLPLVRAEGTVQDLWNSPQYPDYTTNYT
FT                   AGTTIEISWQHALSYQFQYFCESCDVTNVDLWVTGSSYTRKLEAGMNVNETTSYEWTIN
FT                   LDNADVEASTQWTFRFLPADVSWGDNQEEISSARFNLLPRSDSSSTTTSSTSTSTSSST
FT                   TATSNPNATPTTDSATDGESSSTENHNDGLSTGAKAGIGVGVSAGAIILAALAFLLWRR
FT                   IKALPSTNAVGPEGPNGGYSQVHQGYFADPPMVKAAPVPASGVVAPMSELAGDHAGEMD
FT                   AGADARRPPVELDGSELYSHHGR"
FT   gene            complement(990336..992211)
FT                   /locus_tag="ANIA_10214"
FT                   /old_locus_tag="AN10214.4"
FT                   /product="2-hydroxyphytanoyl-CoA lyase, putative
FT                   (AFU_orthologue; AFUA_8G05230)"
FT   mRNA            complement(join(990336..991901,991960..992211))
FT                   /locus_tag="ANIA_10214"
FT                   /old_locus_tag="AN10214.4"
FT                   /note="transcript_id=CADANIAT00008143"
FT   CDS_pept        complement(join(990336..991901,991960..992211))
FT                   /locus_tag="ANIA_10214"
FT                   /old_locus_tag="AN10214.4"
FT                   /product="2-hydroxyphytanoyl-CoA lyase, putative
FT                   (AFU_orthologue; AFUA_8G05230)"
FT                   /note="transcript_id=CADANIAT00008143"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008143"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008143"
FT                   /db_xref="GOA:C8VMP9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMP9"
FT                   /protein_id="CBF85026.1"
FT                   /translation="MAIRTGAQIIARSLRDLGVTVIFGIVGIPVVEIAEEAINLGIRFV
FT                   AFRNEQACSYAASVYGYMTGQPGVCLVVGGPGVLHALAGIGNSSANNFPLLVLAGSAET
FT                   SAVTKGAFQELDAISLLTPHTKFAARASSLDFIPDAIKNAYRTCWYGRPGPTFIDLPAD
FT                   IIQGKLTSQFELPKPENLLVSAPPKASGDPALILKATQLLKAASAPLIIVGKGAAYARA
FT                   ELGIRKLVDQTQVPFLPTPMGKGVVPDSHPLNASSARSAALKHADVVLVLGARLNWILH
FT                   FGEPPKWSPKVKIIQVDICAEEIGRNAGTSELGILGDISLVVDQFRASLSSWKYSSSAK
FT                   FPLLLAESAKKNEDKAQKAALRQTPAGKPLTYQRAYHIIKTALNALTPVEDGNIVYVSE
FT                   GANTMDISRSIFPLYHPRQRLDAGTYATMGVGMGYIVAAHEAFNANPGASTSRPKKIVA
FT                   FEGDSAFGFSAMEIETLARYRIPALIFVINNSGIYHGDSISKEDWKTLQNQTVANDTKT
FT                   SESDSGTNAKTKGLRSTSLLYETRYEMLATMCGGKGYFVKSEEELERATKEGFVSDTVT
FT                   IVNVIVEPGIGKEIGFAWQNQGKESKPKL"
FT   gene            complement(992454..994480)
FT                   /locus_tag="ANIA_10215"
FT                   /old_locus_tag="AN10215.4"
FT                   /product="peroxisomal targeting signal (PTS1) receptor
FT                   protein peroxin 5 (Eurofung)"
FT   mRNA            complement(join(992454..994253,994313..994480))
FT                   /locus_tag="ANIA_10215"
FT                   /old_locus_tag="AN10215.4"
FT                   /note="transcript_id=CADANIAT00008144"
FT   CDS_pept        complement(join(992454..994253,994313..994480))
FT                   /locus_tag="ANIA_10215"
FT                   /old_locus_tag="AN10215.4"
FT                   /product="peroxisomal targeting signal (PTS1) receptor
FT                   protein peroxin 5 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008144"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008144"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008144"
FT                   /db_xref="GOA:C8VMQ0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024111"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMQ0"
FT                   /protein_id="CBF85028.1"
FT                   /translation="MSFLGGAECSTAGNPLTQFTKHVQDDKSLQRDRLVGRAPGMQEGM
FT                   RSQGMMGGHDQMMDEFAQQSAQLPGGPQQHMRMEMEQVRQQLEQMHTTPRTGSPGWAAE
FT                   FDPGEQARMEAAFAGPKGPMMNNGSGFTPAEFARFQQQSTMSVPQSASPVTAGQSPMMG
FT                   GYQRSMGMGYMGYGGMGMMQPGFGPMGMQHQQPAEASTQDKGKGRMIELDDENWEAQFK
FT                   EIETADQGKLDDEANAAIEAELNDLDRSVPTTSSTEDLSHFERVWERVQAETATNRKLA
FT                   EDSEYNIDDNLHMGDMAEWDGFDNLNTRFREPRLGDYSFEQENVFRDIANPFEEGMKIM
FT                   QEGGNLSLAALAFEAAVQKDPQHVKAWTMLGTAQAQNEKELPAIRALEQALKVDPNNLD
FT                   ALMGLAVSYTNEGYDSTAYRTLERWLSVKYPQIISRDDLSSDADLGFTDRQILHERVTD
FT                   LFIQAAQLSPSGAQMDPDVQVGLGVLFYCAEEYEKAVDCFTTALASTESGTTNQREQLH
FT                   LLWNRLGATLANSGRSEEAIEAYEQALNINPNFVRARYNLGVSCINIGCYPEAAQHLLG
FT                   ALSMHRVVEEEGKERAREIVGGNDGRINEAELNRMITANQSTNLYDTLRRVFSQMGRRD
FT                   LADLVEAGMDVNIFRKEFEF"
FT   gene            complement(994869..996420)
FT                   /locus_tag="ANIA_01517"
FT                   /old_locus_tag="AN1517.4"
FT                   /product="nucleic acid-binding protein (AFU_orthologue;
FT                   AFUA_8G05260)"
FT   mRNA            complement(join(994869..995286,995362..996294,
FT                   996357..996420))
FT                   /locus_tag="ANIA_01517"
FT                   /old_locus_tag="AN1517.4"
FT                   /note="transcript_id=CADANIAT00008145"
FT   CDS_pept        complement(join(994869..995286,995362..996294,
FT                   996357..996358))
FT                   /locus_tag="ANIA_01517"
FT                   /old_locus_tag="AN1517.4"
FT                   /product="nucleic acid-binding protein (AFU_orthologue;
FT                   AFUA_8G05260)"
FT                   /note="transcript_id=CADANIAT00008145"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008145"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008145"
FT                   /db_xref="GOA:C8VMQ1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMQ1"
FT                   /protein_id="CBF85030.1"
FT                   /translation="MYTLRRAACRLLASPSPITRSRLTALPHTHLPVVVRRPITQSRRS
FT                   LGDAKSPLGSKDAPAASTATNSDTTTATATADNALDLSPPVENYAEAVEKDVMKGDLKN
FT                   ELELSSGTTGAATARAVSTKETKQEDGGTCKNLNLKSSDSTRNTSGVPTAPEYEAGAEK
FT                   VREGRPSGTIIANTAPTGATSGVPRASSNAPGAEKAQTLNQGLAAKLSLSESLTKSTTV
FT                   DEQDPDLDFDISQIREAAAQEAWAAAEKKQMTHGEKLDMLRRLQYEPKQTVFIGNLFYD
FT                   VTAEDLKKQMAKYGVVEGVNIIYDSRGISKGYGYVQFSSNAAARRAIDAMHMRIFEGRR
FT                   VTLYYAQTNITNSFKNKKPTNTLYIGNVPFEMTDRDLNDLVKDLDGLTDVRVTVDRQSG
FT                   ALRGYIHAEFLDIQSAMVAHEKLAQRRPYGRRLKIDYSKTKSAQGGFPVAV"
FT   gene            complement(996604..1000630)
FT                   /locus_tag="ANIA_01518"
FT                   /old_locus_tag="AN1518.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(996604..996834,996893..997242,
FT                   997299..998006,998056..998829,998883..998914,
FT                   998970..999192,999247..999658,999714..999982,
FT                   1000047..1000630))
FT                   /locus_tag="ANIA_01518"
FT                   /old_locus_tag="AN1518.4"
FT                   /note="transcript_id=CADANIAT00008146"
FT   CDS_pept        complement(join(997036..997242,997299..998006,
FT                   998056..998829,998883..998914,998970..999192,
FT                   999247..999658,999714..999835))
FT                   /locus_tag="ANIA_01518"
FT                   /old_locus_tag="AN1518.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008146"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008146"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008146"
FT                   /db_xref="GOA:C8VMQ2"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMQ2"
FT                   /protein_id="CBF85031.1"
FT                   /translation="MSPTPPSTTSSSNGPSPEGQYRIVRKRNRVPLSCGPCRHRKLKCN
FT                   RAHPCENCVKRGDAHSCTYAQTNSRKKNSANQAASTSPDDMQNRIDRLEGLVLSLMTNG
FT                   SQSEGPAAAMAAISGTSSSTGSAQHVHDLEIEDEGPNQEESETEQVTKSFGIMKMDNNK
FT                   SYYISDAHWASVLSEISEVKNYFNTHKKQYEEQAEKLKATKLPTDVPGSTLLFGAMKAT
FT                   SRAEIMSSFPSKYTTDMLIARYFNCYDPATHFLHGPTFQAQYNKHWEDPSQTCIVWIGM
FT                   LFAMMRLAMLSYYREGDEPPEFRGKSLDMAGTFRNLVAMCLTLADYTKPYPYLIECLAF
FT                   HLHGDFCQTKEADVSVWVLNGVIVRLAMRMGYHRDSKAFPNITPFQGEMRRRVWSFVRQ
FT                   ADLLFSCQVGLPSMIRMADSDTELPRNLYDDDFDENCKELPPSRPPNEPTPLSYLITKS
FT                   RLANVLGQAIEQTSSLQNTPYDKVIEMDSELRRARDMIPDHLLVRPFEESSLDPLGLIM
FT                   SRFSVMSVYHRAQCLLHRKYILRARENPRFIHSRRTCIDSALELLRYQSMLHVETRPTG
FT                   RLRSRQNRVTTLSSSDFLQAATIICLDLYHGYNLPSASRASSDTYAWGRDRREEMMAAV
FT                   QRSKEIWDELRDETMDAWKASGVLGVMLNGLQQRQNLEGTPVTPAFEPQDEKQSAAMTL
FT                   GLLSSGMTPIGQSATFNDVSLKPSEPPLPTLGGFGGPETNPGASSIFNNMFGQMPDMQV
FT                   NLDWDAWDNYIQGGTLDTSATWWTPMDIQQNSGPLSPSQLPATQSNPTERIRTVPRTTN
FT                   LFPNNGYENDGLT"
FT   gene            1002190..1005633
FT                   /locus_tag="ANIA_01519"
FT                   /old_locus_tag="AN1519.4"
FT                   /product="RNA interference and gene silencing protein
FT                   (Qde2), putative (AFU_orthologue; AFUA_8G05280)"
FT   mRNA            join(1002190..1002431,1002501..1003600,1003654..1003898,
FT                   1003954..1005633)
FT                   /locus_tag="ANIA_01519"
FT                   /old_locus_tag="AN1519.4"
FT                   /note="transcript_id=CADANIAT00008147"
FT   CDS_pept        join(1002190..1002431,1002501..1003600,1003654..1003898,
FT                   1003954..1005426)
FT                   /locus_tag="ANIA_01519"
FT                   /old_locus_tag="AN1519.4"
FT                   /product="RNA interference and gene silencing protein
FT                   (Qde2), putative (AFU_orthologue; AFUA_8G05280)"
FT                   /note="transcript_id=CADANIAT00008147"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008147"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008147"
FT                   /db_xref="GOA:Q5BD61"
FT                   /db_xref="InterPro:IPR003100"
FT                   /db_xref="InterPro:IPR003165"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014811"
FT                   /db_xref="InterPro:IPR032472"
FT                   /db_xref="InterPro:IPR032474"
FT                   /db_xref="InterPro:IPR036085"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD61"
FT                   /protein_id="CBF85033.1"
FT                   /translation="MSSAGGSPQRGSRGRGNDRGRGRGLFHGDRGRGRGGGRGLFNDLP
FT                   HRPAPGDPGRGGSRGRAGRGGRGGGGGLDQGPPIYLPPDGAPQPNVKVTQTENSQAAAL
FT                   VKKEKTAGYPERPGYGTQGHPIQLFANYLELKSSGKSLFRYHINIDGGGRKPSSRKAKQ
FT                   IICLLLEDHFSPFRHSIVTDYRSNLISHLEILDHEQPSVKYNVTYRSEKEDEPRDTSET
FT                   YRITCKFTGRLDPADLLNYLTSSNAASMLQEKAEILQALNIVLGHHPKSTGSIASVGTN
FT                   KHYAIHDNAAEKFDLGAGLEALRGYFVSVRAATARLLVNIQVKYVACYQDGPLYQVIRE
FT                   FQCANGRNVYALKRFLGRLRVEVTHIKRKNKRGEYIPRIKTITNLATPQDGTQDGNKCK
FT                   DAPKVKFIGAGPNDVSFFLDDPEQGKGSKKAGPKPSGTYITVAEFFKEYYRIQVDPDMP
FT                   VVNVGSIAKPSYLPVEVCDVLSGQPAKTKLSSNQTRQMLNFAVRSPAQNAHSIVTKGTQ
FT                   ILGLRDPTAATLVDFGIQTNPNLITVPGRVLAPPTVYYKDEKSKDKEIAPMSGSWNMKS
FT                   IRFSTSSNLQSWACILITAGPKQHFQSPDDLEDCLYRFTKKLREVGVNANPPVFKVRVQ
FT                   VTKENAETVIDAEIRKILHQHRPKLILTILPFNDTALYNCIKRACDVRHGVRNINVLAE
FT                   QFCKRNEQYFANVGLKFNLKLGGVNQVVRPSQLGIIGEGKTMLIGIDVTHPSPGSAKGA
FT                   PSVAAMVASVDSSLGQWPAEIRIQKEARKEMVDALDSMLKAHLRRWAANHKAAYPENII
FT                   VYRDGVSEGQYDHVTDEELPLLKNACKNIYPAPDTARNLPRFSIIIVGKRHHTRFYPTL
FT                   QEDADRFNNPVNGTVVDRGITEARNWDFFLQAHTALKGTARPAHYYTVWDEIFLRQKVI
FT                   PPAKNAADMLEAMTHHMCYLFGRATKAVSICPPAYYADLVCTRARCYLSSAFEPSTPSG
FT                   SVIGAEDSTVKVANDDVLIHPNVRDTMFYI"
FT   gene            complement(1005892..1007906)
FT                   /locus_tag="ANIA_01520"
FT                   /old_locus_tag="AN1520.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1005892..1007530,1007601..1007906))
FT                   /locus_tag="ANIA_01520"
FT                   /old_locus_tag="AN1520.4"
FT                   /note="transcript_id=CADANIAT00008148"
FT   CDS_pept        complement(join(1006220..1007530,1007601..1007906))
FT                   /locus_tag="ANIA_01520"
FT                   /old_locus_tag="AN1520.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008148"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008148"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008148"
FT                   /db_xref="GOA:Q5BD60"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD60"
FT                   /protein_id="CBF85035.1"
FT                   /translation="MSLKDVYQKFLASPNSASLASDVSLIYITSTTEINGADRVIKHLS
FT                   RQQELKINSQTVLDTVQGSNALCLDIETSLQFLTGGGAYLPNLDETFLFDRVAKFPTIH
FT                   IVRFNANNEIQSIRIYWDQASLLKQVEVIGNRSRNWPVRDADKQTRLIRFASESAPADN
FT                   GPPPAARPEPSSTGKDEAHEAPEAREGSPGKKHIKDPYAAESLFELLSPCKDRGEPVHR
FT                   PRAPASAQPPPRDYKELFVGDEGNDDAPETPSRARAIAPKVGAGKHFAPSRIFEPEEVE
FT                   PSPVVPKLGAGRHFAPSRIFGDDNETASREKPEQIAYRAHPKRFEHFELGGDNSSREIK
FT                   PTTSRPGSRHVKNWDFEDFSTPPKAKRGPRGEEVRHFGWSDDEPEQDTPPARPRVVQPR
FT                   RDAETHFQIADGEEQGNKRIIRSYGNKGLGLYKDTLYAEAEDLEAEGSAKQQASKERPL
FT                   SVVQNGPNRKKDFESHWDDPEATVSHENKKPTGDRVKAAKALESSWHFDKSPEPSKESR
FT                   PPQRRVLKNVNQRSWGFEDEE"
FT   gene            complement(1008887..1009863)
FT                   /locus_tag="ANIA_01521"
FT                   /old_locus_tag="AN1521.4"
FT                   /product="RNA polymerase II subunit 7 (AFU_orthologue;
FT                   AFUA_8G05300)"
FT   mRNA            complement(join(1008887..1008896,1008959..1009128,
FT                   1009189..1009269,1009319..1009863))
FT                   /locus_tag="ANIA_01521"
FT                   /old_locus_tag="AN1521.4"
FT                   /note="transcript_id=CADANIAT00008149"
FT   CDS_pept        complement(join(1008887..1008896,1008959..1009128,
FT                   1009189..1009269,1009319..1009567))
FT                   /locus_tag="ANIA_01521"
FT                   /old_locus_tag="AN1521.4"
FT                   /product="RNA polymerase II subunit 7 (AFU_orthologue;
FT                   AFUA_8G05300)"
FT                   /note="transcript_id=CADANIAT00008149"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008149"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008149"
FT                   /db_xref="GOA:Q5BD59"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD59"
FT                   /protein_id="CBF85037.1"
FT                   /translation="MFFLKEETKVITLHPSYFGPNVREYLINRLNEEEEGRCTGDHFVI
FT                   CVMDMVDIGEGRVLPGNGQAEYTIKYRAIIWKPFRGETVDALVTSVKPTGIFTLAGPLS
FT                   VFIARKNIPSDIRWEPNTVPPQYTDHADQVIEKGTSLRLKILGVKPDVAAINAIGTIKE
FT                   DYLGPL"
FT   gene            1010338..1011084
FT                   /locus_tag="ANIA_01522"
FT                   /old_locus_tag="AN1522.4"
FT                   /product="DUF962 domain protein (AFU_orthologue;
FT                   AFUA_8G05310)"
FT   mRNA            join(1010338..1010370,1010509..1010568,1010632..1011084)
FT                   /locus_tag="ANIA_01522"
FT                   /old_locus_tag="AN1522.4"
FT                   /note="transcript_id=CADANIAT00008150"
FT   CDS_pept        join(1010338..1010370,1010509..1010568,1010632..1011084)
FT                   /locus_tag="ANIA_01522"
FT                   /old_locus_tag="AN1522.4"
FT                   /product="DUF962 domain protein (AFU_orthologue;
FT                   AFUA_8G05310)"
FT                   /note="transcript_id=CADANIAT00008150"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008150"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008150"
FT                   /db_xref="GOA:Q5BD58"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD58"
FT                   /protein_id="CBF85039.1"
FT                   /translation="MALNLEKQLLFVNVAIHITCVPILLFTGIAMASNSPPLIKLPEVL
FT                   QFEDLPPNIGTIAALFYAIFYVLLEPVAGTLIAPLLLGAAALGNRLIATYGMTVNYWFG
FT                   GIHVVSWLLQFVGHGAFEGRAPALLDNLVQALLLAPLFVWMEILFFFGYRPELRARYEA
FT                   SVKKEIAAFKEKRNKALK"
FT   gene            1011942..1014534
FT                   /locus_tag="ANIA_01523"
FT                   /old_locus_tag="AN1523.4"
FT                   /product="ATP synthase alpha chain, mitochondrial precursor
FT                   (Broad)"
FT   mRNA            join(1011942..1012100,1012280..1012449,1012586..1012642,
FT                   1012699..1012819,1012882..1014534)
FT                   /locus_tag="ANIA_01523"
FT                   /old_locus_tag="AN1523.4"
FT                   /note="transcript_id=CADANIAT00008151"
FT   CDS_pept        join(1012029..1012100,1012280..1012449,1012586..1012642,
FT                   1012699..1012819,1012882..1014132)
FT                   /locus_tag="ANIA_01523"
FT                   /old_locus_tag="AN1523.4"
FT                   /product="ATP synthase alpha chain, mitochondrial precursor
FT                   (Broad)"
FT                   /note="transcript_id=CADANIAT00008151"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008151"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008151"
FT                   /db_xref="GOA:C8VMQ7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMQ7"
FT                   /protein_id="CBF85040.1"
FT                   /translation="MFRNALRQSSRTVAAATATGRIASVRAAVPGPLSAASKQVRTYAA
FT                   EAKASPTEVSSILEQRIRGVQEESGLAETGRVLSVGDGIARVHGMTNVQAEELVEFASG
FT                   VKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVDVPVGPELLGRVVDALGNPIDG
FT                   KGPINASTKSRAQLKAPGILPRRSVNQPVQTGLKCVDSMVPIGRGQRELIIGDRQTGKT
FT                   AVALDAMLNQKRWNNTSDESKKLYCIYVAVGQKRSTVAQLVKTLEENDAMKYSIVVAAT
FT                   ASEAAPLQYLAPFTGCAMGEWFRDNGRHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAY
FT                   PGDVFYLHSRLLERAAKMNDKHGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLE
FT                   AELFYKGIRPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDA
FT                   STKQTLNRGQRLTELLKQKQYSPMAVSDMVPLIFAGVNGYLDNIPVAKILQWESDFLAY
FT                   LKSNHPEVQETIEKEGQVSKELEAKLKDIIPSFNKSFNA"
FT   gene            1014962..1016458
FT                   /locus_tag="ANIA_01524"
FT                   /old_locus_tag="AN1524.4"
FT                   /product="methylenetetrahydrofolate dehydrogenase
FT                   (AFU_orthologue; AFUA_8G05330)"
FT   mRNA            join(1014962..1015204,1015364..1015997,1016055..1016144,
FT                   1016199..1016458)
FT                   /locus_tag="ANIA_01524"
FT                   /old_locus_tag="AN1524.4"
FT                   /note="transcript_id=CADANIAT00008152"
FT   CDS_pept        join(1015008..1015204,1015364..1015997,1016055..1016144,
FT                   1016199..1016282)
FT                   /locus_tag="ANIA_01524"
FT                   /old_locus_tag="AN1524.4"
FT                   /product="methylenetetrahydrofolate dehydrogenase
FT                   (AFU_orthologue; AFUA_8G05330)"
FT                   /note="transcript_id=CADANIAT00008152"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008152"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008152"
FT                   /db_xref="GOA:Q5BD56"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD56"
FT                   /protein_id="CBF85042.1"
FT                   /translation="MATPSEPAPTNCKVMLSKHVANGLLAEVSEGIKTLEKPPHLVGFL
FT                   ANNDPAALMYAQWTEKTCHENGFRYSLREVHRDNLEEAILAANVDPDVDGIIVYYPIFN
FT                   NRQDQYLQQIVDVSKDVEGLSHRYIFNMYQNIRFLDPETKRQKCILPCTPLAIVKILEH
FT                   LNIYNTVLPYGNRLHGHTICVVNRSEVVGRPLAALLANDGACVYSVDITGIQKFYRGTG
FT                   LKLGRHEVEDVEGKELKDIVPLCDTVISGVPGDKYKFDTSLLRDGAVCINFSSEKNFGP
FT                   EVKQKASIFVPSIGKVTIVVLLRNLLRLIQNKRMDDIKPAAATERPGTLEAAS"
FT   gene            complement(1016599..1017412)
FT                   /locus_tag="ANIA_01525"
FT                   /old_locus_tag="AN1525.4"
FT                   /product="signal peptidase complex component, putative
FT                   (AFU_orthologue; AFUA_8G05340)"
FT   mRNA            complement(join(1016599..1016895,1017002..1017244,
FT                   1017410..1017412))
FT                   /locus_tag="ANIA_01525"
FT                   /old_locus_tag="AN1525.4"
FT                   /note="transcript_id=CADANIAT00008153"
FT   CDS_pept        complement(join(1016599..1016895,1017002..1017244,
FT                   1017410..1017412))
FT                   /locus_tag="ANIA_01525"
FT                   /old_locus_tag="AN1525.4"
FT                   /product="signal peptidase complex component, putative
FT                   (AFU_orthologue; AFUA_8G05340)"
FT                   /note="transcript_id=CADANIAT00008153"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008153"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008153"
FT                   /db_xref="GOA:Q5BD55"
FT                   /db_xref="InterPro:IPR009582"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD55"
FT                   /protein_id="CBF85044.1"
FT                   /translation="MPYTFKQDHFKTNVRFIVGYSAVAIAAFTFYADRKLGWEATTSSW
FT                   VIAAVGSYFILNSLLTYWVWAVEASEVFRGKRKSGETISIRSSVKKHTPLYRLQIQYKS
FT                   ASNSVLEEKEIVSPFTAWFSADGTFHPEPLRKWLANEINVLRLAAQETRKKTGGVASVV
FT                   GVEETENKEVKDAKKRR"
FT   gene            1017694..1018764
FT                   /locus_tag="ANIA_01526"
FT                   /old_locus_tag="AN1526.4"
FT                   /product="DUF850 domain protein (AFU_orthologue;
FT                   AFUA_8G05350)"
FT   mRNA            join(1017694..1017776,1017837..1017870,1017922..1018288,
FT                   1018348..1018509,1018577..1018764)
FT                   /locus_tag="ANIA_01526"
FT                   /old_locus_tag="AN1526.4"
FT                   /note="transcript_id=CADANIAT00008154"
FT   CDS_pept        join(1017727..1017776,1017837..1017870,1017922..1018288,
FT                   1018348..1018509,1018577..1018764)
FT                   /locus_tag="ANIA_01526"
FT                   /old_locus_tag="AN1526.4"
FT                   /product="DUF850 domain protein (AFU_orthologue;
FT                   AFUA_8G05350)"
FT                   /note="transcript_id=CADANIAT00008154"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008154"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008154"
FT                   /db_xref="GOA:Q5BD54"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR008568"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD54"
FT                   /protein_id="CBF85046.1"
FT                   /translation="MALQGVEQTILRDPALFYWILIPISVVMILTGMLRHYATILMNSP
FT                   PKPPATLAESRERLSLFRAVNLRNHAPAVLSKEAFEMRKNYLVTGFQTGAFLKDPNSRG
FT                   QPPANPMSDPAAMEGMMGMMKGNMMMMIPQTLIMSWINAFFSGFVILKLPFPLTIRFKS
FT                   MLQSGVMTRDLDVRWVSSLSWYFLNLFGLQSVFGFILGSDNAANHMAQQMGPMGPAAGA
FT                   NPFQPGQDPHKMYLNEAENLEVFEHFSILDGIEDRVLRKYGAAQ"
FT   gene            complement(1018850..1019776)
FT                   /locus_tag="ANIA_01527"
FT                   /old_locus_tag="AN1527.4"
FT                   /product="FAS1 domain-containing protein AN1527 Precursor
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BD53]"
FT   mRNA            complement(join(1018850..1019086,1019141..1019776))
FT                   /locus_tag="ANIA_01527"
FT                   /old_locus_tag="AN1527.4"
FT                   /note="transcript_id=CADANIAT00008155"
FT   CDS_pept        complement(join(1019000..1019086,1019141..1019776))
FT                   /locus_tag="ANIA_01527"
FT                   /old_locus_tag="AN1527.4"
FT                   /product="FAS1 domain-containing protein AN1527 Precursor
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BD53]"
FT                   /note="transcript_id=CADANIAT00008155"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008155"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008155"
FT                   /db_xref="GOA:Q5BD53"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="InterPro:IPR040200"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD53"
FT                   /protein_id="CBF85048.1"
FT                   /translation="MRQLSTTALVLFLFFYCSISTAWSLPYFAYRKRIPEPLLNKPRSR
FT                   HARSIEDLDGLKEWLSNQQPLRGAVMAPPSEDNKRTVTVKGGANNEPTISDVLPKTRGI
FT                   NIYASLTRQFETVERRLKDQTQNVTVLAPRNSAIQDLPHKPWENPDDYEKFGEMNAYEG
FT                   DKGQDRAKRNLERFVSAHVVAQSPWREGEEAETLGGDKLTWRKDGDRIYIEPERIRVES
FT                   IAEQVSNGEVWVIDGVIN"
FT   gene            1020035..1023649
FT                   /locus_tag="ANIA_01528"
FT                   /old_locus_tag="AN1528.4"
FT                   /product="DNA repair and TFIIH regulator (Eurofung)"
FT   mRNA            join(1020035..1020110,1020170..1020443,1020524..1020663,
FT                   1020711..1020808,1020859..1021047,1021100..1022002,
FT                   1022051..1023649)
FT                   /locus_tag="ANIA_01528"
FT                   /old_locus_tag="AN1528.4"
FT                   /note="transcript_id=CADANIAT00008156"
FT   CDS_pept        join(1020050..1020110,1020170..1020443,1020524..1020663,
FT                   1020711..1020808,1020859..1021047,1021100..1022002,
FT                   1022051..1023535)
FT                   /locus_tag="ANIA_01528"
FT                   /old_locus_tag="AN1528.4"
FT                   /product="DNA repair and TFIIH regulator (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008156"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008156"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008156"
FT                   /db_xref="GOA:C8VMR2"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024687"
FT                   /db_xref="InterPro:IPR029240"
FT                   /db_xref="InterPro:IPR039920"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMR2"
FT                   /protein_id="CBF85050.1"
FT                   /translation="MLVVDHDKQEARQIAERIAQDIENKKTTLVEVVQSLGEYVNDEDP
FT                   LLRGKAVSYLSAVIKALPPKFLTRQQVQVLTTFFCDRIGDAGAVTGLETLQKLDRFTKE
FT                   MAEELATALFENFNTLQSRAQSQRFQVYQLLNELMSNHRSGLSRLPFGVFRILTDLMTG
FT                   EKDPRNLMLVFSILKVIMVEWDISRHVELLFDSVYNYFPITFRPPPNDPYGITAQDLKD
FT                   RLQDCISSTSHFAPHSIPALLDKLDSTSQNVKKDALNALIACINSYNPDTVSTYSITIW
FT                   ETLKFEVLNAQEELLSDLSLKALHDIARRLSEGVMQIHDQLPLAQYLRPITKECNEQLR
FT                   EPQQKQAKPAQKILKAVSEASAPSFTLVAQVVIAPLLTLYQGADGITKQRALLETLTLL
FT                   FESAISVFGEWTTRNPETSAENPLLEFKDQFSEIFGQALMSTVKEEVSFRVSALKGFLR
FT                   LSVLRDYFHESEIGLFVQYLDEILLTEEPVGRDDLKREAIAALAEVSKHQPRLIMDITF
FT                   PAFVATLPDSDEGTDTSYLPTLETLAQISVEKAIFETLPGSVAYPRAILMTIFYVMNQR
FT                   RLDGEPGLEMYYDKIVVAMCRNAAATALGKAKNNILGDTTVLDVLGRLCNLIVRSLPRL
FT                   KQDEVTKNIYALFALPEDFQPVPFAQSPSEDQRRTMILSTYLLAGLPVDSKLPHSTPNM
FT                   ADLLSYLVKLSIAETSPQIQLAILRHIALLVNKFLPKSELEIANTLLNSFLFTDTTTAL
FT                   EPTPEAVRTVFWLSKALILRLAPTTTQILTSLLHLLSSPSEQTSTTASRGFAILLKDDD
FT                   VLSPINGANIRLLSKQRVFTTLVPLISTKIREININSSGTTMMAAEQDKAYMKPAHLTA
FT                   LSGILSTIPPALVMPELPTLLPLLLQSLDLQTATRDSFAVRAATLQTLSVIIRENGVGV
FT                   IEECGHVQSLVTRLLKTAEHKPLPAASASEKTGEGAAVNAPRLRVDALRCLFLLAQPRN
FT                   AENAPAVAKAGKLSPLLPVRSQVLRALKVVLDDPKRDVRKAAVDARGAWLRGIEDAEDD
FT                   D"
FT   gene            complement(1023998..1025515)
FT                   /pseudo
FT                   /locus_tag="ANIA_01529"
FT                   /old_locus_tag="AN1529.4"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(1023998..1025515)
FT                   /pseudo
FT                   /locus_tag="ANIA_01529"
FT                   /old_locus_tag="AN1529.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00010581"
FT   gene            complement(1026514..1027883)
FT                   /locus_tag="ANIA_01531"
FT                   /old_locus_tag="AN1531.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1026514..1027352,1027428..1027883))
FT                   /locus_tag="ANIA_01531"
FT                   /old_locus_tag="AN1531.4"
FT                   /note="transcript_id=CADANIAT00008157"
FT   CDS_pept        complement(join(1026514..1027352,1027428..1027653))
FT                   /locus_tag="ANIA_01531"
FT                   /old_locus_tag="AN1531.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008157"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008157"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008157"
FT                   /db_xref="GOA:Q5BD49"
FT                   /db_xref="InterPro:IPR031398"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD49"
FT                   /protein_id="CBF85052.1"
FT                   /translation="MPSIVRFGRPKKSSKPETENANSTPHVSATPNSFRAPRISLPHVD
FT                   AELNMAQHNGLFEVDPPERQKGTEAAETIMDSTSPPPSYISNASANPMNGDATGAEWSS
FT                   AVGHAATGKSGRVIHNLQEDIARLTRECSVYRSRAEETQRMNEAFKTQVQNMTDRLRNL
FT                   EHSNEMNLHSLSRKEKKIEELRAELKGERDRRQQADDEKARFRQLMDEAQDGFHQKCAE
FT                   LQEIAHHAQTQYDVLVKSGQRERADQQRRLKNIRDEFIALREAHNQTNSQLSQLDAIMA
FT                   QKDQEIERGRANFDALFKEYEAYKRAHDEEVRDLIKQTRQGEAKFNATLASLKETESQM
FT                   KWVVQVKREVKDAE"
FT   misc_feature    1027453..1255349
FT                   /note="contig 1.25 1206..229102(1)"
FT   gene            complement(1028839..1029760)
FT                   /locus_tag="ANIA_01532"
FT                   /old_locus_tag="AN1532.4"
FT                   /product="extracellular matrix protein, putative
FT                   (AFU_orthologue; AFUA_8G05410)"
FT   mRNA            complement(join(1028839..1029282,1029330..1029760))
FT                   /locus_tag="ANIA_01532"
FT                   /old_locus_tag="AN1532.4"
FT                   /note="transcript_id=CADANIAT00008158"
FT   CDS_pept        complement(join(1028839..1029282,1029330..1029470))
FT                   /locus_tag="ANIA_01532"
FT                   /old_locus_tag="AN1532.4"
FT                   /product="extracellular matrix protein, putative
FT                   (AFU_orthologue; AFUA_8G05410)"
FT                   /note="transcript_id=CADANIAT00008158"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008158"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008158"
FT                   /db_xref="GOA:C8VMR4"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMR4"
FT                   /protein_id="CBF85054.1"
FT                   /translation="MHPLRPLLATWACLAQVSFAAVSFTKWPTTIHTGKPATVYWKGDS
FT                   DTPVTITLRQGPAGNLRTLKVLTHDAQGGSFTWVPDESLAPGSDYALQIEQDGSINYSG
FT                   LVTLVDQSGKKPQPSASKHTPVSSPLGGARTSVQKGNNGYIPTLNSSSARVNMTSGKST
FT                   AHKTSNDGVTFRYISAEMILAAMAAVVYFAA"
FT   gene            complement(1030026..1030446)
FT                   /locus_tag="ANIA_11305"
FT                   /old_locus_tag="AN11305.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(1030026..1030152,1030310..1030347,
FT                   1030387..1030446))
FT                   /locus_tag="ANIA_11305"
FT                   /old_locus_tag="AN11305.4"
FT                   /note="transcript_id=CADANIAT00008159"
FT   CDS_pept        complement(join(1030026..1030152,1030310..1030347,
FT                   1030387..1030446))
FT                   /locus_tag="ANIA_11305"
FT                   /old_locus_tag="AN11305.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008159"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008159"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008159"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMR5"
FT                   /protein_id="CBF85056.1"
FT                   /translation="MSYGVERKGFEMELMCVSYGVQRVTSQSGLYHLQEEPEMAGTPLV
FT                   SLKHGEADVTSAFGSIPKPTAKSQCVFSL"
FT   gene            complement(1031308..1033403)
FT                   /locus_tag="ANIA_01533"
FT                   /old_locus_tag="AN1533.4"
FT                   /product="putative CCAAT-box-binding transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(1031308..1031447,1031684..1032645,
FT                   1032704..1032915,1032967..1033403))
FT                   /locus_tag="ANIA_01533"
FT                   /old_locus_tag="AN1533.4"
FT                   /note="transcript_id=CADANIAT00008160"
FT   CDS_pept        complement(join(1031308..1031447,1031684..1032645,
FT                   1032704..1032915,1032967..1033374))
FT                   /locus_tag="ANIA_01533"
FT                   /old_locus_tag="AN1533.4"
FT                   /product="putative CCAAT-box-binding transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008160"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008160"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008160"
FT                   /db_xref="GOA:C8VMR6"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027193"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMR6"
FT                   /protein_id="CBF85058.1"
FT                   /translation="MPAIIDNSIASKKRKGSKESGVPSSKRRAVAENASAESMAKIQQL
FT                   EDQISESRKNYNNIATLLSMLSEDGTSVKPNLAVAVSLCRVFSRLIAGGNLTVGERAPE
FT                   NEKIVVAWLKERCREYQRLLESFMRESDASSQITALTLAMRLLNERATHIPGDDTQAWT
FT                   SGLFRNIFEAVVEAKDGQALRSEFLEKFLKPYEDVTYYTFMQVGEYASTPRSTEILETL
FT                   VTILSTCDTVPGPEHKFSNFYSKVSNKNKKLVSVNSYKKRAQDAWLSILRNDLSQPLRK
FT                   TLLRIMVHHIEPWFNRPEYLMDFLTDSYNVGGATSLLALSGLFYLIQEKNLDYPQFYPK
FT                   LYSLLDADLLHSKHRSRFFRLLNTFLASTHLPATLVASFIKRLSRLALNAPPAAVVAIV
FT                   PFIYNLFKNHPTCTFMLHRVIRDKEFQAELEAEGMDDPFDPEESDPDQTGAIESSLWEI
FT                   ESLQSHYHPNVASIARIISEQFTKHSYNLEDFLDYTYQGMLQAELGTGEKPLKKIPVVE
FT                   YQIPKRIFTDHHKHNATLMLQYHATHSLMRKQAGVTDCDPPCFHQSSEIRKFLDIE"
FT   gene            1033599..1034708
FT                   /locus_tag="ANIA_01534"
FT                   /old_locus_tag="AN1534.4"
FT                   /product="ATP synthase subunit 4, mitochondrial precursor
FT                   (Broad)"
FT   mRNA            join(1033599..1033647,1033712..1034160,1034243..1034465,
FT                   1034524..1034708)
FT                   /locus_tag="ANIA_01534"
FT                   /old_locus_tag="AN1534.4"
FT                   /note="transcript_id=CADANIAT00008161"
FT   CDS_pept        join(1033617..1033647,1033712..1034160,1034243..1034465,
FT                   1034524..1034549)
FT                   /locus_tag="ANIA_01534"
FT                   /old_locus_tag="AN1534.4"
FT                   /product="ATP synthase subunit 4, mitochondrial precursor
FT                   (Broad)"
FT                   /note="transcript_id=CADANIAT00008161"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008161"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008161"
FT                   /db_xref="GOA:Q5BD46"
FT                   /db_xref="InterPro:IPR008688"
FT                   /db_xref="InterPro:IPR013837"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD46"
FT                   /protein_id="CBF85060.1"
FT                   /translation="MASRLAKSAIGVTRLRPTLASRNVAAVTLSATRAASNVPTEDPKQ
FT                   KAQSILDSLPGNSLVSKTAILSATAGLSIAAISNELYVMNEETVAAFCLLSVFTAVAKY
FT                   GGPAYKEWAEAQVQKHKDILNAARADHTNAVKQRMENVKELSGVVDLTKQLFEVSKETA
FT                   KLEAQAYELEQRTALAAEAKQVLDSWVRYEGQVKQRQQRELAETVIGKIQKELQNPKTL
FT                   QQILNQSVADVERIMSSKAQ"
FT   gene            1035484..1037342
FT                   /locus_tag="ANIA_01535"
FT                   /old_locus_tag="AN1535.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1035484..1036035,1036089..1036128,1036199..1036292,
FT                   1036359..1036665,1036814..1036878,1037225..1037342)
FT                   /locus_tag="ANIA_01535"
FT                   /old_locus_tag="AN1535.4"
FT                   /note="transcript_id=CADANIAT00008162"
FT   CDS_pept        join(1035484..1036035,1036089..1036128,1036199..1036292,
FT                   1036359..1036665,1036814..1036878,1037225..1037342)
FT                   /locus_tag="ANIA_01535"
FT                   /old_locus_tag="AN1535.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008162"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008162"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008162"
FT                   /db_xref="GOA:Q5BD45"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD45"
FT                   /protein_id="CBF85062.1"
FT                   /translation="MPLRDILHKKDRLNNTSDQYATDTLDAANSVPEIRFIRSDTTTQE
FT                   IIIPPNHDVDHEDRLASPRPSSSSSHRRTLNPFHRSRTPPDPQDPGSPRERRFSGFLRR
FT                   GSSSSSVNLPPDLPQIAADAGDEQEREAQWEKRATVLAQQSPRYGSPSHSPAPSMGLGS
FT                   ENVRPRSRSSSHSRINDPQGDVNILEAIRLHEAGELEQSTSMFAQLADTTGANNALSQV
FT                   LYGLALRHGWGCRPDPEKAVVYLSAAASNSASIEAQALEAGLKKGGAAKGELVLAIFEL
FT                   GNCFRNGWGVKKDPAAARQYFETAANLGDTDAMNEVAWCYLEGFGGKKDKFMAAKYYRL
FT                   AESKGNKIVGNSCKSAHLQPLSKTGTRHLGAPAQPYHAPQPYHAPGSRTDG"
FT   gene            complement(1039695..1042133)
FT                   /locus_tag="ANIA_01536"
FT                   /old_locus_tag="AN1536.4"
FT                   /product="b-zip transcription factor (Eurofung)"
FT   mRNA            complement(join(1039695..1041277,1041331..1042133))
FT                   /locus_tag="ANIA_01536"
FT                   /old_locus_tag="AN1536.4"
FT                   /note="transcript_id=CADANIAT00008163"
FT   CDS_pept        complement(join(1040197..1041277,1041331..1042133))
FT                   /locus_tag="ANIA_01536"
FT                   /old_locus_tag="AN1536.4"
FT                   /product="b-zip transcription factor (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008163"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008163"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008163"
FT                   /db_xref="GOA:Q5BD44"
FT                   /db_xref="InterPro:IPR004826"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD44"
FT                   /protein_id="CBF85064.1"
FT                   /translation="MARYSQPVFDFYHQHPSTLDTKTQPSAYPEDDEMSVLDDKILDTT
FT                   SSDFTSPADHRRHSYEQGPDAFQHRDSVWSDISQSLSSTQSRQNSQVGHPFFESAPNPF
FT                   MRMDGLPYVHSQQWSISKDSGSCTPSAMYENYPTDMENTSVAPFAGGAVGPVNTVSMPS
FT                   MTYRQHMAFAPAGAVAMSPQSSQGWMPASTDMPDPSSRPKNSPTYRNSSPLSVRRDGIR
FT                   KKNARFEIPAERTLSNIDHLIAQSTNEEEIKELKQQKRLLRNRQAALDSRQRKKLHTEK
FT                   LEEEKKHFTQAINELEEELQNMRLREAELLREKEEWMATQQKISEYINSLHMDKDELIR
FT                   AHTLETADLRKKNNILKETVEKMERRVRTNVSNEFSDFENLTMESSPWEDFTMVNSLSL
FT                   DTDSVAPAAQPSQAMVVATNEKGSEKHANEYPFSWNAFYMCLLFGAFIASNSASLPARS
FT                   LPRLSEEYRAESANVLKAVLASSPPELAQSSSNQPPVSSSVGLLPTTITGAEMAQMTGS
FT                   APTSNLDELHETLAMPTKEQEQEQAFALNAEQYNSLTTFDETGAGYKSQQPSNLQQALA
FT                   AMRGNAAQARTPLKATSDVYSRSLLWDRVPEKVIRDFRRMVQEYGAPAARE"
FT   gene            complement(1047060..1048953)
FT                   /locus_tag="ANIA_01537"
FT                   /old_locus_tag="AN1537.4"
FT                   /product="CCCH zinc finger protein (AFU_orthologue;
FT                   AFUA_8G05480)"
FT   mRNA            complement(join(1047060..1047916,1048010..1048065,
FT                   1048115..1048856,1048908..1048953))
FT                   /locus_tag="ANIA_01537"
FT                   /old_locus_tag="AN1537.4"
FT                   /note="transcript_id=CADANIAT00008164"
FT   CDS_pept        complement(join(1047357..1047916,1048010..1048065,
FT                   1048115..1048856,1048908..1048953))
FT                   /locus_tag="ANIA_01537"
FT                   /old_locus_tag="AN1537.4"
FT                   /product="CCCH zinc finger protein (AFU_orthologue;
FT                   AFUA_8G05480)"
FT                   /note="transcript_id=CADANIAT00008164"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008164"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008164"
FT                   /db_xref="GOA:C8VMX4"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMX4"
FT                   /protein_id="CBF85065.1"
FT                   /translation="MSEDQDLMARISQLAGQINRFKNGNTPVQSAHNEMHSNSHVSRHT
FT                   SYRGRPGWAPYRGRPYGRGRGAAPHRHRTLILNNSATPASKSSTPPDGMAIDTDENSRS
FT                   ATPNAWVTKHARHMQLINSAVYDKEAQKRVKALEETRKAKAQKKAQIEQAKVLQFAHGA
FT                   GRQFSSSSNPQVSAAGESHGEYQITLNDIPFRVSRGGGKLIRVSSATPVLSALIERAGL
FT                   QIVDDPNTANNTPKRVKVAGVTFVRSKNGNLHRLGAVTSKRVPSAVKKKDELCQRFTTT
FT                   GTCYKGPSCPYIHDPNKVAICKDFLQTGKCSAGNSCDLSHEPSPHRSPACVHFLRGRCS
FT                   NPECRYAHVRVTPGAPVCRAFATLGYCDKGETCEERHVHECPDYANTGVCKKKHCRLPH
FT                   VDRAGQIRKNAGPKEGEGDDESDASSEEEEFDEIGSDDVDSDYLSDEGELIEGTETGEV
FT                   SKQQDFIRL"
FT   gene            complement(1049310..1050580)
FT                   /locus_tag="ANIA_01538"
FT                   /old_locus_tag="AN1538.4"
FT                   /product="transcription initiation factor iif, beta subunit
FT                   (AFU_orthologue; AFUA_8G05490)"
FT   mRNA            complement(join(1049310..1049690,1049742..1049938,
FT                   1049988..1050252,1050350..1050580))
FT                   /locus_tag="ANIA_01538"
FT                   /old_locus_tag="AN1538.4"
FT                   /note="transcript_id=CADANIAT00008165"
FT   CDS_pept        complement(join(1049310..1049690,1049742..1049938,
FT                   1049988..1050252,1050350..1050580))
FT                   /locus_tag="ANIA_01538"
FT                   /old_locus_tag="AN1538.4"
FT                   /product="transcription initiation factor iif, beta subunit
FT                   (AFU_orthologue; AFUA_8G05490)"
FT                   /note="transcript_id=CADANIAT00008165"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008165"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008165"
FT                   /db_xref="GOA:Q5BD42"
FT                   /db_xref="InterPro:IPR003196"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040450"
FT                   /db_xref="InterPro:IPR040504"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD42"
FT                   /protein_id="CBF85067.1"
FT                   /translation="MFSHIKQEHDASSPYIKPDPETKDTVLADIDDEDVYEDDGDLDFT
FT                   NADQSLWLSRIPRSLWEHWSKLDDDDEIQIGTVSLRLTESEENRDIPKDYILSRQTLNS
FT                   ENLLHMTQNTYLFTEKDIPGYENRMVTFGEARSALYESMKRDARRKERKKKWEPYIRKT
FT                   IPKRTALVGQVKEEFNCLPVENEEFRILSEKKALEALKPRREVKYVDKMPAKLLQQRHA
FT                   LPGEQGAFVQATKPAKLKAQENKTTRMPQNELLDLIYQCFREYRYWPFKTLKARLRQPE
FT                   AYLKQTLEMIAHLVKSGDFAMTWELKPEARESNYSNAMDVKQEAAPGLDYNFDEGSETD
FT                   AMASGVDNDDTQFENVV"
FT   gene            1051269..1052507
FT                   /gene="csnD"
FT                   /locus_tag="ANIA_01539"
FT                   /old_locus_tag="AN1539.4"
FT                   /product="COP9 signalosome complex subunit 4 (Signalosome
FT                   subunit 4) [Source:UniProtKB/Swiss-Prot;Acc:Q9C467]"
FT   mRNA            1051269..1052507
FT                   /gene="csnD"
FT                   /locus_tag="ANIA_01539"
FT                   /old_locus_tag="AN1539.4"
FT                   /note="transcript_id=CADANIAT00008166"
FT   CDS_pept        1051281..1052507
FT                   /gene="csnD"
FT                   /locus_tag="ANIA_01539"
FT                   /old_locus_tag="AN1539.4"
FT                   /product="COP9 signalosome complex subunit 4 (Signalosome
FT                   subunit 4) [Source:UniProtKB/Swiss-Prot;Acc:Q9C467]"
FT                   /note="transcript_id=CADANIAT00008166"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008166"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008166"
FT                   /db_xref="GOA:Q9C467"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037754"
FT                   /db_xref="InterPro:IPR040134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C467"
FT                   /protein_id="CBF85069.1"
FT                   /translation="MPSQKIISALAEIESSASPQNKLQLYNDLLSETVSASPEPQLADD
FT                   LIYYLDSVLSEDLSIVAARPILDSFIYTLRKLSSETQIKVAQHAVNLLQSRSASVEEQD
FT                   AQIREILADAYEAEEEYIAAARALQGIHIDSSQRLVSDSAKVKLWIRIVRLYLEEDDTT
FT                   SAEAFLNRIKNLPSKIEDHELKLHFRLSQARIQDARRRFLDASQEYFAVSLAAGVDESD
FT                   RLQALAAAIRCAVLAPAGPQRSRTLATLYKDDRATSVEEFGILEKMFLDRLLTPEEVSA
FT                   FAQRLAPHQLAQTADGTTVLDKAVVEHNLVAASKLYENIKTDALGAILGLQASGDLTAG
FT                   EKAEAYAARMVEQGRLSGSIDQIDGIIYFESNTTATGRHIRQWDAGVQGLSEGVERVAT
FT                   NIAEGHLVR"
FT   gene            complement(1053210..1054240)
FT                   /locus_tag="ANIA_01540"
FT                   /old_locus_tag="AN1540.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_8G05510)"
FT   mRNA            complement(join(1053210..1054034,1054087..1054157,
FT                   1054219..1054240))
FT                   /locus_tag="ANIA_01540"
FT                   /old_locus_tag="AN1540.4"
FT                   /note="transcript_id=CADANIAT00008167"
FT   CDS_pept        complement(join(1053210..1054034,1054087..1054157,
FT                   1054219..1054240))
FT                   /locus_tag="ANIA_01540"
FT                   /old_locus_tag="AN1540.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_8G05510)"
FT                   /note="transcript_id=CADANIAT00008167"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008167"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008167"
FT                   /db_xref="GOA:Q5BD40"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD40"
FT                   /protein_id="CBF85071.1"
FT                   /translation="MHIELVLWVVIGGNGSHQADLSEKTMQNFFKIFLANQFTYFALSP
FT                   AIKISIVCFYRRVFAIQTFQWTSFAINTLIALWGAAIFIACGLQCRPLNAYWDHTVVGN
FT                   CFDSNKYIIVNQVFNVLMDFVILALPIPMIWNLQRSWQDKLALNGVFAVGGVVCLASIY
FT                   RIVVLFWINPADITYTVYEATLWTHIEPSIGLICACLPIIRGLFPQFKLSAGRVDNATY
FT                   YGRTYQTTTSTSHTPLSPSLKSPLSEKFFAHQLEEIRSNKAPSLPATPHDNSEFYQGSL
FT                   SPFAIEVRTDIDVENSGQSVRSYK"
FT   gene            1056809..1058442
FT                   /locus_tag="ANIA_01541"
FT                   /old_locus_tag="AN1541.4"
FT                   /product="aldehyde dehydrogenase family protein
FT                   (AFU_orthologue; AFUA_8G05520)"
FT   mRNA            join(1056809..1057266,1057315..1057708,1057759..1058216,
FT                   1058298..1058442)
FT                   /locus_tag="ANIA_01541"
FT                   /old_locus_tag="AN1541.4"
FT                   /note="transcript_id=CADANIAT00008168"
FT   CDS_pept        join(1056809..1057266,1057315..1057708,1057759..1058216,
FT                   1058298..1058442)
FT                   /locus_tag="ANIA_01541"
FT                   /old_locus_tag="AN1541.4"
FT                   /product="aldehyde dehydrogenase family protein
FT                   (AFU_orthologue; AFUA_8G05520)"
FT                   /note="transcript_id=CADANIAT00008168"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008168"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008168"
FT                   /db_xref="GOA:Q5BD39"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD39"
FT                   /protein_id="CBF85073.1"
FT                   /translation="MTTPTPSVIPLIINGKEELASSVFDVISPYTNKACWAAASASPQD
FT                   AIRAVEAAQAAFPAWSQTKPTVRRDILLKAADILESRLEKCAEFMRTEMGADAGASQFF
FT                   VVPLAIRMLREVASRITSICGTVPVVEAEGQSAIIYKEPMGVILGIVPWNAPYVFGVRS
FT                   AACALAAGNTTILKSSELTPCCYWALTRAFHDAGLPDGCLNLVSCRPQDAAEVVNAMIE
FT                   HPAVMKINFTGSTAVGRKIARACGQNLKPCLMELGGKNSSIVCADADIETAVKSVIAGA
FT                   YLNSGQICMATDRILVHSSIAPTFVEALKSALQSMSDPSSEPPTLVNVASKARVQRLIE
FT                   SALEAGAHIIHGSVTADSDAANSDSGVRMPPVLLGGVKEDMAVWQDEAFASLAACMTFD
FT                   TEEEAVRIANSSGYGLSAAVFTQDLRKGLAIARKIQSGAVHINSMTIHDEPVLPHGGVK
FT                   NSGWGRFNASQGLEEFLVTKSVTWMD"
FT   gene            1060259..1062691
FT                   /locus_tag="ANIA_01542"
FT                   /old_locus_tag="AN1542.4"
FT                   /product="oligo-xyloglucan specific cellobiohydrolase
FT                   (Eurofung)"
FT   mRNA            1060259..1062691
FT                   /locus_tag="ANIA_01542"
FT                   /old_locus_tag="AN1542.4"
FT                   /note="transcript_id=CADANIAT00008169"
FT   CDS_pept        1060259..1062691
FT                   /locus_tag="ANIA_01542"
FT                   /old_locus_tag="AN1542.4"
FT                   /product="oligo-xyloglucan specific cellobiohydrolase
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008169"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008169"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008169"
FT                   /db_xref="GOA:Q5BD38"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD38"
FT                   /protein_id="CBF85075.1"
FT                   /translation="MRAKNGPGSWLALTAIATSLNTLALAAAKTINHSYEFNPVVVSGG
FT                   GYITGIIAHPTEKNLLYARTDIGGTYRWNADEDKWIPLNDFISGADENLLGTESVALDP
FT                   NDPDRLYLAQGRYLNSENSAFFVSQDRGATFDVYPAPFKMGANELGRNNGERLAVNPFK
FT                   TDELWMGTRDAGLMVSEDGAQTWRNVSGFPQANANGIGIYWVIFDPRSEGTVYVGVGVP
FT                   GGIYVTRDSGESWEAVPGQPVEWDEDILVFPAESQPQSTGPQPMKGVLAENGALYVTYA
FT                   DAPGPYGVTYGGVYVYNTTSSAWTNITPKTNNSFPAPFDNQTFPAGGFCGISVDSKNPE
FT                   RLVVVSLDRDPGPALDSMYLSHDGGKSWKDVSQLSTPSGSGGYWGHPIEEAAFKDGTAV
FT                   PWLSFNWGPQWGGYGAPSPVRGLTKFGWWMTAVVIDPSDSDHVLYGTGATIWATDNLSK
FT                   VDKNQSPGWYIQAQGIEESVALALASPNGGDSHLLTGLGDINGYRYGDLDVPQPMFDLP
FT                   VLSNLNALDWAGQKPEIIIRAGPCGHNYTDGCGLAAYSADGGSSWTKFATCIPGINTSS
FT                   SNPGVIAIDASGKDIVWSSAMTAYWPTLQAITPRTNQSGPYVTTDLGQTWVSPTGLNVQ
FT                   TPNISADRVQPRTFYSFTDGTWYLSRDGGLSYRAYKAKEVGLPAYSGALPIANFNRAGE
FT                   IWLGLGDHGIYHTRNFGKKWTKITGRGVTARQLTIGAGARRSSEPTLFIVGKAASHGAL
FT                   SKDGVYRSDDNGKTWVRVNDEKHQYGGIAMIQGDPRVYGRVYLGTGGRGIIYADIKE"
FT   gene            1063457..1063675
FT                   /locus_tag="ANIA_11306"
FT                   /old_locus_tag="AN11306.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1063457..1063481,1063536..1063675)
FT                   /locus_tag="ANIA_11306"
FT                   /old_locus_tag="AN11306.4"
FT                   /note="transcript_id=CADANIAT00008170"
FT   CDS_pept        join(1063457..1063481,1063536..1063675)
FT                   /locus_tag="ANIA_11306"
FT                   /old_locus_tag="AN11306.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008170"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008170"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008170"
FT                   /db_xref="GOA:C8VMY0"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMY0"
FT                   /protein_id="CBF85076.1"
FT                   /translation="MIDEGTRRDSPSTDDTKTGRCLSMVQGFERREASTELEFTMTQSN
FT                   DGERAELLS"
FT   gene            1064319..1066696
FT                   /locus_tag="ANIA_01543"
FT                   /old_locus_tag="AN1543.4"
FT                   /product="hypothetical fumarate reductase (Eurofung)"
FT   mRNA            join(1064319..1064395,1064465..1064533,1064648..1064885,
FT                   1064943..1066387,1066441..1066696)
FT                   /locus_tag="ANIA_01543"
FT                   /old_locus_tag="AN1543.4"
FT                   /note="transcript_id=CADANIAT00008171"
FT   CDS_pept        join(1064362..1064395,1064465..1064533,1064648..1064885,
FT                   1064943..1066387,1066441..1066538)
FT                   /locus_tag="ANIA_01543"
FT                   /old_locus_tag="AN1543.4"
FT                   /product="hypothetical fumarate reductase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008171"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008171"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008171"
FT                   /db_xref="GOA:Q5BD37"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD37"
FT                   /protein_id="CBF85078.1"
FT                   /translation="MAPRVIVVGGGLSGLSAAHTVYLNGGSVLVLDKQAFFGGNSTKAT
FT                   SGINGALTRTQVDLNIRDSVKQFYDDTLKSARDKARPDLIKVLTYKSAAAVEWLQDVFN
FT                   LDLTLVSRLGGHSQPRTHRGHDAKFPGMAITYALMQRLEELSESDPDRVQIIKKARVTA
FT                   VNKDGNAVTGVTFEVDGETKTADGVVILATGGYAADFGDSSLLKKHRPDTFGLSSTNGT
FT                   HATGDGQKMLMSIGANGIDMDKVQVHPTGLVDPKDPTAKFKFLAAEALRGEGGLLLNSD
FT                   GERFSDELGHRDYVSGQMWKEKEKGKWPIRLVLNSKASKVLDFHTRHYSGRGLMKKMTG
FT                   KELAKEIGCGEAKLQKTFEDYNAIAEGKKKDPWNKRFFHNLPFSIDDEFHVALMEPVLH
FT                   FTMGGIEINDRAEVLNSEHKPFDGLYACGELAGGVHGANRLGGSSLLGCVVYGRVAGDS
FT                   ASEYLFKKLVAGGGSSAQQRLGQISLHIDPATPGKVSVEWNGAGAAKASGTNPAVSTAP
FT                   LPANADAPAETSKPPTKAPKKFTIPETEYSMEEVAKHNKKDDLWIVVKGIILDVTNWLD
FT                   EHPGGANALFNFMGRDATEEFEMLHDDEVIPKYAPHIVIGRVKGQTPSLEY"
FT   gene            complement(1066921..1067961)
FT                   /locus_tag="ANIA_01544"
FT                   /old_locus_tag="AN1544.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(1066921..1067961)
FT                   /locus_tag="ANIA_01544"
FT                   /old_locus_tag="AN1544.4"
FT                   /note="transcript_id=CADANIAT00008172"
FT   CDS_pept        complement(1066921..1067961)
FT                   /locus_tag="ANIA_01544"
FT                   /old_locus_tag="AN1544.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008172"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008172"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008172"
FT                   /db_xref="GOA:Q5BD36"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD36"
FT                   /protein_id="CBF85080.1"
FT                   /translation="MSDHQKRGSSEDSNTPTKQRPDRNDGDPAQSDQDTQSLASRIQKS
FT                   ASGLARNAFFSSTPSGDTAHLLSDSGKAAPSSSSSALAAAEQYKDTTGPSSSASRDHNV
FT                   HVPAETFRSPGATHSGGFELPRLTEDEFQSTYGGNLSDTIDPLDETKGKGRAINSVPGS
FT                   GLTSSIYHDGTTAPPTLNPSDGDAVVAILNDQTFDPEFPPSANEPPEYVETELSPLQLT
FT                   PEEMQMIESFRRQLPPDSQSTTDTQQKRQLNSFSLVPDIGSFLDTVPAASATDATSLRD
FT                   TVLANLPGAAEWMSVEEEYHDEVWGYLRPTLEAAAKEIESKKDSGITEDGPAVRRLKMI
FT                   LKHMQH"
FT   gene            1069172..1071580
FT                   /locus_tag="ANIA_01545"
FT                   /old_locus_tag="AN1545.4"
FT                   /product="hypothetical protein similar to protein
FT                   phosphatase 2A regulatory B subunit (Broad)"
FT   mRNA            join(1069172..1069246,1069417..1069457,1069523..1069620,
FT                   1069680..1070325,1070395..1070960,1071020..1071580)
FT                   /locus_tag="ANIA_01545"
FT                   /old_locus_tag="AN1545.4"
FT                   /note="transcript_id=CADANIAT00008173"
FT   CDS_pept        join(1069203..1069246,1069417..1069457,1069523..1069620,
FT                   1069680..1070325,1070395..1070960,1071020..1071043)
FT                   /locus_tag="ANIA_01545"
FT                   /old_locus_tag="AN1545.4"
FT                   /product="hypothetical protein similar to protein
FT                   phosphatase 2A regulatory B subunit (Broad)"
FT                   /note="transcript_id=CADANIAT00008173"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008173"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008173"
FT                   /db_xref="GOA:C8VMY3"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR018067"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMY3"
FT                   /protein_id="CBF85082.1"
FT                   /translation="MVDRDPGTPTWKFTQCFGDKGDVEDITEADIISTVEFDHTGNYLA
FT                   TGDKGGRVVLFERNETKKTCEYKFHTEFQSHEPEFDYLKSLEIEEKINKIKWCRRQNAS
FT                   HFLLSTNDKTIKLWKVFDKSLKVVAENNLSTELTPGGVGGGGAPRAPRVSFKDSSALKL
FT                   PRMTHHDTVVAAVPRRTYANAHAYHINSISVNSDGETFISSDDLRVNLWNLNIQDQSFN
FT                   IVDIKPANMEELTEVITAAEFHPTSCNWFMYASSKGTIKLADMRQRALCDTHHKLFEQE
FT                   EDASSRSFFSEIISSISDVRFSHDGRYIVSRDYLTVKIWDVNMERQPVKTIPIHEHLRP
FT                   RLCDTYENDSIFDKFEVVFSGDAENVMTGSYNNNFMIYPTDPAKETEIVLQADKSAFKA
FT                   KKVGVPTPMNKGANGKKSNSRTSSPAGPGSRMKKETDADQIDFNKKILHMSWHPFEDSI
FT                   AIAATNNLFVFSAL"
FT   gene            1071934..1078006
FT                   /locus_tag="ANIA_01546"
FT                   /old_locus_tag="AN1546.4"
FT                   /product="transcription factor (Sin3), putative
FT                   (AFU_orthologue; AFUA_8G05570)"
FT   mRNA            join(1071934..1072348,1072425..1072492,1072569..1073224,
FT                   1073273..1073382,1073439..1074132,1074193..1074675,
FT                   1074882..1076984,1077031..1078006)
FT                   /locus_tag="ANIA_01546"
FT                   /old_locus_tag="AN1546.4"
FT                   /note="transcript_id=CADANIAT00008174"
FT   CDS_pept        join(1072254..1072348,1072425..1072492,1072569..1073224,
FT                   1073273..1073382,1073439..1074132,1074193..1074675,
FT                   1074882..1076984,1077031..1077639)
FT                   /locus_tag="ANIA_01546"
FT                   /old_locus_tag="AN1546.4"
FT                   /product="transcription factor (Sin3), putative
FT                   (AFU_orthologue; AFUA_8G05570)"
FT                   /note="transcript_id=CADANIAT00008174"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008174"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008174"
FT                   /db_xref="GOA:Q5BD34"
FT                   /db_xref="InterPro:IPR003822"
FT                   /db_xref="InterPro:IPR013194"
FT                   /db_xref="InterPro:IPR031693"
FT                   /db_xref="InterPro:IPR036600"
FT                   /db_xref="InterPro:IPR039774"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD34"
FT                   /protein_id="CBF85084.1"
FT                   /translation="MNSGNDNWHPGGPSHPAMDQMNQPPRPLGTFSQNPTPQQGPSSQP
FT                   SGPVLPPPAAPYHSAGQAGGHSLPGLAELSQTHGNPHPPPSYGQHAPAPAHGGGHSLPG
FT                   IGQAMQHPSPQSMNQDRERDSRDREIIERQRQEEMVHRERERERERDIERQQLERQRDQ
FT                   QHHPVQSHTGSIPLHQPVASKVPNTIHGPGGLLSNLGPNPPNGPQNAMQASGGPGGMYG
FT                   SQIPHGEGTPRSYMQHAAGPPGQPLMAFNGGGPSIPGNVAALAQGQQPILNFCQDALSY
FT                   LDQVKVRFVDQPDVYNRFLDIMKDFKSQAIDTPGVIQRVSNLFNGHPALIQGFNTFLPP
FT                   GYRIECGTEDNPDAIRVTTPSGTNTLSMPRARHTLDGPSDLAPPAGLGPHNRPDYYEHS
FT                   RPGWQQQQPQSQQPQGGFSDSPGARMMGGLFPQQSGQGQPQDHHYEYTGQQEQPAPAGA
FT                   AVATHGQDQRGVSQLQGAASAASAGLGRASLLGAGPSSQGPSMTQPMNNLAGVGSGVLQ
FT                   GSQADLKRGPVEFNHAISYVNKIKNRFSSRPEIYKQFLEILQTYQRESKPIGDVYTQVT
FT                   QLFNSAPDLLEDFKQFLPESAAHAKQQAALRQQAEENAPMSNLRGDPNYAPGSLTSQTP
FT                   NRDVKMPPLGNFNVKDSAKEGKKRRTGPGAPTLGGSSVGPAGGVDAARMVDSQAGRGQV
FT                   LPAGNANKRAKVHHTKPSQAEAPVVSPTLVPALPEPVQPTFSLTPTQEEFAFFDRVKKY
FT                   IGNKQTFSEFLKLCNLYSTDLIDRHVLVKRAAGYIGSNPELMAWFKRFMHVEEPEDKIV
FT                   EVKPKQEPGIVNLSHCRSLGPSYRLLPKRERQKPCSGRDELCRSVLNDEWASHPTWASE
FT                   DSGFVAHRKNQYEDALHRIEEDRHDYDHHIEACNRTIQLIEPIVQQFLVMTEAERAAFQ
FT                   LPRGLGGQSEAIYQRVIKKIYDRQRGERIIKEMFERPCHVLPIVLFRLKQKCEEWKASQ
FT                   REWDKIWREQMQKAYWRSLDHQAIASKGVDKKLFVAKHIQTEIQAKHEESKNLRKSGFQ
FT                   VPKHQFEFSFTDPTVLIDATHLLLTFIDRNSAGFGADPQKVMMFIKDFIPVFFGMDRDT
FT                   FHVYMNELSNGTSPIDEGDDESSAADDAATSRSSRKGVTNKKIDLLRDVLERRGEKASR
FT                   NDKEGSAPASGDGTPDAVLVSTTPIPDPTETFDVAELKWMEHPGQGNFNQHREYNLNET
FT                   YEKKAHHLYANLNIYCFFRTFEILYSRLLRIKLHEKEAHEVVRRALVMKPARELNLIDK
FT                   VPTDFFYDTDPKANLYQQVVRMCEEVIKGDLESSHLEETLRRYYLRSGYQLYNLEKMFT
FT                   GIAKFAGAIFNGDSKDRSSDIINLFFKERDKDETTHNQEIQYRKQVERLVKDSEIFRIT
FT                   YYPDNQKTTVQLLTPEDATLENEELSQEARWSYYVSAYTMRDPTEGVPFSQMRMPFLKR
FT                   NLPGKLEQEEEYNRFYRPLVHQDGLIIRICANSYHILYEPGSYDWWYRPALPPDETSED
FT                   TAKEAAVKERRRDRFTEKFINNPSWAHGLSKDQVDESNQRFRSWIKGSEAENAETSAPA
FT                   GSATDKPENKDDVEMPDAEKASGPES"
FT   gene            1078912..1080712
FT                   /locus_tag="ANIA_01547"
FT                   /old_locus_tag="AN1547.4"
FT                   /product="Acyl-CoA carboxylate CoA-transferasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5BD33]"
FT   mRNA            join(1078912..1079054,1079105..1079345,1079394..1080712)
FT                   /locus_tag="ANIA_01547"
FT                   /old_locus_tag="AN1547.4"
FT                   /note="transcript_id=CADANIAT00008175"
FT   CDS_pept        join(1078912..1079054,1079105..1079345,1079394..1080587)
FT                   /locus_tag="ANIA_01547"
FT                   /old_locus_tag="AN1547.4"
FT                   /product="Acyl-CoA carboxylate CoA-transferasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5BD33]"
FT                   /note="transcript_id=CADANIAT00008175"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008175"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008175"
FT                   /db_xref="GOA:Q5BD33"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD33"
FT                   /protein_id="CBF85085.1"
FT                   /translation="MSASALLRSRVRRPSYLNKIAKAEDLIDLFPNGSYIGWSGFTGVG
FT                   YPKKVPTALADHVEKNGLEGKLKYTLFVGASSGAETENRWARLNMIDRRSPHQVGKEIA
FT                   KGINNGQIKFFDKHLSMFPSDLTYGWYTLNKPKNRIDVAVIEASAITEDGGIIPGASVG
FT                   ASPELVQMADKVIIEVNTASPSFEGLHDITMSELPPNRKPYLILQPEDRIGTPHIPVDP
FT                   EKVVAIVESDYPDQTQPNSPEDANSQAIASNLIEFLKHEVKHGRLPPNLLPIQSGIGNI
FT                   ANAVIGGLSKGGADFTNLKVWTEVLQDSFLDLFDSGNLDFATATSIRFSPDGFKRFYDN
FT                   WERYAGKLLLRSQQVSNSPEIIRRLGCIGMNTPVEVDIYAHANSTCVMGSRMLNGLGGS
FT                   ADFLRSSKYSIMHTPSVRPSKTDPTGVSCIVPFATHIDQTEHDLDVIVTEQGLADVRGL
FT                   SPRERARVIIKKCSHPDYTPILTDYLDRAEFECLKKGMAHEPHLLFNAFKMHKNLQENG
FT                   TMKISNWD"
FT   gene            1081265..1082125
FT                   /locus_tag="ANIA_01548"
FT                   /old_locus_tag="AN1548.4"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family (AFU_orthologue;
FT                   AFUA_8G05590)"
FT   mRNA            join(1081265..1081622,1081653..1082125)
FT                   /locus_tag="ANIA_01548"
FT                   /old_locus_tag="AN1548.4"
FT                   /note="transcript_id=CADANIAT00008176"
FT   CDS_pept        join(1081265..1081622,1081653..1082125)
FT                   /locus_tag="ANIA_01548"
FT                   /old_locus_tag="AN1548.4"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family (AFU_orthologue;
FT                   AFUA_8G05590)"
FT                   /note="transcript_id=CADANIAT00008176"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008176"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008176"
FT                   /db_xref="GOA:Q5BD32"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD32"
FT                   /protein_id="CBF85087.1"
FT                   /translation="MSSYISTNKLHNSRILLIGGTSGIGFGVARASLEHGASVIVSSSN
FT                   PERVANAVSELKALYPEEPYVSRIVGKVCDLGKDDDSIEAEVVGLFEFATKRGLFGEEA
FT                   ESEGKVPINHIVFTADPGVSASYLRSLHTIRYIGGALVAKHAPEYMPKQSPNTPSSSIT
FT                   YTSGGLLVRPRPGLSLGLVGAAIVEGLARTLAVDLAPFGIRVNAVSLGPVRTAIFDAFG
FT                   SKDVVEGMLETYAEQTVLGRVGAPEDTAETYLGLMKDGNITGALVRTDGGFTLK"
FT   gene            complement(1082524..1083550)
FT                   /locus_tag="ANIA_01549"
FT                   /old_locus_tag="AN1549.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1082524..1083004,1083074..1083198,
FT                   1083297..1083550))
FT                   /locus_tag="ANIA_01549"
FT                   /old_locus_tag="AN1549.4"
FT                   /note="transcript_id=CADANIAT00008177"
FT   CDS_pept        complement(join(1082971..1083004,1083074..1083198,
FT                   1083297..1083398))
FT                   /locus_tag="ANIA_01549"
FT                   /old_locus_tag="AN1549.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008177"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008177"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008177"
FT                   /db_xref="GOA:Q5BD31"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD31"
FT                   /protein_id="CBF85089.1"
FT                   /translation="MVDDKSSTPAVSHARAHNDFGTNLWVRQGAVEHRHPTAGRGLFAG
FT                   LQDMKKYNVEHGWAKRNADASTGLGGWLWNKIFGGNYKPYD"
FT   gene            complement(1085398..1087594)
FT                   /locus_tag="ANIA_01550"
FT                   /old_locus_tag="AN1550.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1085398..1085944,1086031..1087380,
FT                   1087578..1087594))
FT                   /locus_tag="ANIA_01550"
FT                   /old_locus_tag="AN1550.4"
FT                   /note="transcript_id=CADANIAT00008178"
FT   CDS_pept        complement(join(1085398..1085944,1086031..1087380,
FT                   1087578..1087594))
FT                   /locus_tag="ANIA_01550"
FT                   /old_locus_tag="AN1550.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008178"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008178"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008178"
FT                   /db_xref="GOA:Q5BD30"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD30"
FT                   /protein_id="CBF85091.1"
FT                   /translation="MIACCRPFIDKGTLERRNGIHWRMPAAMAVCWIIGLGLALGHHFY
FT                   YFSLDGTIVPGQTQQEWSLRVGTGLAFLTKTFLTTSVGIACVQNIWWILRMKPVRLSTL
FT                   DSMWDIRGNIFNFFDLHIWLRGPNVAILGLISWCVVLVYVVSSLLKCLRCIPLVTVVTP
FT                   STLSVRSTIGSMLQEQQMPAIDFNFDKFYTMDDGGPTGPTPSVTRFITGAVIQGTIPSI
FT                   PAPAPNSSYSLTFPGPLIQCSNSSANVSQQVYDWAHANYAHSTSFMGFMSETDNISHAM
FT                   NQLVYEPYQGPDNGDRDADVAGKLIMTVSPYMPLDKRWVVECGIYNASYSVDFNFTNGV
FT                   QSTRITDLQILGRVRDHRQHEIPPPANEDQLFAYTAMMRVFRDVLIGRCVQSGSICTDT
FT                   KIYSSALVNSKQIWQLVYNDKKKVGNTTYDSLGSILDVASELGRNITLSFFGSPYFLNT
FT                   SIGPLVNVTTHPSQTEYVYSQRNLLLAYGLSVFTSLLCIIAGLLTMWDNGIAFLDSPTT
FT                   ILRATRNPMFDEIVPTDSTTGADPTPESLSNTRVLWVQSASPGSNHTVAGLKPLPNTAE
FT                   PEKTGNDNRTANAGSETGLQAMTPITFSNGIPGWERKRYRPTISMVETETREASPPPGG
FT                   FI"
FT   gene            complement(1088409..1090362)
FT                   /locus_tag="ANIA_01551"
FT                   /old_locus_tag="AN1551.4"
FT                   /product="Putative beta-glucosidasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5BD29]"
FT   mRNA            complement(join(1088409..1090125,1090182..1090362))
FT                   /locus_tag="ANIA_01551"
FT                   /old_locus_tag="AN1551.4"
FT                   /note="transcript_id=CADANIAT00008179"
FT   CDS_pept        complement(join(1088639..1090125,1090182..1090362))
FT                   /locus_tag="ANIA_01551"
FT                   /old_locus_tag="AN1551.4"
FT                   /product="Putative beta-glucosidasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5BD29]"
FT                   /note="transcript_id=CADANIAT00008179"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008179"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008179"
FT                   /db_xref="GOA:Q5BD29"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD29"
FT                   /protein_id="CBF85093.1"
FT                   /translation="MRGAILATAAAFAGTAVADMHMRRHAHEGLHHRALHASSAVPEEE
FT                   CGCTTEVITYWGEPTTIPLSVPTSTVTSETTETVHSTSYSTVTVTATSSAAPVETPSET
FT                   PSPTPEVTLPTAGVTSYSETGTYTIPATTITVTDTTTVCGATTTELPSGTHTYGGVTTI
FT                   VETATTITCPYATVKPTGSTVTSVIETTTYVCPSAGTYTIAPTTTFVPTSTVVVYPTPE
FT                   TVTPGTYTNPGTTITVTRTEDVYVCPYTNGNVPTSVPALPTTSAASTTTAVPSSSTTTS
FT                   SATSVPTGASGNKMGMTFTPYNNDGSCMAKNDVLEQVGLIKGKGFSHVRVYGTDCHTLE
FT                   YVGAACSTHGLKMILGVNVEGSTGFDGARSQFKDITNWGQWDLVSLIVVGNEVVTSNIA
FT                   SAAQLASFVSEGASAFSAAGYTGQVTTAEPIDVWLSNGATLCPVVDILGANLHPFFNPE
FT                   FTAAEAGTLVSNQIKDLKQVCTGKDVINLETGWPNAGSANGKAIPGQSQQTTAIKSLVE
FT                   KVGDVSVFFSYADDGWKSKFATSDKYNVEQHWGCIDQF"
FT   gene            1093857..1094950
FT                   /locus_tag="ANIA_01552"
FT                   /old_locus_tag="AN1552.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1093857..1093995,1094065..1094080,1094126..1094950)
FT                   /locus_tag="ANIA_01552"
FT                   /old_locus_tag="AN1552.4"
FT                   /note="transcript_id=CADANIAT00008180"
FT   CDS_pept        join(1093857..1093995,1094065..1094080,1094126..1094477)
FT                   /locus_tag="ANIA_01552"
FT                   /old_locus_tag="AN1552.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008180"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008180"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008180"
FT                   /db_xref="GOA:Q5BD28"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD28"
FT                   /protein_id="CBF85095.1"
FT                   /translation="MTRSELCPTFIPLFLPRIAAHYNQPDGFRLQTSTLVREFDQEKGA
FT                   AGDSAWKLASIHPAGIRLIMRLIHLRFQSYRARIVQPHMDSALPPVNQLYDFNMPRQNR
FT                   EKLSVLCYMASEPMEDTEWPRLRTATAISSPKEVGEESTNTTGKRCKPPSQVRKRNNAP
FT                   EEALS"
FT   gene            complement(1095953..1096429)
FT                   /locus_tag="ANIA_01553"
FT                   /old_locus_tag="AN1553.4"
FT                   /product="Asp hemolysin-like protein (AFU_orthologue;
FT                   AFUA_4G02805)"
FT   mRNA            complement(join(1095953..1095980,1096047..1096429))
FT                   /locus_tag="ANIA_01553"
FT                   /old_locus_tag="AN1553.4"
FT                   /note="transcript_id=CADANIAT00008181"
FT   CDS_pept        complement(join(1095953..1095980,1096047..1096429))
FT                   /locus_tag="ANIA_01553"
FT                   /old_locus_tag="AN1553.4"
FT                   /product="Asp hemolysin-like protein (AFU_orthologue;
FT                   AFUA_4G02805)"
FT                   /note="transcript_id=CADANIAT00008181"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008181"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008181"
FT                   /db_xref="GOA:Q5BD27"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD27"
FT                   /protein_id="CBF85097.1"
FT                   /translation="MTIPAEGLGEVCATGRRGSEGWLDLFDGDKKICELHWDNRAERRW
FT                   NDFEVLEPDEGYRVECSGWSSERGPLGHVFVDVSEARKEELRREKELGGLRVFEGPGVG
FT                   EKSVDVDVAEEVPVLGGLGGIGGNITMGGFIS"
FT   gene            complement(1097325..1099534)
FT                   /locus_tag="ANIA_01554"
FT                   /old_locus_tag="AN1554.4"
FT                   /product="activator of chitin synthase (Eurofung)"
FT   mRNA            complement(join(1097325..1097353,1097407..1097619,
FT                   1097668..1099534))
FT                   /locus_tag="ANIA_01554"
FT                   /old_locus_tag="AN1554.4"
FT                   /note="transcript_id=CADANIAT00008182"
FT   CDS_pept        complement(join(1097325..1097353,1097407..1097619,
FT                   1097668..1099534))
FT                   /locus_tag="ANIA_01554"
FT                   /old_locus_tag="AN1554.4"
FT                   /product="activator of chitin synthase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008182"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008182"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008182"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD26"
FT                   /protein_id="CBF85098.1"
FT                   /translation="MASPVASTYPHPHPLPSPPPVYHPSSPPHSPSHREPQSTPRNPNY
FT                   PPTSPVARKPLPEAPRAQVAQGTQRPPVPSVSVNGQIEQSETQSPTARNVHDNSFTSHV
FT                   PNTAFSNLTLEDNPAKNGGYPPRKESVGVIPLSGNMAYRHTPASSISSFAVEPQPHDEP
FT                   HIPGKDSGSSFDRDVPSGSQNTSSRGSLDSMAHASENIEPLHYHHRPYLTSQPAVRSTP
FT                   ALGLAENTPGTNTHLTAKRPARPRSAYSFASDNASPQASPYLKPRTSSRNSSSPDVRPL
FT                   SFVDLLNTPYPQPGPAPVHLGNSHLRSSVGNNASLLSHKQTFDMYLANVKKTDDPAVQY
FT                   EFAVFMVNAMLEMPDDVLEGGKPSISVEKGKTSNDITRSHLLKEAKSILQGLANRSYPF
FT                   AQYYLADGYASGLFSKGKEDYDRAFPLFVAASKHGHVEACYRTALCYEFGWGTRVEASR
FT                   AQQFYRQAASKNHPGAMLRMAKACLAGDMGLGKRYREGIKWLKRAAESSDAQYNSAPYE
FT                   LGLLHETGYGDDVFVDPSYAAQLFTKSADLGHVEACYRLGDAYEHGKLNCPKDPALSIH
FT                   FYTGAAQGGHPLAMMALCAWYLVGAEPVLEKDENEAYEWAKQAAELGLAKAQYAVGYFT
FT                   EMGIGCRRDPLEANVWYVKAADQGDTRAVHRIAAIRAAADGVNPAQAAADANGKKRKND
FT                   GKKRFGIF"
FT   gene            1103861..1107720
FT                   /locus_tag="ANIA_01555"
FT                   /old_locus_tag="AN1555.4"
FT                   /product="Chitin synthase D (EC 2.4.1.16)(Chitin-UDP
FT                   acetyl-glucosaminyl transferase D)(Class-V chitin synthase
FT                   D) [Source:UniProtKB/Swiss-Prot;Acc:P78611]"
FT   mRNA            join(1103861..1106553,1106605..1107410,1107467..1107720)
FT                   /locus_tag="ANIA_01555"
FT                   /old_locus_tag="AN1555.4"
FT                   /note="transcript_id=CADANIAT00008183"
FT   CDS_pept        join(1103861..1106553,1106605..1107410,1107467..1107552)
FT                   /locus_tag="ANIA_01555"
FT                   /old_locus_tag="AN1555.4"
FT                   /product="Chitin synthase D (EC 2.4.1.16)(Chitin-UDP
FT                   acetyl-glucosaminyl transferase D)(Class-V chitin synthase
FT                   D) [Source:UniProtKB/Swiss-Prot;Acc:P78611]"
FT                   /note="transcript_id=CADANIAT00008183"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008183"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008183"
FT                   /db_xref="GOA:P78611"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P78611"
FT                   /protein_id="CBF85100.1"
FT                   /translation="MSLPQRPGKTSPRREETSAFREPSRRRRRESDSLSNNDPTSPRHH
FT                   RHHRSHSSRHQHDIDEERAEEGGIRRKRSLVKPERGRMDPSHPNYLYRQKTQNMPTYNP
FT                   MTGNEPLIHEEGEAETNSTPSMDSKRKDALYGAHGNVNKPMERVPTRHRSKKRKGSRKI
FT                   SKREAAAEKRRRKAMEQVRPPSLWTTYCSVITFWAPDFVLKCFGMPQKAQRSAWREKIG
FT                   LISIILMIAAFVGFLTFGFTATVCGTPPTRLKINEIGSGYMIFHGQAYDLTKSTHPAAA
FT                   GIPDMTNVLYDLPHKYGGQDGSFFFQEVNGACKGLITRTENSDIPTNSNGDLAWYFPCH
FT                   AFNQDGSSEPNTTVSYYNGWACHTSGSARKSFYSLKNSGDVYFTWEDTKNTSRKLAVYS
FT                   GNVLDLNLLNWFDDTQVNYPTKFKDLRDNDDIRGVDLTYYFQTGEDKQIGKCLSQIIKV
FT                   GSIDTDTVGCIASQVVLYVSLIFILSIVIVKFAFALLFQWFLAPRFAAQKTSMGAVDSK
FT                   ARNQQIEDWSNDIYRPGPRLADPVPGDRMSKRASFLPTTSRFSSPYTVSNGGKQKPQWV
FT                   TMASQNSTTRLVPPASGTTPSIYRQSHNGLGNVSVDNSRLNPSASRTSLVQDSRYSTVI
FT                   PDSEGIGSAGYVHELVVPQPPPDWQPYGFPLAHAMCLVTCYSEGEEGIRTTLDSIALTD
FT                   YPNSHKSIVVICDGIIKGKGEEFSTPDIVLRMMRDPIIPPEEVEAFSYVAVATGSKRHN
FT                   MAKVYAGFYDYGEHSIIPVEKQQRVPMMIIVKCGTPAEATAAKPGNRGKRDSQIILMSF
FT                   LQKVMFDERMTELEYEMFNGLLHVTGIPPDFYEVVLMVDADTKVFPDSLTHMISAMVKD
FT                   PEVMGLCGETKIANKTDSWVTMIQVFEYFVSHHQSKAFESVFGGVTCLPGCFSMYRIKA
FT                   PKGGQNYWVPILANPDIVEHYSENVVDTLHKKNLLLLGEDRYLSTLMLRTFPKRKQIFV
FT                   PQAVCKTVVPDKFMVLLSQRRRWINSTVHNLMELVLVRDLCGTFCFSMQFVIFVELVGT
FT                   VVLPAAISFTIYVVVSSIIKQPVQIIPLVLLALILGLPGVLVVVTAHRLVYVLWMLVYL
FT                   ISLPIWNFVLPTYAYWKFDDFSWGDTRKTAGEKDKGHEDGEGEFDSSKITMKRWRDFEK
FT                   DRRLRMQAGWQLPVGGHPPMPYEPYPEY"
FT   gene            1109056..1111380
FT                   /locus_tag="ANIA_10216"
FT                   /old_locus_tag="AN10216.4"
FT                   /product="WD repeat protein (AFU_orthologue; AFUA_8G05640)"
FT   mRNA            join(1109056..1109884,1109936..1111380)
FT                   /locus_tag="ANIA_10216"
FT                   /old_locus_tag="AN10216.4"
FT                   /note="transcript_id=CADANIAT00008184"
FT   CDS_pept        join(1109056..1109884,1109936..1111380)
FT                   /locus_tag="ANIA_10216"
FT                   /old_locus_tag="AN10216.4"
FT                   /product="WD repeat protein (AFU_orthologue; AFUA_8G05640)"
FT                   /note="transcript_id=CADANIAT00008184"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008184"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008184"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMZ4"
FT                   /protein_id="CBF85102.1"
FT                   /translation="MAPDDDAHPAGAHAANLPEQRLERPVDGLDSIATSLQDPYSDEAL
FT                   SAFMSVPHYPEATSHRTSIPVSEIVNAVIEPGDFFRRQSTSSQRISGSQISPPMELYVS
FT                   DSEMTDTLSEVGGVPLDEYHIEQMRLAEFASRFVHEAIAQNNHAAVSETTEEASATDSV
FT                   MQYELHTSGQEPISFSTAEDDDDTRKFYLDYGDDDYETNSQSSSSGDGHSHVSNVDLDD
FT                   FYRPPGYTYGSQMSGFDPASSHEDHTNFFSDAEDANTDPAADPHFAESVIHHGTTQERN
FT                   YDIDQFISQWLYQSSTASIPMLSLSPQVFLQSTLSNIMRWQPPAKITRPSGYTGDFYDI
FT                   QQIPWWERLRVRRADARRLRDQTYESYQNLPQYSQRRTGRRLPEEEFYFQGKSMYTAHK
FT                   ATIEHFQLRNLMSVPAYNTVHFAHESKLYSWVPAYDDLQCLIDLSVPNAESGFQGPVKI
FT                   STMKTAVGVSIAGGFFGEYAVRAMGTETKGVEGYVTKDPNGITNHIDIIPSRTNRSPIG
FT                   IFASNDRHVRTLDCETNTFLTDHELTHAVNCTSTSPDGRLRIVVGDSPDAWVVEAETGR
FT                   PVYPLRGHKDFGFACAWSPDMMQVATSNQDKSAIIWDARTWRMLEKIESDVAGYRSLRF
FT                   SPVGGGPRTLLLCEPADRIVIVNAQTYRSRQVHDFFGEVGGADYSPDGSTIWAANTDER
FT                   FGGFMEYDRRQWGQQYGLQQSPNEWVKEADLDEDERCILSERERQSRHLWNLCDEGHEE
FT                   LLLC"
FT   gene            1111784..1112611
FT                   /locus_tag="ANIA_10219"
FT                   /old_locus_tag="AN10219.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1111784..1112237,1112324..1112611)
FT                   /locus_tag="ANIA_10219"
FT                   /old_locus_tag="AN10219.4"
FT                   /note="transcript_id=CADANIAT00008185"
FT   CDS_pept        join(1111833..1112237,1112324..1112461)
FT                   /locus_tag="ANIA_10219"
FT                   /old_locus_tag="AN10219.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008185"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008185"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008185"
FT                   /db_xref="GOA:C8VMZ5"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMZ5"
FT                   /protein_id="CBF85104.1"
FT                   /translation="MSLQNILVDAVKSHFDKDDDKDDLKPALSHASANASSEDSNLFSQ
FT                   ALSFINQRKSEGVQDDIDEEQAVNAHRRYEQGGNMDSKDFGAGAALQALKMFNSSSGQE
FT                   TGGGKDKNAFIGMAMAQAAKMWEEKAGKGEASGDKQSAINQAAEMAFKMYLKSQMSGSE
FT                   GTGGPGGLMSLASKFLK"
FT   gene            1113471..1115488
FT                   /locus_tag="ANIA_01557"
FT                   /old_locus_tag="AN1557.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1113471..1113563,1113623..1114145,1114219..1114232,
FT                   1114281..1114856,1115048..1115488)
FT                   /locus_tag="ANIA_01557"
FT                   /old_locus_tag="AN1557.4"
FT                   /note="transcript_id=CADANIAT00008186"
FT   CDS_pept        join(1113471..1113563,1113623..1114145,1114219..1114232,
FT                   1114281..1114856,1115048..1115488)
FT                   /locus_tag="ANIA_01557"
FT                   /old_locus_tag="AN1557.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008186"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008186"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008186"
FT                   /db_xref="GOA:Q5BD23"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD23"
FT                   /protein_id="CBF85105.1"
FT                   /translation="MFCGCMIGGSLWGTGKHLFELTSEQRTTAMEYWWFCNISYAVSSV
FT                   LAKVSVCIFLLRVMPFPCHRAALYTVTVLAVCSGIPFFVLLVIQCSPVSFWWTRMRGDT
FT                   NGHCGYVDAIAIMLYIFSASSALFDFTVALLPVILVRNLQMNRRTKAAVAGLLGMACVC
FT                   VIPLFLLADVFFGMLRAGKCSASIAIIIRLAFVQTIHDPDYLYGTVQIAIWSCIEVGLS
FT                   ITAGSLATTRPLFRILHNRSSSPYNPFDDPSTPSNDRNKHRRSISWSEPYPSSRSRRTS
FT                   NRILALENDLGFNFGSGRNNSISTSSRRRSRSSKSTSRPSTSRNKRRSGVTTEGRPSSN
FT                   FYEPYIGVEMLKMQSTTDVEGGRTDDTEGSSHPAPGTELLDPTTDPNSSGLGEFAGRPE
FT                   GLQTAASNYTAHLTTAVMRPRRWTSRDGLAEIGSTLAVVWETTPEVKAHCVKECSVQAS
FT                   SLHYFLAGSSESELYRQRPMRSYRAGGECSRFFFLTIGVLVQLDGQKSKVRISSIFSPF
FT                   STFYCIALSQGCRKYADHGRILSTIKATRPY"
FT   gene            complement(1115896..1120448)
FT                   /locus_tag="ANIA_01558"
FT                   /old_locus_tag="AN1558.4"
FT                   /product="Myosin-1 (Class I unconventional myosin)(Type I
FT                   myosin) [Source:UniProtKB/Swiss-Prot;Acc:Q00647]"
FT   mRNA            complement(join(1115896..1116466,1116517..1117037,
FT                   1117084..1117331,1117376..1117467,1117515..1119212,
FT                   1119263..1119745,1119805..1119850,1119916..1120152,
FT                   1120231..1120448))
FT                   /locus_tag="ANIA_01558"
FT                   /old_locus_tag="AN1558.4"
FT                   /note="transcript_id=CADANIAT00008187"
FT   CDS_pept        complement(join(1116045..1116466,1116517..1117037,
FT                   1117084..1117331,1117376..1117467,1117515..1119212,
FT                   1119263..1119745,1119805..1119850,1119916..1120152,
FT                   1120231..1120233))
FT                   /locus_tag="ANIA_01558"
FT                   /old_locus_tag="AN1558.4"
FT                   /product="Myosin-1 (Class I unconventional myosin)(Type I
FT                   myosin) [Source:UniProtKB/Swiss-Prot;Acc:Q00647]"
FT                   /note="transcript_id=CADANIAT00008187"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008187"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008187"
FT                   /db_xref="GOA:Q00647"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR010926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="InterPro:IPR036072"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00647"
FT                   /protein_id="CBF85107.1"
FT                   /translation="MGHSRRPAGGEKKSRFGRSKAAADVGDGRQAGGKPQVRKAVFEST
FT                   KKKEIGVSDLTLLSKISNEAINDNLKLRFQHDEIYTYIGHVLVSVNPFRDLGIYTDSVL
FT                   NSYRGKNRLEVPPHVFAVAESAYYNMKSYKDNQCVIISGESGAGKTEAAKRIMQYIASV
FT                   SGGSDSSIQQTKDMVLATNPLLESFGNAKTLRNNNSSRFGKYLELEFNAQGEPVGANIT
FT                   NYLLEKSRVVGQITNERNFHIFYQFAKGAPQKYRDSFGVQQPQSYLYTSRSKCFDVPGV
FT                   DDVAEFQDTLNAMSVIGMSEAEQDNVFRMLAAILWMGNIQFAEDDSGNAAITDQSVVDF
FT                   VAYLLEVDAGQVNQALTIRMMETSRGGRRGSVYEVPLNTTQALAVRDALAKAIYFNLFD
FT                   WIVGRVNQSLTAKGAVANSIGILDIYGFEIFEKNSFEQLCINYVNEKLQQIFIQLTLKA
FT                   EQDEYEREQITWTPIKYFDNKVVCSLIEDKRPPGVFAALNDACATAHADSGAADNTFVG
FT                   RLNFLGQNPNFENRQGQFIIKHYAGDVSYAVQGMTDKNKDQLLKDLLNLVQSSSNHFVH
FT                   TLFPEQVNQDDKRRPPTASDKIKASANDLVATLMKAQPSYIRTIKPNDNKAPKEFNESN
FT                   VLHQIKYLGLQENVRIRRAGFAYRQTFDKFVERFYLLSPKTSYAGDYTWTGDVETGARQ
FT                   ILKDTRIPAEEYQMGITKVFIKTPETLFALEAMRDRYWHNMAIRIQRAWRNYLRYRTEC
FT                   AIRIQRFWRRMNGGLELLKLRDQGHTILGGRKERRRMSILGSRRFLGDYVGISNKGGPG
FT                   EMIRSGAAISTSDDVLFSCRGEVLVSKFGRSSKPSPRIFVLTNRHVYIVSQNFVNNQLV
FT                   ISSERTIPIGAIKTVSASSYRDDWFSLVVGGQEPDPLCNCVFKTEFFTHLHNALRGQLN
FT                   LKIGPEIEYNKKPGKLATVKVVKDGSQVDSYKSGTIHTGPGEPPNSVSKPTPRGKQVAA
FT                   RPVTKGKLLRPGGPGGGPSKLASRPVPERRPIPQPTPQTAAAQPTPASRPVPQPVAAVA
FT                   ASHSRTSSTASARAPPPPPPAPPAAAGPKKAKALYDFSSDNNGMLSISAGQIVEIVSKE
FT                   GNGWWLCMNLETSAQGWTPEAYLEEQVAPTPKPAPPPPPPVAPRASPAPVNGSAAVAAA
FT                   KAKAAPPPPAKRPNMAGRKTAPAPPPAPRDSAVSMNSQGDSSGASGRGTPSSVSNASLA
FT                   GGLAEALRARQSAMQGKQDDDDDW"
FT   gene            complement(1121538..1122941)
FT                   /locus_tag="ANIA_01559"
FT                   /old_locus_tag="AN1559.4"
FT                   /product="OPA3 domain protein (AFU_orthologue;
FT                   AFUA_8G05670)"
FT   mRNA            complement(join(1121538..1122720,1122785..1122941))
FT                   /locus_tag="ANIA_01559"
FT                   /old_locus_tag="AN1559.4"
FT                   /note="transcript_id=CADANIAT00008188"
FT   CDS_pept        complement(join(1121947..1122720,1122785..1122844))
FT                   /locus_tag="ANIA_01559"
FT                   /old_locus_tag="AN1559.4"
FT                   /product="OPA3 domain protein (AFU_orthologue;
FT                   AFUA_8G05670)"
FT                   /note="transcript_id=CADANIAT00008188"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008188"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008188"
FT                   /db_xref="GOA:C8VMZ8"
FT                   /db_xref="InterPro:IPR010754"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMZ8"
FT                   /protein_id="CBF85109.1"
FT                   /translation="MSLTLKLSSLVIRTLSKPIANQIKAQAREHERFRRICISMAQGLH
FT                   RLDMRLRLGTIRDNAAATRRAAAEAELRKHKPTSPTVKTEAETRAEEEAIARAKAAASE
FT                   AEKPAPKPHIRPLSESKAIESGATFISETFLFLVAGSLILFESWRSRRKENNRRDDVAA
FT                   RLNELEETVGIYREAFIALEKNGDLPPASRRILLKMIEDVEPEEVPEPEPQGWFTTITS
FT                   YFSFGQSPEKQPEKETDATQPASVAETPKVPSSTPRSGPAASSTTSVPVSKPEKP"
FT   gene            1123585..1127104
FT                   /gene="plkA"
FT                   /locus_tag="ANIA_01560"
FT                   /old_locus_tag="AN1560.4"
FT                   /product="Polo-like kinase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q874A0]"
FT   mRNA            join(1123585..1123911,1123966..1124408,1124473..1127104)
FT                   /gene="plkA"
FT                   /locus_tag="ANIA_01560"
FT                   /old_locus_tag="AN1560.4"
FT                   /note="transcript_id=CADANIAT00008189"
FT   CDS_pept        join(1123585..1123911,1123966..1124408,1124473..1127104)
FT                   /gene="plkA"
FT                   /locus_tag="ANIA_01560"
FT                   /old_locus_tag="AN1560.4"
FT                   /product="Polo-like kinase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q874A0]"
FT                   /note="transcript_id=CADANIAT00008189"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008189"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008189"
FT                   /db_xref="GOA:C8VMZ9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000959"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033695"
FT                   /db_xref="InterPro:IPR033701"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMZ9"
FT                   /protein_id="CBF85111.1"
FT                   /translation="MERHLQPTMEALSPRSTNQMIKPKASMERKVLDKNAAAAQKASSA
FT                   KNHAPPPPALVVEPGDDGEQYSTGAFLGKGGFAICYEGTLLRNGRVFAMKVVKSDMGQK
FT                   KMQEKFRTELQIHSKMRHPHIVGFHRAFVYDQCIYVILELCPNGSVMDMVRKRKCLSLP
FT                   EVRRFMVQLCGAVKYLHKRNVAHRDLKMGNLFLDRNMDIKVGDFGLAAMIMSEKDEKRR
FT                   KTLCGTPNYIAPEVLDRSKGGHTQKVDIWSLGVICFAMLTGYPPFQSKTQEEIYKKVRN
FT                   LTYVWPKDSECANHIPDEAKSLVSCCLNLDEQKRPEPDDIVEHAFFNMYNGCIPKRLDP
FT                   KCSVQKPTWLRGAEPQGDAMAFGHGLDFDEKFSSYIRDVDDPILRYRTCKAAFYSSCGV
FT                   GRKPDGTARKSVGHNASKSGFAECLAEEEKGLQPLMPLPEDMVYKYPHDLIGDWSVPES
FT                   LPLRRQDALADTSVLSSRSSSTSLRTNTVSQSRTQAALAAAQQRRNGSQSHAASLRQQA
FT                   LTGRGTIRKIPSLCDPPQPTMKAMPDVRDAGLNPDPVPPVPTGGLAERPIRTRRGIAAS
FT                   YSGTTSVRGMDTNAVPSVSQASNDLGMLTVGKTRSQSRKLEAANQVAVEPLRVLKDRST
FT                   STGPENLAAVSRQKSARTVHKDLGGVAARKPDSEAARREEPVTRQRTEAQPQPMSSSGS
FT                   KASLSSTNKPRSSLGLHALLHSDDPCELLPGSSIDDVKIDLRNMLSNLVPGSAARRRVV
FT                   SQRPPHAYVIKWVDYTNRYGIGYVLDDGSVGCVFKAENGQPASGVVLRDGEKHIRRKAR
FT                   SQENSDSQSWSYSEADQLVPRHGKPVEFYENCSDDLLECRGGICRALIPPSLFEVKDSS
FT                   GGVKVRMDSGISRARADAEKIKRVKLVDQFGKYMIGSLGRHGDETLLDDAATDGAPGQF
FT                   IKFYQRLGNVGVWGFGDGAFQFNFPDHTKLVLAPGRTRNSSPWMDFYHLSPTAARYLAA
FT                   KGKMHPSGFDTRAVVSDEIATFLSIAYGTSTSAMDDKIREVLDANSFLQKIAFIKDVLK
FT                   SWIRQGRLGGRPSSDKPGTEMFWEGSQERPQASGGGSSKFVWVTVGAPGGDGEYRSVSL
FT                   RDKKGNSVGENDEMEALRERLRLAGL"
FT   gene            1127406..1128130
FT                   /locus_tag="ANIA_01561"
FT                   /old_locus_tag="AN1561.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1127406..1127610,1127697..1128130)
FT                   /locus_tag="ANIA_01561"
FT                   /old_locus_tag="AN1561.4"
FT                   /note="transcript_id=CADANIAT00008190"
FT   CDS_pept        join(1127406..1127610,1127697..1128130)
FT                   /locus_tag="ANIA_01561"
FT                   /old_locus_tag="AN1561.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008190"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008190"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008190"
FT                   /db_xref="GOA:Q5BD19"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD19"
FT                   /protein_id="CBF85113.1"
FT                   /translation="MIALALLAPLLAGQTIGSVSPSLKRDDSKSNAFTPGTTDGCPAGW
FT                   PTCGSSGICYNPDEGATCCPGGTYACPSSTFCLLDPYCCPDDLTPESCAKEYGLTLVPT
FT                   SPPSESTTFPPPKPSDSDSENDSGGHHRPTAHPTSSDSANSSITLSPTPIRTSSVVLWP
FT                   SLSVIPTGSPSAGQEPAYTGTGGSWRVRGGELATIAGAGALAIGVLCWV"
FT   gene            complement(1129892..1130815)
FT                   /locus_tag="ANIA_01562"
FT                   /old_locus_tag="AN1562.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(1129892..1130815)
FT                   /locus_tag="ANIA_01562"
FT                   /old_locus_tag="AN1562.4"
FT                   /note="transcript_id=CADANIAT00008191"
FT   CDS_pept        complement(1129892..1130815)
FT                   /locus_tag="ANIA_01562"
FT                   /old_locus_tag="AN1562.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008191"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008191"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008191"
FT                   /db_xref="GOA:Q5BD18"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD18"
FT                   /protein_id="CBF85115.1"
FT                   /translation="MGQERPTGRSLARRLLLAALDREEQGYPPAHQSLYPTIGSINYDP
FT                   TVETPEPTDARARRFTINRTDASVLIPPSDKLLVFRALTGIDSTPALNLSHHTPRTAPN
FT                   IGIYTRVVRAETKAAKRYRFHAALINTCLGIQIVVAAALTALGAARGPHNAVTAFGAIN
FT                   TIVAGILTYLKGSGLPDRLKHYQNEWRNIREYIEQRERELCLEGCGLDVEEEIRIIEQM
FT                   YEGVKREIEATKSGGDNRSFSRDRTSTRRPVIQQTEQSREYAPRRSPSPARTSEAFEKH
FT                   YHEPRREFTPRPPSPARVHERFEKHY"
FT   gene            complement(1132664..1132991)
FT                   /locus_tag="ANIA_11307"
FT                   /old_locus_tag="AN11307.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(1132664..1132912,1132968..1132991))
FT                   /locus_tag="ANIA_11307"
FT                   /old_locus_tag="AN11307.4"
FT                   /note="transcript_id=CADANIAT00008192"
FT   CDS_pept        complement(join(1132664..1132912,1132968..1132991))
FT                   /locus_tag="ANIA_11307"
FT                   /old_locus_tag="AN11307.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008192"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008192"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008192"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN02"
FT                   /protein_id="CBF85117.1"
FT                   /translation="MPGRQRIQHKQDEPVPDYEALEAEARRYKHAVFLLVETIRKNSPA
FT                   DTLELIDAIRNTKSVSEAAGLVMQLSETASSPEGGTQRDSEARSQ"
FT   gene            1135521..1136820
FT                   /locus_tag="ANIA_01563"
FT                   /old_locus_tag="AN1563.4"
FT                   /product="dehydrogenase, putative (AFU_orthologue;
FT                   AFUA_8G05760)"
FT   mRNA            join(1135521..1135670,1135745..1135811,1135884..1136167,
FT                   1136237..1136820)
FT                   /locus_tag="ANIA_01563"
FT                   /old_locus_tag="AN1563.4"
FT                   /note="transcript_id=CADANIAT00008193"
FT   CDS_pept        join(1135523..1135670,1135745..1135811,1135884..1136167,
FT                   1136237..1136820)
FT                   /locus_tag="ANIA_01563"
FT                   /old_locus_tag="AN1563.4"
FT                   /product="dehydrogenase, putative (AFU_orthologue;
FT                   AFUA_8G05760)"
FT                   /note="transcript_id=CADANIAT00008193"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008193"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008193"
FT                   /db_xref="GOA:C8VN03"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN03"
FT                   /protein_id="CBF85118.1"
FT                   /translation="MGDAAVQKPHILVVIHRAFPGFMTGEIRNEFPDAEVRFVTPQVGD
FT                   RLPADIVKQSTIIVTGRSLPNPEDAKHIKFIHFFSAGLDKVIHDPVLTDSEIPVTTSSG
FT                   IHGPPIAEWTVMNWLVASREYSITYENQKKHIWGSVDLYSHGIQDHVGKKVGILGYGSI
FT                   GRQIARVAVSLGLSVYAYTASPKPTPESRRDRHYIIPGTGDADGTLPVSWHHGTSKASL
FT                   HEFLSLGLDHIVVSLPLTPSTTHLLGAQEFAILAANKNPKHRNPYLTNISRGKVIDQDA
FT                   LIASLKSGELSGAALDVTDPEPLPEDHELWDTPNVQISPHVSSLGQEYFVRSFDIVREN
FT                   LERVKDGLPLINEYKRGRGY"
FT   gene            complement(1137168..1139867)
FT                   /locus_tag="ANIA_01564"
FT                   /old_locus_tag="AN1564.4"
FT                   /product="DNA mismatch repair protein, putative
FT                   (AFU_orthologue; AFUA_8G05820)"
FT   mRNA            complement(join(1137168..1138981,1139031..1139413,
FT                   1139461..1139867))
FT                   /locus_tag="ANIA_01564"
FT                   /old_locus_tag="AN1564.4"
FT                   /note="transcript_id=CADANIAT00008194"
FT   CDS_pept        complement(join(1137168..1138981,1139031..1139413,
FT                   1139461..1139867))
FT                   /locus_tag="ANIA_01564"
FT                   /old_locus_tag="AN1564.4"
FT                   /product="DNA mismatch repair protein, putative
FT                   (AFU_orthologue; AFUA_8G05820)"
FT                   /note="transcript_id=CADANIAT00008194"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008194"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008194"
FT                   /db_xref="GOA:Q5BD16"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD16"
FT                   /protein_id="CBF85120.1"
FT                   /translation="MPIVALPPATVRAIGSTSIISDPYSLAKELLDNALDAFATLVSVE
FT                   ISQDTVGLLQVKDNGHGIPADDYMVVCKRTFTSKIHTVEDLQKVGGKSLGFRGEALASA
FT                   AELSGALNISTRVETDPVGSSLEYGRNGELTRTERISHPVGTTVRILNLFQQIPVRRQT
FT                   AIKNSKKTLLKIKKMVQAYAMARPSIRLSFKVLKAKNESLNWMYAPGENGTLTEAALRV
FT                   GGTGIAPNCILKNWPTPSKDGNASPEDLGFRLVALLPKVGSDITKFNNLGQYISVDNRP
FT                   LSSGRGFAQDITKLFRRYLRSAASRDGLSPPINDPFLCVHVLCLGGAYDANIEPSKDDV
FT                   LFENQQAVLSLVEDLLRDTYGDLSNVHEDHGSTGQGRGTSQRNGFEALLSKKQQSAALS
FT                   TPALDSSPQERSSVSARLFARPESCRSPPEPHSCGEQADRSLLTRLNNPRATMGTASPV
FT                   VDAQDQGRLSLHKKIHLPGININPRETRQRDDVRPCLPSPTSSADSPAAALNTTPSSSL
FT                   GPSQLSPATSARDRQQQRQIGRERYGNGSLDTWFLKLSQSSQSPAATEEPETQIEDPPL
FT                   SQLTQDYFGTERARPNGTSDLANNPSQTASEISLQDSLADSGSTEGSPRTLARPARFVN
FT                   KPGLPVLEQWSARLYSAASPEENPELQKALEFETRKKAAIQERRMQLQNPKPTTSKNSP
FT                   HQSRYLAARAALSSQPRPSSVTQQSRSELGEISSHGTGVSKTFLSPQDPRAYLIQLQNS
FT                   DVPGGPKLKRISSAKLPFEKIPEEHDLHSMGLTLPAGLPLIYSSFKNLWINDLYTQSGE
FT                   QVEGFVSPDIKTAFESWDAHLSSLIRARYRLAKNSDIPNLQFDFSELSRVSQGSG"
FT   gene            1140151..1141648
FT                   /locus_tag="ANIA_01565"
FT                   /old_locus_tag="AN1565.4"
FT                   /product="Palmitoyltransferase pfa4 (EC 2.3.1.-)(Protein
FT                   fatty acyltransferase 4)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BD15]"
FT   mRNA            join(1140151..1140485,1140535..1140706,1140753..1141052,
FT                   1141102..1141180,1141227..1141648)
FT                   /locus_tag="ANIA_01565"
FT                   /old_locus_tag="AN1565.4"
FT                   /note="transcript_id=CADANIAT00008195"
FT   CDS_pept        join(1140151..1140485,1140535..1140706,1140753..1141052,
FT                   1141102..1141180,1141227..1141648)
FT                   /locus_tag="ANIA_01565"
FT                   /old_locus_tag="AN1565.4"
FT                   /product="Palmitoyltransferase pfa4 (EC 2.3.1.-)(Protein
FT                   fatty acyltransferase 4)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BD15]"
FT                   /note="transcript_id=CADANIAT00008195"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008195"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008195"
FT                   /db_xref="GOA:Q5BD15"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR033682"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD15"
FT                   /protein_id="CBF85122.1"
FT                   /translation="MLCSSFSVSRLAIPAVCILIAFLAYTSQIFFLYFEDAPLKEDEVW
FT                   RINILAICIWICYYRACTVDPGHVPKGWMPSDRERLKADRASGRQRWCRRCEAYKPPRA
FT                   HHCKTCERCVPKMDHHCPWTSNCVSHFTFPHFARFLFYAVVGIAYLETRLWQRVSKVWG
FT                   SRHLPSYLGPSMGQIGHLFVLFVTNSLTLFALSLLLLRTLWSLGSNTTTIESWEIERHE
FT                   TLLRRARRLGGSLPGPGGISVHITKQEFPYDIGIWSNIRAGMGGSANVLSWFWPLARTP
FT                   DRSTGLEFEENGFEDPTVSWPPPDPDRIPLPPMDQRDSFMYDITDTSGTSGQIDIEAFN
FT                   RRKEADLRRRRAPTEIERRKPFHVRLEEYSNGSSDAEADTGSDDDSDHGEEGWKNSEGE
FT                   RLRDFGVDEEAEFYDEEDIPLALLIQQRAKRQHLSQ"
FT   gene            complement(1141704..1142670)
FT                   /locus_tag="ANIA_01566"
FT                   /old_locus_tag="AN1566.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1141704..1142205,1142278..1142561,
FT                   1142617..1142670))
FT                   /locus_tag="ANIA_01566"
FT                   /old_locus_tag="AN1566.4"
FT                   /note="transcript_id=CADANIAT00008196"
FT   CDS_pept        complement(join(1141704..1142205,1142278..1142561,
FT                   1142617..1142670))
FT                   /locus_tag="ANIA_01566"
FT                   /old_locus_tag="AN1566.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008196"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008196"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008196"
FT                   /db_xref="GOA:C8VN06"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN06"
FT                   /protein_id="CBF85124.1"
FT                   /translation="MSATQQTQAERKDNWSSEAYSASAAFVPKLTQTLLQYLDPQPSDS
FT                   VLDIGCGDGKFTELFLPYVSKVLGVDSSPAMIEAARKGYGSEKAEFQVLDCCFLEQNSD
FT                   VADGTWDKVVSNAALHWILRNEKTRLSTLKGIHASLKKGGAFVFEMGGHGNVAEIQAAM
FT                   QYALLRQGISIEKARESYPWFFPSVPWMSSTLESLGFKVVKMESEYRPTKLTSDTNGGL
FT                   AGWVRLMGAAFLDVVDTEKREEVIREVCEVLQTVTTREEDGSQWLGYVRLRGVAVKI"
FT   gene            1144389..1145121
FT                   /locus_tag="ANIA_01567"
FT                   /old_locus_tag="AN1567.4"
FT                   /product="MBL2-like secreted peptide, putative
FT                   (AFU_orthologue; AFUA_5G00910)"
FT   mRNA            join(1144389..1144768,1144844..1144920,1144975..1145121)
FT                   /locus_tag="ANIA_01567"
FT                   /old_locus_tag="AN1567.4"
FT                   /note="transcript_id=CADANIAT00008197"
FT   CDS_pept        join(1144464..1144768,1144844..1144920,1144975..1144994)
FT                   /locus_tag="ANIA_01567"
FT                   /old_locus_tag="AN1567.4"
FT                   /product="MBL2-like secreted peptide, putative
FT                   (AFU_orthologue; AFUA_5G00910)"
FT                   /note="transcript_id=CADANIAT00008197"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008197"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008197"
FT                   /db_xref="GOA:C8VN07"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN07"
FT                   /protein_id="CBF85125.1"
FT                   /translation="MKFTVAGVLALASLALAMPAPEAAAVAEAEALEAPVPVDISPEAL
FT                   GLEKRANTVCKIVNSSSSKVNCRTGPGFDYPASYSVIPGKYYEFRCYKSGDCYNGNCTW
FT                   QRINWDGKTCYVNGYYTDSKCTVAALGKC"
FT   gene            complement(1146366..1148294)
FT                   /locus_tag="ANIA_01568"
FT                   /old_locus_tag="AN1568.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1146366..1147412,1147482..1148045,
FT                   1148094..1148294))
FT                   /locus_tag="ANIA_01568"
FT                   /old_locus_tag="AN1568.4"
FT                   /note="transcript_id=CADANIAT00008198"
FT   CDS_pept        complement(join(1146366..1147412,1147482..1148045,
FT                   1148094..1148294))
FT                   /locus_tag="ANIA_01568"
FT                   /old_locus_tag="AN1568.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008198"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008198"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008198"
FT                   /db_xref="GOA:C8VN08"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN08"
FT                   /protein_id="CBF85127.1"
FT                   /translation="MGKGKPRLLLNHRPSIHPSKMQIKSGYYIGIDVGTGSARACIIDH
FT                   NGDIVGLASKDIGLWQPEQQHYEQSTLNIWQCICASVQQALAERAIPSSQVHGIGFDAT
FT                   CSLAVFSKTTNKPVSVTRQGGFSTERNVILWLDHRAVKETELINATGHKVLKYVGGTMS
FT                   PEMEMPKILWLKNQMPPEVFADCKFYDLVDALTHIATGEETRSYCSLVCKQGYLPSQVE
FT                   GSTTGWQGDFLESIGLGELAADGFARIGGVNGETGQHLSAGERAGRLSARAAKELGLPP
FT                   GIAVGAGVIDAYAGWIGTVGTKIDGVDVVGNHNRADAFNRLAAVAGTSTCHIAMSSNPV
FT                   FVPGVWGPYRDTVFRGCWMAEGGQSATGQLLKHVLDTHPASKSAFAVAADRGLDIFSFL
FT                   DGHLAALAAKQNLPCIAALARHFFFYGDFFGNRSPLADPNMTGSVVGLTADTSIDSLAI
FT                   HYYGTLEFIALQTRQIVETMNKAGHAITSIFMSGSQCKNRTLVKLIATACNMPVIVPRG
FT                   RHVEAAVCHGAAMLGVKAANLDAPGKTVDLWDVIEQTSKPGDVCHPTTAEYERALLAAK
FT                   YQVFLDQCTRQREYREMVDRVAFPNQV"
FT   gene            1150187..1152341
FT                   /locus_tag="ANIA_01569"
FT                   /old_locus_tag="AN1569.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(1150187..1150422,1150482..1151188,1151239..1152341)
FT                   /locus_tag="ANIA_01569"
FT                   /old_locus_tag="AN1569.4"
FT                   /note="transcript_id=CADANIAT00008199"
FT   CDS_pept        join(1150187..1150422,1150482..1151188,1151239..1152341)
FT                   /locus_tag="ANIA_01569"
FT                   /old_locus_tag="AN1569.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008199"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008199"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008199"
FT                   /db_xref="GOA:C8VN09"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN09"
FT                   /protein_id="CBF85129.1"
FT                   /translation="MDPDLDSASQRSESRVEDDQPPPSKKARTNGPRRKPACQTCRRRK
FT                   IRCDNGQPACGYCHANEIPCVYTARGDERTVGQQELAKVFERLDTLTETVENIQHLLIS
FT                   RNNTPLAPRDSAPAVQLQRPERVPKRAQEWQQDYLQIPACRCSADAVLTWPIFGGQFRD
FT                   NSLITTLFQYSSDGGVEHQSVQSAHPDTGGFRITPDEQIPALVDQFIQNVHTKNPILDL
FT                   EALVRSARHAGEYGLQWDAQSCLVLLACALGCISQPFTSSRQGHGLGWGRRASTSSSLG
FT                   RLREGEAFFMMARKRIGLLNYSVIGAECHFFAGVYLMYTFRPLPAWNHFYQASTFYRLR
FT                   LRLIEGLDRSVYEAEQQPPVAQRLEQSLYWSCFKSEVEIRVELPLPQSAIAEYEYPALF
FT                   PTPPTLSEEYPTRQGQNHISDWDVRDEPASAPEPPDLVPGQAVYNHISRLFNEEQSWYY
FT                   YLTEVALRRIGNRVLNAFYREDSSTWANVRPLIPMALEFESQINAWFANLPPSMRYYES
FT                   GPDTIQHGQRTSTRESISLELSWAIGNRFLEIRLWLYQPFLYYAVHHYDQYHKPPPIHT
FT                   EEESTIIQDLVNSGIDCTLKILQARCLRHRHHGIWFDLRALVTASLIVIAFARSGTNSV
FT                   ELARIYRAGLRTHLTPTLETLAYWADEAPDIKRAREVLDGLLEGLE"
FT   gene            1153140..1154239
FT                   /locus_tag="ANIA_10217"
FT                   /old_locus_tag="AN10217.4"
FT                   /product="aldo-keto reductase (AKR13), puatative
FT                   (AFU_orthologue; AFUA_7G00700)"
FT   mRNA            join(1153140..1153333,1153386..1154239)
FT                   /locus_tag="ANIA_10217"
FT                   /old_locus_tag="AN10217.4"
FT                   /note="transcript_id=CADANIAT00008200"
FT   CDS_pept        join(1153168..1153333,1153386..1154239)
FT                   /locus_tag="ANIA_10217"
FT                   /old_locus_tag="AN10217.4"
FT                   /product="aldo-keto reductase (AKR13), puatative
FT                   (AFU_orthologue; AFUA_7G00700)"
FT                   /note="transcript_id=CADANIAT00008200"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008200"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008200"
FT                   /db_xref="GOA:C8VN10"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN10"
FT                   /protein_id="CBF85130.1"
FT                   /translation="MTLPTRPLGKDGPQVPRLGFGTMGLSAFYGPTKPDEERLAVLDRA
FT                   YELGETFWDTAMLYGDSEELIGRWFAANPGKRADIFLATKFYFRWVNGERVTDTSYENC
FT                   KRCCNESLRRLGIDTIDLFYAHRLDPKTPIEETMKALAELKEEGKIRYIGLSECSSDSL
FT                   RRACKVHHVAAVQVEYSPFSLEIESEQIGLLKTARELGVAVVAYSPLSRGILSGQIRSR
FT                   DDFGPGDLRAMLPRYSPENFGKNLEAVDKLATLAKEKGCTVSQLTLAWLLSQGDDIFPI
FT                   PGTTRISALEENVESLKVQFTEEEERRFRSIISEAEVAGGRYPDAYAGTLYVDTVLPE"
FT   gene            1154744..1156300
FT                   /locus_tag="ANIA_10218"
FT                   /old_locus_tag="AN10218.4"
FT                   /product="hypothetical protein"
FT   mRNA            1154744..1156300
FT                   /locus_tag="ANIA_10218"
FT                   /old_locus_tag="AN10218.4"
FT                   /note="transcript_id=CADANIAT00008201"
FT   CDS_pept        1154744..1156180
FT                   /locus_tag="ANIA_10218"
FT                   /old_locus_tag="AN10218.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008201"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008201"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008201"
FT                   /db_xref="GOA:C8VN11"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN11"
FT                   /protein_id="CBF85132.1"
FT                   /translation="MPTTSRHKHRIYFAYGINMHLKQMAKRCPNTRYLGVAKLSGYRWQ
FT                   INERGYANVIEASAESRASPTTVQGLCYLIGAEDELKLDRVEGVPTAYQKRVLRVELVL
FT                   AKSSLVGRDVSEIASFSGEELKAGSGRGEAEVVEALAYVSKDYIKDGPPKGEYVARMRL
FT                   GLRDALELGMSKEYARVIERVVAVGMRGAGAGGMGRPPATSPRPRPQPSRTAAPRASPP
FT                   TSPASASYYYFAFGSNMQLAQMADRCPGSKVFAKGILPGYRWHINERGVANIVATATQD
FT                   GNDNAVQGILFTVTPKDVKTLDKKEGIAKGYYEKIVLRVKVEPLAISGLKGVKTVVAAG
FT                   KLASNSQAEAREPRKHRHGQDQHGQRAEVAGVREVEALVYLSSQYKKDGRVRAEYVGRM
FT                   QLAMADALKLGVDEAYLRASLHSCILGVDEAAVSAHGKRDFIVRQPAGDASGAAQTSGS
FT                   PKDRRIIERVPAGTGYQAAA"
FT   gene            complement(1156388..1157920)
FT                   /locus_tag="ANIA_01571"
FT                   /old_locus_tag="AN1571.4"
FT                   /product="Alpha-L-arabinofuranosidasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:O74288]"
FT   mRNA            complement(1156388..1157920)
FT                   /locus_tag="ANIA_01571"
FT                   /old_locus_tag="AN1571.4"
FT                   /note="transcript_id=CADANIAT00008202"
FT   CDS_pept        complement(1156388..1157920)
FT                   /locus_tag="ANIA_01571"
FT                   /old_locus_tag="AN1571.4"
FT                   /product="Alpha-L-arabinofuranosidasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:O74288]"
FT                   /note="transcript_id=CADANIAT00008202"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008202"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008202"
FT                   /db_xref="GOA:O74288"
FT                   /db_xref="InterPro:IPR007934"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015289"
FT                   /db_xref="InterPro:IPR036195"
FT                   /db_xref="InterPro:IPR038964"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74288"
FT                   /protein_id="CBF85134.1"
FT                   /translation="MTMSRSSRSSVLALALATGSLVAAGPCDIYSSGGTPCIAAHSTTR
FT                   ALYSSYNGPLYQVQRASDGTTTTITPLSAGGVADASAQDAFCENTTCLITIIYDQSGNG
FT                   NDLTQAPPGGFNGPDVGGYDNLAGAIGAPVTLNGKKAYGVFVSPGTGYRNNEAIGTATG
FT                   DEPEGMYAVLDGTHYNDGCCFDYGNAETSSLDTGNGHMEAIYYGTNTAWGYGAGNGPWI
FT                   MADLENGLFSGQSSDYNAGDPSISYRFVTAILKGGPNLWALRGGNAASGSLSTYYNGIR
FT                   PTDASGYNPMSKEGAIILGIGGDNSVSAQGTFYEGAMTDGYPDDATENSVQADIVAAKY
FT                   ATTSLISGPALTVGDTVSLKVTTSGYDTRYIAHTGSTINTQVVSSSSSSTLKQQASWTV
FT                   RTGLASTAAANGCVSFESVDTPGSYIRHSNFALLLNANDGTKLFSEDATFCPQDSFNDD
FT                   GTNSIRSWNYPTRYWRHYENVLYVASNGGVNTFDAATAFTDDVSWVVADGFA"
FT   gene            complement(1161180..1161547)
FT                   /locus_tag="ANIA_11308"
FT                   /old_locus_tag="AN11308.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(1161180..1161276,1161381..1161547))
FT                   /locus_tag="ANIA_11308"
FT                   /old_locus_tag="AN11308.4"
FT                   /note="transcript_id=CADANIAT00008203"
FT   CDS_pept        complement(join(1161180..1161276,1161381..1161547))
FT                   /locus_tag="ANIA_11308"
FT                   /old_locus_tag="AN11308.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008203"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008203"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008203"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN13"
FT                   /protein_id="CBF85136.1"
FT                   /translation="MTVSPAPSQSYPATSQRYPARYSPQTVTSLTPEMVMFAARWIVSV
FT                   SDSIARAGNRPARRDTLDFYLLDGARLASHKSANYLQAQTRY"
FT   gene            1162629..1163959
FT                   /locus_tag="ANIA_01572"
FT                   /old_locus_tag="AN1572.4"
FT                   /product="toxin biosynthesis protein (Tri7), putative
FT                   (AFU_orthologue; AFUA_8G05970)"
FT   mRNA            join(1162629..1163455,1163530..1163959)
FT                   /locus_tag="ANIA_01572"
FT                   /old_locus_tag="AN1572.4"
FT                   /note="transcript_id=CADANIAT00008204"
FT   CDS_pept        join(1162629..1163455,1163530..1163959)
FT                   /locus_tag="ANIA_01572"
FT                   /old_locus_tag="AN1572.4"
FT                   /product="toxin biosynthesis protein (Tri7), putative
FT                   (AFU_orthologue; AFUA_8G05970)"
FT                   /note="transcript_id=CADANIAT00008204"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008204"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008204"
FT                   /db_xref="GOA:Q5BD08"
FT                   /db_xref="InterPro:IPR032805"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD08"
FT                   /protein_id="CBF85138.1"
FT                   /translation="MASRLAIPPWLTPLTSWTLLQTLTSLTVTFTPSASSLRYVAAAMT
FT                   AICAYIFQTSIQNHFSGAPASGPLVAMCWVNVLNAIDLLVLSRASFDAYLSYRRSKEEK
FT                   KDSRRSSTEDSTKDRLLLALTLPYNYRRINTPWQLSRLPVLTPSSFPSSLTVNNRRKFL
FT                   LHSTVKLILAVIIMQIPLIDPSDPVVLQAVSQLDRSKSVLLLPFCAFTQKGGLHALWLQ
FT                   ARFTLAFGIVIRATIVAAYTAGSIFAVMLGGDPAEWPPVAGSLSEAWTLSRLWGQAWHQ
FT                   TLRRPLASNATFLAALAGFAPKSTVAHWIRVLVTFVESGVVHSACDMGFGIPFGESGGV
FT                   VFFSLQILGLVLESVCQSIAAKVGLRTGGRFSRAVGYIWVSVFMLWTAPVWANPILVNL
FT                   ASDGVNLMSPWLGFPAGSF"
FT   gene            complement(1164128..1166034)
FT                   /locus_tag="ANIA_01573"
FT                   /old_locus_tag="AN1573.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1164128..1165242,1165305..1165629,
FT                   1165682..1166034))
FT                   /locus_tag="ANIA_01573"
FT                   /old_locus_tag="AN1573.4"
FT                   /note="transcript_id=CADANIAT00008205"
FT   CDS_pept        complement(join(1164128..1165242,1165305..1165629,
FT                   1165682..1165879))
FT                   /locus_tag="ANIA_01573"
FT                   /old_locus_tag="AN1573.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008205"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008205"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008205"
FT                   /db_xref="GOA:Q5BD07"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR033121"
FT                   /db_xref="InterPro:IPR033876"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD07"
FT                   /protein_id="CBF85140.1"
FT                   /translation="MSVLLVFSLVTFALQGLCSLSLHESDSPHVLQLGLRRNQHNDPVG
FT                   RDRRRFKRQTGTVAVDLHGDSMGGDIYSTNLTIGDPPQAVEVSVDTGSADLWVVYSENP
FT                   VCNVRGARCDDSGTYDPTASTSFDGLSDEFAIEYGDSSWAEGYYGIDTLTVADAEVSEV
FT                   QFAVAVESSIDKGILGIGYSTNVVSTYRYPNLPERLVASNITSSNAYSLWLNRLGSDEG
FT                   TILFGGVNTAHYTGPLRTLPVVRYNGHYIHLWLTLTGMGVESASDDITKSYSETRSTTG
FT                   EQEFPFVALLDSGATLTYLPSNIVAQIFSDLDVHLYEPEQFGYVPCDTYLVGREDYNLT
FT                   FTFSGVTIRVPLRELVLRDAISGPGRDALQLPNNADEESCLFGILPNTDLFPILGDTFL
FT                   RSAYVVFDLDNNEISLAQANTAPGDDRILEIGSGDDAVPEAEDVDDPVTTATVSLGGSS
FT                   LILPTGWTNEPIFPSRTVTTSTTATSTGTNTGSGEDTEATDSDQGTSGGTGTQAEGPVA
FT                   TDGAVGVGNSPLLAIAMAALVLNMVLAL"
FT   gene            complement(1167333..1168097)
FT                   /locus_tag="ANIA_01574"
FT                   /old_locus_tag="AN1574.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(1167333..1167622,1167767..1168097))
FT                   /locus_tag="ANIA_01574"
FT                   /old_locus_tag="AN1574.4"
FT                   /note="transcript_id=CADANIAT00008206"
FT   CDS_pept        complement(join(1167333..1167622,1167767..1168097))
FT                   /locus_tag="ANIA_01574"
FT                   /old_locus_tag="AN1574.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008206"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008206"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008206"
FT                   /db_xref="GOA:C8VN16"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN16"
FT                   /protein_id="CBF85142.1"
FT                   /translation="MGPEPRPDSRSSHTDTNTSASLRPRPRPRNEAHLDPDNLELHEIE
FT                   TQQDDDSGVSISSGEYRITTRRTVSRTSTSQTQRPRREGLLGRIQRFWTRHVVLTVAQK
FT                   KNRDYFALERTFLAYIRTSVILAMQGVLIAQLFRLQFAGSSKGLGYHEVGVPLSVTCHC
FT                   AAIVTAILGAHRFWKQQSAIALGTVYAGGWELNCIGFLTTAVS"
FT   gene            complement(1169249..1171962)
FT                   /locus_tag="ANIA_01575"
FT                   /old_locus_tag="AN1575.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1169249..1169339,1169631..1169707,
FT                   1169870..1169891,1169990..1170297,1170445..1170539,
FT                   1170725..1170890,1170952..1171082,1171281..1171605,
FT                   1171664..1171789,1171885..1171962))
FT                   /locus_tag="ANIA_01575"
FT                   /old_locus_tag="AN1575.4"
FT                   /note="transcript_id=CADANIAT00008207"
FT   CDS_pept        complement(join(1169249..1169339,1169631..1169707,
FT                   1169870..1169891,1169990..1170297,1170445..1170539,
FT                   1170725..1170890,1170952..1171082,1171281..1171605,
FT                   1171664..1171789,1171885..1171962))
FT                   /locus_tag="ANIA_01575"
FT                   /old_locus_tag="AN1575.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008207"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008207"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008207"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD05"
FT                   /protein_id="CBF85144.1"
FT                   /translation="MRRPRLPVWETGRQTDREARRLYCFQVSESSRRSATPSSAWARSM
FT                   ISSYSYAWATRTARWQGNERGDAPTGGSSEHRAGADLCIVLISILLLKKTRSRLVSSAV
FT                   SLETVGSESEDRPRQSATSLTIAQAFVGLYLGWSSTSTPKALVQDDVRSRLFPDIEGAT
FT                   GGRKQHRHDQHIHERQQLPWETEYNAYFARFQHAVEMAKQLLTAASSMKPMPTFAVNEA
FT                   LLLLCRWRRYKGIWSSGTAARVLTRVIEIETVGLVPGNSIADFSWIDSVHVDVRCSADC
FT                   CWAKWSIGNAQGQSQTLFYAAPTSAILSYTEPPLSNGHTEPATTSSKVTMASTVMAPTP
FT                   GLPAVSNVLPDISLIRRAYLLNLGGNGFNVAVFASSFPSSLSWHRTKAWSFMIGTACDR
FT                   LLVLGMRHASRLSRSMYMVVQSRLAMTVPQCGRMNIMIAGPPSRSGRRHDLYRGHTAER
FT                   MGPSDIGFQDSGLT"
FT   gene            1174761..1176190
FT                   /locus_tag="ANIA_01576"
FT                   /old_locus_tag="AN1576.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1174761..1174873,1174929..1175368,1175444..1175565,
FT                   1175606..1176190)
FT                   /locus_tag="ANIA_01576"
FT                   /old_locus_tag="AN1576.4"
FT                   /note="transcript_id=CADANIAT00008208"
FT   CDS_pept        join(1174761..1174873,1174929..1175368,1175444..1175565,
FT                   1175606..1176190)
FT                   /locus_tag="ANIA_01576"
FT                   /old_locus_tag="AN1576.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008208"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008208"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008208"
FT                   /db_xref="GOA:C8VN18"
FT                   /db_xref="InterPro:IPR022185"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN18"
FT                   /protein_id="CBF85146.1"
FT                   /translation="MKFADIPGGSGMIISRGTLSAMGFSALSCLPYCSPFCKIIYAVPA
FT                   FTTYLLNESPLPSLQVSLLTPTNDSILFSASSEIKVPDALTMHLDSMHAEIFRPQPRGR
FT                   PKEDLIPLAEVDISKLHFKGNQKITMKNQTLKLGDVGQFARLVEDAAYHSTFRTAMHAK
FT                   TKVGLAGLTTSIDITKEVEMPGFSNFTELAINDLTIRERDDQGNNIFAETVLFNPTPAS
FT                   VTLVMKLTLWDKGDVTLSILAANHSIGTATSSINNIKSGNNTLSIRAFLDGDVLEENIS
FT                   GIIREQIPYLRKGDIKITATGKSVVYNGQHLEYWETALQAVRVEVTRSVREVVNMVLDT
FT                   LDGDDIVGEDGDDSGFGIFGFEIDIPRVQEGVRSVVEGLVEQILDTAKGLDENEEDTFT
FT                   EELTVLGRLILRLLQVLGVL"
FT   gene            1180410..1182394
FT                   /locus_tag="ANIA_01577"
FT                   /old_locus_tag="AN1577.4"
FT                   /product="MFS lactose permease, putative (AFU_orthologue;
FT                   AFUA_6G01860)"
FT   mRNA            join(1180410..1180547,1180613..1180826,1180896..1181245,
FT                   1181324..1181546,1181614..1182044,1182131..1182394)
FT                   /locus_tag="ANIA_01577"
FT                   /old_locus_tag="AN1577.4"
FT                   /note="transcript_id=CADANIAT00008209"
FT   CDS_pept        join(1180410..1180547,1180613..1180826,1180896..1181245,
FT                   1181324..1181546,1181614..1182044,1182131..1182394)
FT                   /locus_tag="ANIA_01577"
FT                   /old_locus_tag="AN1577.4"
FT                   /product="MFS lactose permease, putative (AFU_orthologue;
FT                   AFUA_6G01860)"
FT                   /note="transcript_id=CADANIAT00008209"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008209"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008209"
FT                   /db_xref="GOA:C8VN19"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN19"
FT                   /protein_id="CBF85148.1"
FT                   /translation="MERRTYGFETTISRDADKGVFSVNNAALHMATLRVKPRLLTKRML
FT                   KLYWCIGVAMLNSCINGYNGSLMGSINSYRQYREYFGFDLEEGTSTTGIVYAIYTIGNI
FT                   VGSFFAGPFTDFRGRRMGMAIGALWIIAGTIVQATCHNLGGFMAGRFLLGFGVATSATA
FT                   GPAYVSEMAHPAYRGAMTGLYNVLWFGGGIPGTFIPWRTSTIDGTQSWRIPVWLQMVFS
FT                   GLVLLLCFTIPESPRWLISCDRHEAAIRVLAEYHGEGDRNSPLVQLEYREMLEDISNVG
FT                   ADKRWWDYRELFDSRETRYRSMLVVFMAFFGQWSGNGPVSYYYPQMLAGAGISSNHTRL
FT                   LLQGLQNIVQFTGAIFGALITDRVGRRPQLLVSTSIIVFLFVIITALNATNVQVAGDGG
FT                   GVVAKSSVTARAQIAMIFIFGFVYSAGWTPNQAMYPVECLRYESRAKGMGMNNFFINIA
FT                   SFYNTFVTGIAFTRIGWKYYFLFIFWCTFEVLIIYFLFVETSKRTLEELTVIFQQKRPV
FT                   QASLDKEEIFVSGDEIVEVRSW"
FT   gene            complement(1183213..1186281)
FT                   /locus_tag="ANIA_01578"
FT                   /old_locus_tag="AN1578.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1183213..1186068,1186218..1186281))
FT                   /locus_tag="ANIA_01578"
FT                   /old_locus_tag="AN1578.4"
FT                   /note="transcript_id=CADANIAT00008210"
FT   CDS_pept        complement(join(1183487..1186068,1186218..1186281))
FT                   /locus_tag="ANIA_01578"
FT                   /old_locus_tag="AN1578.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008210"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008210"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008210"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD02"
FT                   /protein_id="CBF85149.1"
FT                   /translation="MFWALTDTKYAGKRRYSTGQAFAKMLPQFLQGSYARYKADTNIFA
FT                   TWLLEAANQCGYQPSSLFASVPTAKKSQQKGKNNASDAEPLHYRATIKDLQKLAEVIAS
FT                   SALTVPEPVLTIAKRAIRLRKVVTSWFLGHGDTTSNERHAHFITVLERICETLEWKSSQ
FT                   STRPDINHPLPTPEAQSDDANVDGFLNRFAVLTVEEPQDTEEAQATPVGSKKVVKVTVV
FT                   EDNNEAEDSYFGLLFFKTLCLLRDLENMRRFISITWSEYRDKKIDLMNAAIVTDSALQL
FT                   ARELVEEVEADWHTSLTGKEDNVQNIVYNYAVLTRGSSAAPSREIGLPYNKNMADIAEW
FT                   CYVPTMVVLESFAKVLQVNHQPVFKKGSFGTYDPKMDRERMSLGQKFNEDQTILFSILP
FT                   EFCMVNRFGIQMPVQDAVTRGVVEFIKTKKVTLWLCFASQIFLDVHHTMRHSTLGAFED
FT                   LRMSGLRIQKTIDDYLQLSKTHPQPRFWPKEGDEEIRNISSTVQSWIIQDRFLDIRVQT
FT                   KLDRIGPPPEKHALFSQHAILCGLILFHLNTRMQFVGQQLLNQWYDVQQLAFLHNLVIK
FT                   SPAHKNLRWPDMDAFIKIHGESHIFIGSRPGDAVESLKRLELVTGISSVANFARDSRSR
FT                   RFHNPNGKHARSLKPTTTVANLFFTKYVEGTEEGAGIVDFDRVLDELSQKSKLGASTEG
FT                   IQRADPQSIITRKWSNTHNIDTLQLLAFLKAKLFEEEPIILYNYFGMHKRSVELLRLIR
FT                   DKEHQKFVQYFTSVYLPDESFISNIVILIHHVVQGSAQNARAMGLASGGVEVGSRILIS
FT                   AGDVMREYLKKNGDLACKELRVFCKNKKPIQDDAYDESESDELVHSWLSLEDVLGPKGV
FT                   ASLMTGIQIA"
FT   gene            1188333..1189891
FT                   /locus_tag="ANIA_01579"
FT                   /old_locus_tag="AN1579.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1188333..1188547,1188590..1188781,1188850..1189005,
FT                   1189064..1189231,1189304..1189354,1189492..1189891)
FT                   /locus_tag="ANIA_01579"
FT                   /old_locus_tag="AN1579.4"
FT                   /note="transcript_id=CADANIAT00008211"
FT   CDS_pept        join(1188333..1188547,1188590..1188781,1188850..1189005,
FT                   1189064..1189231,1189304..1189354,1189492..1189891)
FT                   /locus_tag="ANIA_01579"
FT                   /old_locus_tag="AN1579.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008211"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008211"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008211"
FT                   /db_xref="GOA:C8VN21"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN21"
FT                   /protein_id="CBF85151.1"
FT                   /translation="MAQVCTPESLYGYDHAYKIADQSTLDTIASECTSINGSIYIMSNY
FT                   TGPFYLPNIRNISGDVHWYADTSYLYDSISFPDLEHINGSLDLQAGYNLRNISAPKLNL
FT                   VGRLVQVDYAHDVDLRSLQHAEYASIFGNLSSLRLDSLQSINRTLKICNKDSCSSSLSP
FT                   VTSLELYLLSLESSTYIELEGRISTLVVPELTSVVGLETSPALQSSEGFQLTTAGGPPL
FT                   NLVFPRLDTVYGRFQVSGNIASLSMPKMIDTNMTLEVNAVNLPSLRRASDGIYIYSDMA
FT                   LDCDAIEEEIFRNVSISNGSKTCSAKEAEPESHGLSTGDKAGIGIGSGFAGIIIFVLIP
FT                   LYIRHRKKEKERLKAVSEVELMPPSYQAAQQDRASLPEYSPGEHRPVASPRGT"
FT   gene            complement(1191996..1195533)
FT                   /locus_tag="ANIA_01580"
FT                   /old_locus_tag="AN1580.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1191996..1192949,1193020..1193807,
FT                   1193889..1195533))
FT                   /locus_tag="ANIA_01580"
FT                   /old_locus_tag="AN1580.4"
FT                   /note="transcript_id=CADANIAT00008212"
FT   CDS_pept        complement(join(1191996..1192949,1193020..1193807,
FT                   1193889..1195533))
FT                   /locus_tag="ANIA_01580"
FT                   /old_locus_tag="AN1580.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008212"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008212"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008212"
FT                   /db_xref="GOA:Q5BD00"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD00"
FT                   /protein_id="CBF85153.1"
FT                   /translation="MTSLTRDEYTFAWICALPLEMAAARAMLDKIHSPLPKQSADPNAY
FT                   EVGELNGHYIVIACLPAGVYGTVSAATVVSRMRLTFPRLQYGLMVGIGGGVPGRNNDIR
FT                   LGDVVVSKPVGKYSGVLQYDYGKAVQGGIFEPTGTLNKPPHAFLTHMGQLEAKQMTEGK
FT                   AALSKIVREALEKNPEMTEKFAPPEHYTDRLFHSSYHHIPGEDTCERCDVKQLIKRQPR
FT                   ETRSPYVHYGLIASGDQVMKDSETRDRLARQHGILCFEMEAAGLMDELPTLVIRGICDY
FT                   CDSHKQKQWQSYAALTAAAYAKLLLSIMPVCRTCRTESNASERNLLRHWMVSLERNPRF
FT                   VGRQDELSQLEKLLTAPDGPKRVAITGLGGVGKTQLALEVAHRIRNQDRECSVFWVPCT
FT                   SYAMIEQTFMNIAHMLGLHEVKPAEVKERVKLYLSSQRAGKWLLIFDNADDADMWLTTT
FT                   PALEEILPKSEQGRILFTTRNGELAVELTSSNIIHIPDLDKKTAHDMLDRLVLQKNLLQ
FT                   DPVTTSSFLEQLAYFPLAISQASAYINKKRLRRYNDIQNPVITTWLISFKQIQQQDQLA
FT                   ADYLSFMACLDPRNIPSSLLPNQSTDKQKLDALGLLNAYSFTQCQGTQISMHRLVHIAI
FT                   RNWLRKNGLFSLWIQRVADHLEKLFPNSSHHNRGLWRGYLPHALALVHENEFILQLGQY
FT                   TELFERISGCLTRDGRYSEAEVLYSKLMTINQEKNSYEHPDTLRSMANLASTYWNQGRW
FT                   NEAEKLGLQVLETRKAVLGPEHPDTLSSMANLASTYWNQGRWNEAEKLELQVLETSKAG
FT                   RWNEAEKLGLQVLETRKAVLGPEHPDTLSSMANLASTYWNQGRWNEAEKLGLQVLETRK
FT                   AVLGPEHPDTLSSMANLASTYWNQGRWNEAEKLELQVLETSKAVLGPEHPDTLTSMANL
FT                   ASTYRNQGRWNDAEKLDVQVLETRKAVLGPEHPDTLTSMANLASTYWNQGRWNEAEKLD
FT                   VQVLETRKAVLGPEHLHTLSSMANLASTYWNQGRWNEAEKLEVQVLETRKAVLGPEHPD
FT                   TLSSMHNLAYTYHSMGRNTEASDLMTQCATLRARNIGSTHPDTLSSSDALTEWQKLDHH
FT                   RSSKPGKGRKLKALGRVLGFK"
FT   gene            1196151..1196882
FT                   /locus_tag="ANIA_11309"
FT                   /old_locus_tag="AN11309.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1196151..1196246,1196495..1196566,1196746..1196787,
FT                   1196856..1196882)
FT                   /locus_tag="ANIA_11309"
FT                   /old_locus_tag="AN11309.4"
FT                   /note="transcript_id=CADANIAT00008213"
FT   CDS_pept        join(1196151..1196246,1196495..1196566,1196746..1196787,
FT                   1196856..1196882)
FT                   /locus_tag="ANIA_11309"
FT                   /old_locus_tag="AN11309.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008213"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008213"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008213"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN73"
FT                   /protein_id="CBF85155.1"
FT                   /translation="MPILLPLGILAALTYLPRWSMMGDPIHIDLLDLFPNHGRHGYNPF
FT                   FSSAVLATWPWLATGDVVDTPLVIAKKAQLWVN"
FT   gene            complement(1198050..1199716)
FT                   /locus_tag="ANIA_01581"
FT                   /old_locus_tag="AN1581.4"
FT                   /product="proline transporter (Eurofung)"
FT   mRNA            complement(join(1198050..1199175,1199234..1199519,
FT                   1199569..1199716))
FT                   /locus_tag="ANIA_01581"
FT                   /old_locus_tag="AN1581.4"
FT                   /note="transcript_id=CADANIAT00008214"
FT   CDS_pept        complement(join(1198050..1199175,1199234..1199519,
FT                   1199569..1199716))
FT                   /locus_tag="ANIA_01581"
FT                   /old_locus_tag="AN1581.4"
FT                   /product="proline transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008214"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008214"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008214"
FT                   /db_xref="GOA:Q5BCZ9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ9"
FT                   /protein_id="CBF85157.1"
FT                   /translation="MSLDYGKKELQMGGSMNGGIASGEVFEHGTTKRGLKPRHSQMIAL
FT                   GGCVGTGLFVGTGASLALGGPAFLLGSFVLMSIVVYMIVTAIVEIAAYLPVAGASMSYY
FT                   GTRYVSRSLGFAMGWLYVYSLGILVPYEVTAGALVIDYWDSPVNVGVWITVFIVVIVAL
FT                   NLLPVEYYGEAEFWFASIKVFTIIGLLILSFILFWGGGPNQSGILGFHYWEDPGATKTW
FT                   LAEGATGRFIAFVGTLVLCAFPFTFSPELLISTSGEMQNPRKDLKKAANRFLLRLVVFY
FT                   VGAALAMSVISPSNDEALSNGGNNAKSSPFVVGIRHAGIRGLSSVVNASILTMAWSAGN
FT                   AYLYMSSRALYALAISGQAPKVFLRCTKGGVPYAAVLACGLFGFLAYLNCGNSSSTVFT
FT                   WFVTITNTSGFVSWICCCIVYLRFRAACKRQGVHELPYRSWLQPYGAWFGLVFFIVLAL
FT                   INGFNVFFPGQLTASSFLTAYIGLPAFAIIYAGHKLLLGRSDPWYLNAGEIDISDGLDI
FT                   EY"
FT   gene            1200259..1201644
FT                   /locus_tag="ANIA_01582"
FT                   /old_locus_tag="AN1582.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            1200259..1201644
FT                   /locus_tag="ANIA_01582"
FT                   /old_locus_tag="AN1582.4"
FT                   /note="transcript_id=CADANIAT00008215"
FT   CDS_pept        1200259..1201644
FT                   /locus_tag="ANIA_01582"
FT                   /old_locus_tag="AN1582.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008215"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008215"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008215"
FT                   /db_xref="GOA:Q5BCZ8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ8"
FT                   /protein_id="CBF85159.1"
FT                   /translation="MVTIKKPQPFKRALHFSEGEFEERRYRALELMKREQLDGFLITKQ
FT                   ETLYYLTGYDTFGYVFFQAMYFHIDGSMKLITRMPDLRQALYTSILKPEDIMIRSDDAS
FT                   SNPVSLVPRVLKQFGINSPNRRIGYEPNSATLTHEIGKLLEEAVDGLCTLVNHSTLFTR
FT                   ELRIVKSPTELRKIRKAAYLADFALIRALKLAKPGAYEGDLWREIVGTVYEGGGDDPAN
FT                   ENILVSGNKAVLTRYSAGKSKIDRQITLEHAGVYKHYHACLMRTIHIGGVTKLAREMFR
FT                   VNILQMEAAMAALKPGREIGDVFEAYARVADKNGFQDQRFNACGYSLGATFAPTWMDYP
FT                   MFVRGQKVIARPGMVFFIHIILMDKATDTASSIGQTVEVTQDGCVALSKLPFCITRKQT
FT                   IAAWKKVKKEDYGFTEEEEDEGENLQDVELSEGDVDAEDYDVEYDFSDYQPSAPPGDPT
FT                   QQA"
FT   gene            complement(1201901..1203082)
FT                   /locus_tag="ANIA_01583"
FT                   /old_locus_tag="AN1583.4"
FT                   /product="acetylornithine deacetylase, hypothetical
FT                   (Eurofung)"
FT   mRNA            complement(1201901..1203082)
FT                   /locus_tag="ANIA_01583"
FT                   /old_locus_tag="AN1583.4"
FT                   /note="transcript_id=CADANIAT00008216"
FT   CDS_pept        complement(1201901..1203082)
FT                   /locus_tag="ANIA_01583"
FT                   /old_locus_tag="AN1583.4"
FT                   /product="acetylornithine deacetylase, hypothetical
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008216"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008216"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008216"
FT                   /db_xref="GOA:Q5BCZ7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ7"
FT                   /protein_id="CBF85161.1"
FT                   /translation="MSIPHQSTPDVTIDDVVSLTQTLVQIDSSTPGSGSNTAGETTIAT
FT                   YIAAWLRHRGIEYHWIEETPGRPSVVAVVRGSGGGKTLMFNGHTDTVTLQGYDGDPLSG
FT                   RIADGRLYGRGSADMKSGLAAAMTAIAGAKKLHLRGDVILAAVADEECDSIGTEQVLAA
FT                   GWRADAAVIAEPTEFAIINAHKGYVLFEVDIHGIAAHGSRPDLGVDAICKAGYFLVELD
FT                   GYAQSLQQRGPSRVNTDAPNVHAGIIRGGAEINSYPAKCTISIERRTIAGETPDSVRKE
FT                   LLAILETLASTVPNFSFDLRMTSYRPPYFIAPDHAFVKLVADHAIKTTGNAPPIRSETY
FT                   WTDMALLSETGIPGVIWGPKGCGLHSKDESVEIESIRQLADAFVAIVETFCQG"
FT   gene            1203720..1206021
FT                   /locus_tag="ANIA_01584"
FT                   /old_locus_tag="AN1584.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(1203720..1203790,1203850..1204005,1204061..1205120,
FT                   1205170..1206021)
FT                   /locus_tag="ANIA_01584"
FT                   /old_locus_tag="AN1584.4"
FT                   /note="transcript_id=CADANIAT00008217"
FT   CDS_pept        join(1203720..1203790,1203850..1204005,1204061..1205120,
FT                   1205170..1206021)
FT                   /locus_tag="ANIA_01584"
FT                   /old_locus_tag="AN1584.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008217"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008217"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008217"
FT                   /db_xref="GOA:C8VN77"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN77"
FT                   /protein_id="CBF85162.1"
FT                   /translation="MTELVWSLGGARKTKPSRSLSYTGCWTCRKRRIKCDETPVACRAC
FT                   QRAGLDCAGYDVRLIWNAGPNTRRRRIKPCALGCAPMTEAQVVRALETIEKSTTNSIGP
FT                   FSVFTSQPPSAICSDTPEESQSLLPADEYVEDIFTDSMSHAHSTPPHSTDGSTADSNTD
FT                   CQQAAAQSSSSSVEELPTHPLPDGTSGLPYRSTETSIPVDDIDSWDGTWIIPLEQTLTS
FT                   RFSGALQFANRSLVADSREFRSHQPFVSSSPPPSDTHGILSTPGRVVSSSDLPRLEGND
FT                   RSPQGPVAGNRGVISLDCDLASTMIENTTATMLMDHYMQHVVHLMQPVSHPRNPFKTVY
FT                   LPLALHGSSQLERSGRRSQLQSASIAAFHSLLSTAAANLQRMQGEQEALEQLACHHKQR
FT                   SLIALQSALATKSTPYRDLMTAILSLVSADIMDGGMDDHWIHLEAGIKLLASRHYSLLV
FT                   SRETSLLNNICKMLHLFGRTTRVHPERRAWPGYDHVPRGADFDTLEPSIEFIYGITTSI
FT                   AGAIFRIYRLAQYLAYYREQGRPYPDSLLQSCETLGDELCSYTINSESFAEMDSTEAEP
FT                   YMIDIARAQAKAFQGAARIYYYRSIQQCARSRLHREQQEVLAALNEAEDLKITFGKNGA
FT                   LPAPISWPAFVASCEAVGEQRRQWDGWWSRVLVYGMGNYSKQHATVHRVWSSLDADPDE
FT                   SMDWREALAAMGVRILPV"
FT   gene            complement(1206448..1208016)
FT                   /locus_tag="ANIA_01585"
FT                   /old_locus_tag="AN1585.4"
FT                   /product="succinate semialdehyde dehydrogenase (Eurofung)"
FT   mRNA            complement(join(1206448..1206590,1206651..1208016))
FT                   /locus_tag="ANIA_01585"
FT                   /old_locus_tag="AN1585.4"
FT                   /note="transcript_id=CADANIAT00008218"
FT   CDS_pept        complement(join(1206448..1206590,1206651..1208016))
FT                   /locus_tag="ANIA_01585"
FT                   /old_locus_tag="AN1585.4"
FT                   /product="succinate semialdehyde dehydrogenase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008218"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008218"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008218"
FT                   /db_xref="GOA:Q5BCZ5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ5"
FT                   /protein_id="CBF85164.1"
FT                   /translation="MKPPYYMETGCKRNPGSDSTLKVRWTLYTRLLQSANQGLGIDPGS
FT                   GQVFASCPTNTVADVDAYVSSAHRSFLSYRETNPRARAKMLLNWHNLIAQSKNDIAKLV
FT                   VYETGKPMAEAVGEVDYALGFAWWFAGEAERVRGSIAQPSISERRTFVIKQPIGVCIAL
FT                   VPWNFPVAMIIRKAAAALAAGCTVVIKPSPETPLSVLALADLALQAGFGPGVINVLTTD
FT                   NLNTPDVSEALCKHPLVRKVTFTGSTAVGQLIARHCSEGLKKVTLELGGNCPFIIFDDG
FT                   DLEQALAALMILKWRTAGQACTHANRVYVQSGVYDTFLRMIVNATKQLKVGHGASPGTT
FT                   MGPLTTSRGIEKLERHVADALAKGARLELGGHRLQLEGNYFQPTIISGMSAYMLTTQEE
FT                   IFGPLLGLYRFETEEEAVRMANDTSMGLASYFFTRDVSRTWRLLENLEAGMIGMNTGNS
FT                   SAAESPFGGIKASGYGKEAGKDVAIEEYLIAKTGTLTVGAVSKL"
FT   gene            1209176..1211357
FT                   /locus_tag="ANIA_01586"
FT                   /old_locus_tag="AN1586.4"
FT                   /product="amine oxidase (AFU_orthologue; AFUA_1G13440)"
FT   mRNA            join(1209176..1209229,1209293..1209724,1209795..1211357)
FT                   /locus_tag="ANIA_01586"
FT                   /old_locus_tag="AN1586.4"
FT                   /note="transcript_id=CADANIAT00008219"
FT   CDS_pept        join(1209176..1209229,1209293..1209724,1209795..1211357)
FT                   /locus_tag="ANIA_01586"
FT                   /old_locus_tag="AN1586.4"
FT                   /product="amine oxidase (AFU_orthologue; AFUA_1G13440)"
FT                   /note="transcript_id=CADANIAT00008219"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008219"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008219"
FT                   /db_xref="GOA:C8VN79"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="InterPro:IPR015800"
FT                   /db_xref="InterPro:IPR016182"
FT                   /db_xref="InterPro:IPR036460"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN79"
FT                   /protein_id="CBF85166.1"
FT                   /translation="MTGKMHPFDPLSPEEISKAATIVRGQFPGQSPAFRFITLKEPSKQ
FT                   EMMPFLESEHRGIPAAKRPARVSRVQVVLRGNDGANQLRELLIDLDSTGVLKNDHLVGR
FT                   HSYIDSDYMRLVESACLADQRVQDEIKKLKLPPSSTVIVEPWAYGTDGTYDGLERVTMC
FT                   WFYLRLLDNPDANYYAYPLDLCAEVSEQLKVIKIYYLPSAQNDRITDQARPFDIKKIHS
FT                   TAESEYHPSLRPPPRNTTKPYQVVQPEGPSFTIKGNHISWEKWTMRVGFNYREGLTLHD
FT                   IRYDGRSLFYRLSLSEMFVPYGDPRSPYPRKAAFDLGSDGAGINANNLRLGCDCLGLIK
FT                   YFDGWHNTSSGEPLKLPNVVCCHEQDDGILWKHTNFRTQNAVVTRARILVLQTIITVSN
FT                   YEYIFAFQFGQDASIHYEVRATGILSTCPINLGDQVPYGTIVGPGVLAPYHQHLFCLRM
FT                   DPWLDGDVRNSLQVEESHPMPVNDPSIHNPLGVGYSTTSVIVPEETGLDLDFTKNRTFK
FT                   LINENKINPTTKTPVGFKLLPAYSQMLLAHPDSYHSKRSEFGAHAVWVTRYDDEEMFPA
FT                   GQYTMQSSGGEGINSAITRRRNDPGSKTSVRNEDIVLWHTFGSTHNPRIEDWPVMPMDR
FT                   MVVGLKPVNFFSGNPGLDVPVSTQERNRSVLVEGDTVVSTSDACCRL"
FT   gene            complement(1212255..1214009)
FT                   /locus_tag="ANIA_01587"
FT                   /old_locus_tag="AN1587.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1212255..1212799,1212877..1214009))
FT                   /locus_tag="ANIA_01587"
FT                   /old_locus_tag="AN1587.4"
FT                   /note="transcript_id=CADANIAT00008220"
FT   CDS_pept        complement(join(1212255..1212799,1212877..1213867))
FT                   /locus_tag="ANIA_01587"
FT                   /old_locus_tag="AN1587.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008220"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008220"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008220"
FT                   /db_xref="GOA:Q5BCZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ3"
FT                   /protein_id="CBF85168.1"
FT                   /translation="MAQPMSGDVPELAPLEVVVPTRRRRMIGWAMLQPGEKVEPSQRFD
FT                   SNITQEHILPPDQKRRRPAVQESEPQHKGHSNAKTKGNMPSKRSSQGSRAPQQSRILLG
FT                   ETKPGADDSIELKREITRLKIENDLRALAESREIQRLQAEVKRLGRLKTELNRAIDRLL
FT                   SDPTRSAAATPESATSNDAILREKERLIERQICSINDLESSLSEAYEHEFLRSRIRNTD
FT                   LPTSTASIEDAMILIKRGVIRTADLLSSCLHPPDLLHLVLQMNAATDLRNLFNSTVKDS
FT                   SILEKTPDLALRAMLFRIVRDQILNSEIWTAFHTEGFMLRAYQRTIQQTAGSEFASTFH
FT                   KASLLYMLDHDPDFEACFLGAQVKELQIYTMRLLDPFFDSAKLTPNEKDLLREMDHLFF
FT                   ETFFFRARCFAPDGIRYEVIHFEPGESFDSVTMEAQDAPQEQLQGQERDKKPLIRLCVH
FT                   GTVVAHRIYETETEGLRKLKLLSQPFLQPSKSRAHSGRAVGEVVSDKAIVVLR"
FT   gene            1214263..1216918
FT                   /locus_tag="ANIA_01588"
FT                   /old_locus_tag="AN1588.4"
FT                   /product="HSP70 family protein (AFU_orthologue;
FT                   AFUA_3G13740)"
FT   mRNA            join(1214263..1214842,1214891..1215259,1215312..1215356,
FT                   1215413..1215479,1215529..1215790,1215897..1215966,
FT                   1216044..1216144,1216192..1216369,1216458..1216608,
FT                   1216689..1216918)
FT                   /locus_tag="ANIA_01588"
FT                   /old_locus_tag="AN1588.4"
FT                   /note="transcript_id=CADANIAT00008221"
FT   CDS_pept        join(1214303..1214842,1214891..1215259,1215312..1215356,
FT                   1215413..1215479,1215529..1215790,1215897..1215966,
FT                   1216044..1216144,1216192..1216369,1216458..1216608,
FT                   1216689..1216918)
FT                   /locus_tag="ANIA_01588"
FT                   /old_locus_tag="AN1588.4"
FT                   /product="HSP70 family protein (AFU_orthologue;
FT                   AFUA_3G13740)"
FT                   /note="transcript_id=CADANIAT00008221"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008221"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008221"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ2"
FT                   /protein_id="CBF85170.1"
FT                   /translation="MADLRRLATRKRRRASTIVDQNVCFTGTDTEDGDSMVPETPPSRS
FT                   WSRSQSRGSSRSTWTNQATTETGTETSAIPSTETSVEPSVELTEPFTSRSTSAQSDTLS
FT                   PRTKFIIGLDYGTTFSSVSYIKFDSARPPPTLFGAQICSITDWPGVDSRARNIPEVPSE
FT                   SWYLGDRFYWGYGARQGYAKLLLPGNQKETRGPREELRRTLVRARKDETEAIKDYLRQI
FT                   LKYSKEFLTEREELSEECEVELVFCVPAGWPAKAIRTMQEILLDIAHELNIGTLATPFV
FT                   LNEPEAAAAYILEACSGRKRLSTGEVFMVCDAGGGTVDAITYRVCQQHPFRVEEVVPPT
FT                   GSNCGSSYANQTLKHQAIEKIKSTAYESLKGPSFEYIIEHDIMTEFEYKIKRGFNPADG
FT                   LDGDEVIVVHGLERNERLGFGHNTMRIKSLNGISKLIRQQISAAAAKGLTVETILLVGG
FT                   FSAAPILRSHIETEFEALKIIYPPKGLDSAVTVSHGAVFRAFNKSDGPKRIVQSNFGFL
FT                   QLELYSTRQPAHRGVSPIFNAIDGKKYGLVLSKQQQFRTRNWQVFKMEEELVIHQKIWV
FT                   SDFDNAQNHYRVNAPCNKGAEVFGILQIDLEPVKNEGLLELRSGPEGMFYEIHYELAME
FT                   VDGRNLAVKLFYPPGGMCRAQTQLCIAAAFIPGTE"
FT   gene            complement(1217058..1219642)
FT                   /locus_tag="ANIA_01589"
FT                   /old_locus_tag="AN1589.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1217058..1217212,1217318..1218554,
FT                   1218610..1219108,1219167..1219642))
FT                   /locus_tag="ANIA_01589"
FT                   /old_locus_tag="AN1589.4"
FT                   /note="transcript_id=CADANIAT00008222"
FT   CDS_pept        complement(join(1217058..1217212,1217318..1218554,
FT                   1218610..1219108,1219167..1219642))
FT                   /locus_tag="ANIA_01589"
FT                   /old_locus_tag="AN1589.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008222"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008222"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008222"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ1"
FT                   /protein_id="CBF85171.1"
FT                   /translation="MPPMPSEEYRSRYRLTEDLKIKFLGPLEPEKWPTHWPEARRRLFH
FT                   DIVKLGDSKFGTFECTYSSEKPWRAQIKRRAAKLAYLASRCCDEGKNEPSWRASLEHEV
FT                   LYRFTVEVSCPTCRARLWRSEIEAAIESSDSQALSLDERRKHRMPCRCPEGFGTTDFHG
FT                   VNMIFSDRAETSIHYQPPLPIRSRSKGYKKYEQPDRVYGLIETQNIKTLLDSPYQRTTD
FT                   SQVKQLRDLLEVSPFKGDRKPLLFPFLLLEAKSATVGDSAGVEMQSAFTIHRLLKVQDE
FT                   LRAATRVDSMWATGPLVWFFGWHGQDWYVKGSFIDYTSGTPHRYCIVDLWQGNISQQSR
FT                   ALQLLLVVDYIFDWARDIYRPCIIRELSILAAREMQPCDPDIFSTVDRSQSQIASELPG
FT                   FSWSQESDSLYVSTTGLESGLGDTHPLSGVVRDASNIETRFLSLHITEANMDELWVSLP
FT                   AHLRESATTFVDTLRPSLDSSWRVTRKTLFSIQAAWTRNVNAPEFAGGSNTDIASDEIF
FT                   FTNIVILFHMTDDWTLVRQLTYLAISEGALQVLLLRHSLPGLLRDLEAQNPIIDDSSIE
FT                   PFIKSIRRQTIASSLTAAVSMLCISSSFTRGPGRIPGKWLLSKAKNIYAGFVFDNSPST
FT                   LEIVASFHETREKLIVNYFDDPYLVYSRTRTFLSADSPEQGLWPRLDSICQDKHGCALV
FT                   ESLNLPDNSTGAGARFCVFIISKYDFDRSDVDTATIVRGLAEGDSLGLLLEWLEDLGSQ
FT                   SGRAGWSGGGPGETPDSPIMISSSEESEGDPIEED"
FT   gene            complement(1221145..1223267)
FT                   /locus_tag="ANIA_01590"
FT                   /old_locus_tag="AN1590.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1221145..1221163,1221216..1222458,
FT                   1222513..1222711,1222781..1223021,1223089..1223267))
FT                   /locus_tag="ANIA_01590"
FT                   /old_locus_tag="AN1590.4"
FT                   /note="transcript_id=CADANIAT00008223"
FT   CDS_pept        complement(join(1221145..1221163,1221216..1222458,
FT                   1222513..1222711,1222781..1223021,1223089..1223267))
FT                   /locus_tag="ANIA_01590"
FT                   /old_locus_tag="AN1590.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008223"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008223"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008223"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCZ0"
FT                   /protein_id="CBF85173.1"
FT                   /translation="MGKEKHHFSRLPWRKSEPATDEDEAWIRKKAGAHHPAFRTPADYD
FT                   RSEKRYISDEEQAIEYLENLLRKHDDSQPGEPKFYQCSWEVVIQSLTQAQDAYAKNTGC
FT                   GQRTGMALDVTLSAFEALPAEFGLGTVKGILGLMFRVALQGIENRAKILDAFSSIPNTI
FT                   VTINVACTVLRPSQGDLDLREEFYRTLIKGMPLLVDVLLRAAPWYRKLKEILLFRIPET
FT                   VAVDEVLSEWKGIIDSFNQRMQRMRDRMLGTLHQQGVDLQNQADKHFSATENHFRGLRE
FT                   ENSTTHDMMRDLQLMMTVIMYNQKQLSKQKAQEASTWHHGLKSGADATTLLYQELQAIR
FT                   RQGEIQQEENSRLRRENVALREEAALRAETESSWKPTHPSMAALSELELLGVIGVPSNA
FT                   AWRDLDIVLSQSSSFGSQMLGKAQRLIRTRAFRDWFNQSESSILLVEGYLDISPAASIT
FT                   PISILDATLISSLLDSSNTLVLFAFAGLHREYEKPEVMNGPGGLLRSLIMQLLTSDKFP
FT                   LSNLEFLTPERIAACQKGDIVALCALFERLLLQVPPSLQVYCILDGLGWYERNPWGQDL
FT                   LYVISMFEELAQWDFPQTAVIKPMISFPHHSLLVADAVQIPVLWSRRYWD"
FT   gene            1224169..1227040
FT                   /locus_tag="ANIA_01591"
FT                   /old_locus_tag="AN1591.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1224169..1225990,1226088..1227040)
FT                   /locus_tag="ANIA_01591"
FT                   /old_locus_tag="AN1591.4"
FT                   /note="transcript_id=CADANIAT00008224"
FT   CDS_pept        join(1224169..1225990,1226088..1227040)
FT                   /locus_tag="ANIA_01591"
FT                   /old_locus_tag="AN1591.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008224"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008224"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008224"
FT                   /db_xref="GOA:Q5BCY9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY9"
FT                   /protein_id="CBF85175.1"
FT                   /translation="MNRTVGDDWDYTIEVCIGRPNLLEEIREELRRREAIEKKTYSGNH
FT                   RPLMAESPEKIGENRKLHRVRIRSPTVLSHLERLTRKLGNGSILNEEDNLVFMYPFYIL
FT                   GVYLDDMREILADMERGVLASGSIPPSEPEPKGLSPSVSPSPIDQMKCFVQFVESSILP
FT                   IHTALRQLDAQTSRRLSYAEISLLLEPGELIYVAPSLMTTKMLDRSAVQTVFRCLTRIP
FT                   ADHPISIDDSGWLSSDIGRLLADVYCLDHDGEEYTVCWRKLEMEYFDGEKDITALPFYP
FT                   LKFHPNYERFLSNRARQGTAFRALVEDENLHHYYAGWTLITGLFERTESDGKSTESKPE
FT                   DSEYVDSEVFLDTQEARRHMDDWSSLREPFTTKGSLAINDGAKFCLWHMTEKKTVAEKL
FT                   NRILTREDLVYWRARERYLLDNKWVIDDRVFIKEEWTDEDLALLPKRVYGYSLRDRKFL
FT                   RLDVDKFRPHTLKTKANLDKIEIKDSHRMIIRAAVKSHFDRAAQVLNRDEATHVPDIFE
FT                   GKGRGLVILLHGAPGVGKTATAEAVALEFDKPLFQITCGDLGTGPAEVETSLKAIFRYA
FT                   NMWSCILLLDEADVFLTQRNRTDVERNALVSVFLRVLEYYSGVLFLTTNRVGALDEAFR
FT                   SRVHLSLFYPHLNRTDMAKILESNLQRLPRDDKLSPGATAGPNHVTVMDSEIREFVLQQ
FT                   FDEHYKLHERGPWNGRQIRNAVHIAMCLAFFENGRKGRRAPAILTAEHFRKVHETIAEF
FT                   EDYLRAARTVDDETLAQMEGLRYDKEGQAYKRQLVGSTKFHRWSENERQVTHQRQSVRE
FT                   QGQSYRETTSYTPSRRSFLGGDIDSPPESRFSGSGAAARPTSQRYPPREIDDSHLAHER
FT                   YNMSDSGYGETGLRGTPRNYNLSPDRPRTPNRDYLVDGSPESVRSRSSVRGRD"
FT   gene            1228831..1230198
FT                   /locus_tag="ANIA_01592"
FT                   /old_locus_tag="AN1592.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1228831..1229145,1229204..1229358,1229419..1229827,
FT                   1229884..1230198)
FT                   /locus_tag="ANIA_01592"
FT                   /old_locus_tag="AN1592.4"
FT                   /note="transcript_id=CADANIAT00008225"
FT   CDS_pept        join(1228831..1229145,1229204..1229358,1229419..1229827,
FT                   1229884..1230198)
FT                   /locus_tag="ANIA_01592"
FT                   /old_locus_tag="AN1592.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008225"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008225"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008225"
FT                   /db_xref="GOA:Q5BCY8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY8"
FT                   /protein_id="CBF85177.1"
FT                   /translation="MSPPLDSALEPLSEYKETAFPRTEKDPSQYKEHDLVTPEKEIQTG
FT                   YFSPRGSHSSHGSHDSSASSNISLDDARMSDVNNSPNVFHDDPDTIDEKLSMYWKAANE
FT                   TVIREPYDYIAGIPGKEIRRKLLEAFNHWYKVDEQSCQAIATTVGMAHNASLLIDDIQD
FT                   SSKLRRGVPCAHEVFGIAQTINSANYVYFLAQNQLFRLRSWPQAISVFNEEMVNLHRGQ
FT                   GMELFWRDNLLPPSMDDYLQMIANKTGGLFRMIVRLLQTSSRQVIDVEQLVDVLGLYFQ
FT                   ILDDYKNIREEKMAAQKGFFEDLTEGKFSFPICHAIGEGAKNRTALLHMLRLKTDDMKI
FT                   KQEAVCILDNAGSLDYTREVLYGLDRKARSLLREFKTPNPFMEALLDAMLSSLQACH"
FT   gene            1231956..1233265
FT                   /locus_tag="ANIA_01593"
FT                   /old_locus_tag="AN1593.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1231956..1232938,1232998..1233265)
FT                   /locus_tag="ANIA_01593"
FT                   /old_locus_tag="AN1593.4"
FT                   /note="transcript_id=CADANIAT00008226"
FT   CDS_pept        join(1231956..1232938,1232998..1233265)
FT                   /locus_tag="ANIA_01593"
FT                   /old_locus_tag="AN1593.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008226"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008226"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008226"
FT                   /db_xref="GOA:C8VN86"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="InterPro:IPR023282"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN86"
FT                   /protein_id="CBF85179.1"
FT                   /translation="MPESQIIELGTLGQIPLYSLERALQDPLRAVKLRRQIVSQHQATG
FT                   NIDFTTDGSALPYEGYDYKAVLGACCENVIGYMPIPVGVAGPIKINGKMVFLPMSTTEG
FT                   ALVASTNRGCMAINAGGGVTALVLGDGMTRAPIVRFPSLEEAGAAKQWLGSDAGFLIIE
FT                   DAFNASSRFARLQNIKATAVGSDLYIRFTASTGDAMGMNMISKGVEQALEAMQKHGFES
FT                   MDVVSLSGNFCADKKPAAVNWIEGRGKTVTAQATIPEHAVRETLKTSVEALVELNVSKN
FT                   LVGSAVAGALGGFNAHAANVVTAIYLATGQDPAQNVQSSNTLTVMKNVNGDLQISVFMP
FT                   SIEVGTVGGGTVLGPQKAMLHMMGVQGADPEQPGRNAQELALLVAAGVLAGELSLCSAL
FT                   SAGSLVKSHLTHNRKKG"
FT   gene            complement(1233605..1236660)
FT                   /locus_tag="ANIA_01594"
FT                   /old_locus_tag="AN1594.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1233605..1235293,1235348..1235634,
FT                   1235697..1236660))
FT                   /locus_tag="ANIA_01594"
FT                   /old_locus_tag="AN1594.4"
FT                   /note="transcript_id=CADANIAT00008227"
FT   CDS_pept        complement(join(1233605..1235293,1235348..1235634,
FT                   1235697..1236660))
FT                   /locus_tag="ANIA_01594"
FT                   /old_locus_tag="AN1594.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008227"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008227"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008227"
FT                   /db_xref="GOA:Q5BCY6"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR017057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY6"
FT                   /protein_id="CBF85181.1"
FT                   /translation="MTCADVTDLCTQASQLVQQLRTKDGELGFMSAAVYDTAWVSMVQK
FT                   TTPEGRQWLLPKCFEYILRTQLEDGSWETYASDVDGILNTAASLLALETHAESRIASTD
FT                   PPVEEMKERIGRARAALSRQLQAWSVKDTVHVGFEIILPALLRLLREKGHEFEFDGRAE
FT                   LDRLNRIKLSKFRPEYLYSARTTALHSLEAFVGMIDFDKVAHQKVNGSFMFSPSSTAAF
FT                   LMFSSSWDDECEQYLRLVLQNGAGGGTGGMPSAYPSKYFEVSWVRGQLARLESKLTELQ
FT                   ALTTLLDNGYSTGDLGIEDTDSLGEMLRDALVKGGGIVGFAPSIQADADDTAKSLIAVS
FT                   LLDKPVSAQGLIDAFEGPMHFRTYHGERDPSFTANSNVLLALLNTPDAATVSPQIEKAA
FT                   AFLCDVWWTADSEIGDKWNLSPYYPSMLMAEAFGKLLQVWSDGGLKSISSQFIRDRVSV
FT                   CLYQALVRTLQTQNENGSWGSHSHEETAYAILTIAHACQLPVVNQLWTNVQLAVSRGRK
FT                   FLQNSAGDKAEYLWVEKVTYSSILLSKSYVLAALKVSFERSYPACLANLFIVSKKRVIE
FT                   FARFHSMLPLFSSMELWKVRAAIVEGYLLLPQLRDRRLAVFSRTGMEEDKYFEYIPFTW
FT                   TLCNNRRNTFLSTKTLVEMMVISFLNYQADEFMEAVVGRLNSSQRSMTRSCIDEIFRDL
FT                   KDKPELNDAIQAQSGPRNADANGHRILPQAKRIKMGSQLPSDVSRVLSAFVHHVMDHPS
FT                   VKAAAPLEYERVKNELQVFLLSHIEQADDNGRFAAQLESTRDDFETARSSFYRWVSSTS
FT                   SDHTSCPYSFAFYQCLLGFEQASHNAACFQTCEEKYVAEAMCRHLAVMCRMYNDYGSLA
FT                   RDRDEKNLNCVNFPEFAQAGPKSDAVRQKQLFSLAEFERSNMKRGLEVLTEMAAQDRAK
FT                   MRMLEKVQMFCDVTDVYGQIYALEILRVGCDLAHDCFMLELPAQWSNST"
FT   gene            1237447..1238442
FT                   /locus_tag="ANIA_01595"
FT                   /old_locus_tag="AN1595.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1237447..1237451,1237508..1237655,1237729..1237918,
FT                   1237985..1238442)
FT                   /locus_tag="ANIA_01595"
FT                   /old_locus_tag="AN1595.4"
FT                   /note="transcript_id=CADANIAT00008228"
FT   CDS_pept        join(1237447..1237451,1237508..1237655,1237729..1237918,
FT                   1237985..1238442)
FT                   /locus_tag="ANIA_01595"
FT                   /old_locus_tag="AN1595.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008228"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008228"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008228"
FT                   /db_xref="GOA:Q5BCY5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY5"
FT                   /protein_id="CBF85182.1"
FT                   /translation="MNTLNAPRNPTRHPAMTADTLVDAPALPHQNGSTEEKLKERGSFG
FT                   KLYTYKRSPRALGIQAVAKSIGLELEQVELQPANGVPDFYWNLNPLGKTPTFVGADGLV
FT                   LTECMAIALHVTNEDSTTTLLGSSSLDFVQIIRWISFTNTDVVTRMASWVRPLIGYTPY
FT                   SKEEVLKAQQQTTQAIGVFEDSLRDRKYLVGDRLTLADIMCVSLVSFGFAQIFDKEWRE
FT                   AFPYFSGWYMMVMHLPIMKAVVEEVPFVEEGLPNAPPTEPFRAP"
FT   gene            complement(1238668..1239723)
FT                   /locus_tag="ANIA_01596"
FT                   /old_locus_tag="AN1596.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1238668..1239317,1239372..1239723))
FT                   /locus_tag="ANIA_01596"
FT                   /old_locus_tag="AN1596.4"
FT                   /note="transcript_id=CADANIAT00008229"
FT   CDS_pept        complement(join(1238668..1239317,1239372..1239723))
FT                   /locus_tag="ANIA_01596"
FT                   /old_locus_tag="AN1596.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008229"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008229"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008229"
FT                   /db_xref="GOA:Q5BCY4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY4"
FT                   /protein_id="CBF85184.1"
FT                   /translation="MVSLKTVQASNAGLRALPNITALFVGGTSGIGQSTLRQLARYADS
FT                   PTAYIIGRNEARTRPFLSELQQLNPKGRFHFIEADVSLVRNVDAACQQILQQQKKLNFL
FT                   FMTPGGISLGGRNETVEGIDYLFALRYYSRMRFIQNLLPLLEASSPSRVISVYGGGFEY
FT                   SINTADLDLKHNFSLLNAYKHSITMTSLSMEHLARTHPAVSFIHVYPGLVGTNIYTNSF
FT                   PAPVSTFYNYLVWPFMKPFSVDLGESGERHLFHLSSAHYPAKQGIVPQGVPLEAGEVAK
FT                   GITGEPGSGAYLLNWKGDVRPSTKILAQYREQKIPQLVWDHTESLMDQAVHR"
FT   gene            1239993..1241279
FT                   /locus_tag="ANIA_01597"
FT                   /old_locus_tag="AN1597.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1239993..1240282,1240340..1240851,1240943..1241279)
FT                   /locus_tag="ANIA_01597"
FT                   /old_locus_tag="AN1597.4"
FT                   /note="transcript_id=CADANIAT00008230"
FT   CDS_pept        join(1239993..1240282,1240340..1240851,1240943..1241028)
FT                   /locus_tag="ANIA_01597"
FT                   /old_locus_tag="AN1597.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008230"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008230"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008230"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY3"
FT                   /protein_id="CBF85186.1"
FT                   /translation="MVDATSPPGVNAVVNYYVPNSDGSPPATNDMAVMLGQKDMISHKM
FT                   RIRDLRPYKEEYSLDRNGFQYATIHSTLTDATDETQIKEVYYREIEKLVQDITGAKRVL
FT                   AFHHAVRTRTGNEFGEQIKDRYQGVEGPAYRVHIDQTPQGALSIVQFMFPDLADDVRNG
FT                   SFQVINVWRPLTRVQRDPLMVADAAEMPPEDLLLISRKYYNGLHSSNFVIKYDGRMAAG
FT                   EGPTDGLSGDGKHSWWYIGDQEPTEALVFSSSGFRNGKAIIGTAHDLYSAEPMINAYER
FT                   KNASSLYGHDESQI"
FT   gene            1242596..1244301
FT                   /locus_tag="ANIA_01598"
FT                   /old_locus_tag="AN1598.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            join(1242596..1242847,1242897..1243791,1243844..1244301)
FT                   /locus_tag="ANIA_01598"
FT                   /old_locus_tag="AN1598.4"
FT                   /note="transcript_id=CADANIAT00008231"
FT   CDS_pept        join(1242596..1242847,1242897..1243791,1243844..1244301)
FT                   /locus_tag="ANIA_01598"
FT                   /old_locus_tag="AN1598.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008231"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008231"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008231"
FT                   /db_xref="GOA:C8VN91"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN91"
FT                   /protein_id="CBF85188.1"
FT                   /translation="MDNYTWHSGTLIPSDSPSSIDRSQLYLEILGVLSVVYLLQTLVAY
FT                   SKSFKAPFVGFRFWYEPKWLVGLRFSQGALAQVNEGYAKYKNAMFKVARNDSDILVIPN
FT                   KYVEELRSLPDEKISAIRAHIKNLLGKYSTTLILLESDLHTRMLQTKLTPNLGSFIEVI
FT                   ESELLFAMDQEIPANLDDWQSVNVFHIVLRIVARISARVFLGVPACRNEEWLQTSIHYT
FT                   ENVFATVMLLRRFPKWMHPIVGHLLPSYWAIHRNLRTAKRIISPMVRQRRAEEAKRNPD
FT                   YVKPNDLLQWMMDGANENDGQPDKLAHRQLLLSLASIHTTTMAAAHCFYDLCQHPEYFE
FT                   PLREEINDVIAQDGGWKKTTLNKMRKLDSFLKESQRINPPSLLAFNRIVSEDLTLSDGT
FT                   LLPKGTHFSMPSAAILQDNGVEPGADQFDGFRYYKKRLNPEEANKHQFAMTDNNNLHFG
FT                   HGKYSCPGRFFASNEIKIIMAHLLTDYEFKYPRGATRPRNLTADENLYPDPSARLLMRR
FT                   RVVAPPQASITPQLVSA"
FT   gene            1245211..1247923
FT                   /locus_tag="ANIA_01599"
FT                   /old_locus_tag="AN1599.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(1245211..1245332,1245421..1245749,1245827..1246412,
FT                   1246463..1246743,1246853..1247923)
FT                   /locus_tag="ANIA_01599"
FT                   /old_locus_tag="AN1599.4"
FT                   /note="transcript_id=CADANIAT00008232"
FT   CDS_pept        join(1245211..1245332,1245421..1245749,1245827..1246412,
FT                   1246463..1246743,1246853..1247775)
FT                   /locus_tag="ANIA_01599"
FT                   /old_locus_tag="AN1599.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008232"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008232"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008232"
FT                   /db_xref="GOA:Q5BCY1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCY1"
FT                   /protein_id="CBF85190.1"
FT                   /translation="MYPWSSTGTSPFSHPDNEGAESGDMSMGEEQQQPHQRRQKFNNLR
FT                   ACQSCRASKVRCDQPNPGMPCLRCQKSGKPCVDAASQPGKRQRQPINSILEMESRIETI
FT                   LSSAELQDSAGDGETAHSTALRSPSQLSHHIQPFQHLPMGFAIPFNGGNSGTEDLNSSI
FT                   RSWLNDNITDLDARTTETIFSHYLTNMVPTFPVVVFATGTTAADVRRNNPILFLAILDV
FT                   ASSGFCALETQRKLRKLIVQAYVHCMLRTEQYTLGLLQALIVSATWYRTIEPVEPGEQM
FT                   DIYQISHTAANMALIMRLGESLNAKSWGGPMFPRREMKKGPGSAFQADSLEARRVWLGC
FT                   HYICSNTSMSLRAPNIMRWTRLMDECLEVLENSPAALLSDRLLCQHIRLQHITEEFAMH
FT                   LSAEEASAPAKSRAIQIQVTHRAFKRQLSEWRRTVGDGWDAHCTATSDDVPEDNAQRLT
FT                   PPPPIVAIEPHAITEFMDTIDNIFRVFTSLDMSTIRALPAMYLIRIIYTFIILVKLYFA
FT                   AAKLPAQDAVLQVDGLQVSRRFNRVIQMTAGWGPLWPATKLTTVFTKMRSWFESGGDNN
FT                   CQRLQQAAAWLTGWELKPPSQGRDAHAMNMAEVVSDDGSIVASSSRGPASWVPSLASTD
FT                   VDTLAFSHEPPLGTEFSIAPPPFRSMSCATKSCSPQAGAAEFMHDEEVPLEGQRLGDLP
FT                   NIDQMDDVGMDWSQYTNMGFDLYNLDAPFLPNPPSGFDPDAAMKDNCADRNT"
FT   gene            complement(1249097..1250053)
FT                   /locus_tag="ANIA_01600"
FT                   /old_locus_tag="AN1600.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(1249097..1250053)
FT                   /locus_tag="ANIA_01600"
FT                   /old_locus_tag="AN1600.4"
FT                   /note="transcript_id=CADANIAT00008233"
FT   CDS_pept        complement(1249097..1250053)
FT                   /locus_tag="ANIA_01600"
FT                   /old_locus_tag="AN1600.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008233"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008233"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008233"
FT                   /db_xref="GOA:C8VN93"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN93"
FT                   /protein_id="CBF85192.1"
FT                   /translation="MPSGRSNSNITMAQLLVVLGATGQQGISVINHVLSDPILSSKYSI
FT                   RGVTRDASKPAAQDLMMKSLDIVSADFDDPASIYAALRGAHTVFAMTCTIYDEHAKTRE
FT                   EDQGKTIADAAVAVGARYLIWSTATHAGNTSGGKYSVPAFDVRWDVEQYIRGLPIQSAF
FT                   VAPATFMQNLRDMMAPQPCEDGTYAIANIHSPQTRFPWLDVVADLGKFVGAILEQPEKY
FT                   DGKVLGASSCIHSLVEVAQILSKVSGRTVKYVVMPESKFRSFCPPDGADSIVNMFLFIQ
FT                   DYGYYGVETEKVVEWSIQQVTGRLITIEEFAKTLHFA"
FT   gene            1252126..1252469
FT                   /locus_tag="ANIA_11310"
FT                   /old_locus_tag="AN11310.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1252126..1252142,1252205..1252469)
FT                   /locus_tag="ANIA_11310"
FT                   /old_locus_tag="AN11310.4"
FT                   /note="transcript_id=CADANIAT00008234"
FT   CDS_pept        join(1252126..1252142,1252205..1252469)
FT                   /locus_tag="ANIA_11310"
FT                   /old_locus_tag="AN11310.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008234"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008234"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008234"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN94"
FT                   /protein_id="CBF85193.1"
FT                   /translation="MLSDPRQGLLQAARRRVPEPHCLVIGAGRQQSAVRREGHTINPAG
FT                   MALQSLLQAARRRVPEPHCQVIGAGCQQPAVRQEGHRVNRAGMALQSL"
FT   misc_feature    1255350..1265616
FT                   /note="contig 1.182 354..10620(1)"
FT   gene            complement(1258094..1259249)
FT                   /locus_tag="ANIA_09442"
FT                   /old_locus_tag="AN9442.4"
FT                   /product="cellulose-binding GDSL lipase/acylhydrolase,
FT                   putative (AFU_orthologue; AFUA_2G00510)"
FT   mRNA            complement(join(1258094..1258291,1258386..1258641,
FT                   1258722..1258992,1259228..1259249))
FT                   /locus_tag="ANIA_09442"
FT                   /old_locus_tag="AN9442.4"
FT                   /note="transcript_id=CADANIAT00008235"
FT   CDS_pept        complement(join(1258094..1258291,1258386..1258641,
FT                   1258722..1258992,1259228..1259249))
FT                   /locus_tag="ANIA_09442"
FT                   /old_locus_tag="AN9442.4"
FT                   /product="cellulose-binding GDSL lipase/acylhydrolase,
FT                   putative (AFU_orthologue; AFUA_2G00510)"
FT                   /note="transcript_id=CADANIAT00008235"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008235"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008235"
FT                   /db_xref="GOA:Q5AQI8"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQI8"
FT                   /protein_id="CBF85195.1"
FT                   /translation="MSGISSVCSGTAADSINWVGYLATVYNDTTVLSYNHAVYGATVNN
FT                   TLVPGVPRDLAYQVSRVFEPHYCLPAGSEIEAEAGESWTPEAALFTVWIGINDIYSLSQ
FT                   RTAPFKDIPSILQSYFDLIDRLHDCGARDFLIFNVPPCDRTPKILALEPSDIRRYGAVT
FT                   EEFNRQLLNAVEQWRLANVDSTMATYDTWSFFTQILDSPQGYGFVDSKCIGAKKRCVWW
FT                   DDFHPVSALHRLLAADIGKILGWPDE"
FT   gene            complement(1259861..1261249)
FT                   /locus_tag="ANIA_09443"
FT                   /old_locus_tag="AN9443.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1259861..1259929,1260008..1260347,
FT                   1260417..1260585,1260675..1260816,1260880..1260945,
FT                   1261010..1261056,1261171..1261249))
FT                   /locus_tag="ANIA_09443"
FT                   /old_locus_tag="AN9443.4"
FT                   /note="transcript_id=CADANIAT00008236"
FT   CDS_pept        complement(join(1259861..1259929,1260008..1260347,
FT                   1260417..1260585,1260675..1260816,1260880..1260945,
FT                   1261010..1261056,1261171..1261249))
FT                   /locus_tag="ANIA_09443"
FT                   /old_locus_tag="AN9443.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008236"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008236"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008236"
FT                   /db_xref="GOA:Q5AQI7"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQI7"
FT                   /protein_id="CBF85197.1"
FT                   /translation="MEETRVNLLEYLRSKTQVDLDTFDITGISFPRLLEHTLNLETVAA
FT                   GLHDQFPEVTFDELGVEVGAVLLAGEMVPAFTGNLHLMVNPSYAYSREKVIEAAKSTPS
FT                   PISLYPVLPATWEGLQACRDLQAFKIKTLGTTLFSMEQAILAGEAGCVSISPFVHSLRI
FT                   LVDPEYKDPHPVYNLSAQAQRWYRRQSLPTKVKSCSTVGVDELLELAGIDALTIIPDDL
FT                   RALQSTYRDANQVFKLSIVENGTQNDDKIEHISYINDEEKYRADFQKADEGRAKAKTAE
FT                   AIDIFCGFQAKAEDVIRKAKGQ"
FT   gene            complement(1263264..1264790)
FT                   /locus_tag="ANIA_09444"
FT                   /old_locus_tag="AN9444.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1263264..1263505,1263560..1263645,
FT                   1263728..1264113,1264165..1264245,1264365..1264790))
FT                   /locus_tag="ANIA_09444"
FT                   /old_locus_tag="AN9444.4"
FT                   /note="transcript_id=CADANIAT00008237"
FT   CDS_pept        complement(join(1263264..1263505,1263560..1263645,
FT                   1263728..1264113,1264165..1264245,1264365..1264790))
FT                   /locus_tag="ANIA_09444"
FT                   /old_locus_tag="AN9444.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008237"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008237"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008237"
FT                   /db_xref="GOA:Q5AQI6"
FT                   /db_xref="InterPro:IPR008427"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQI6"
FT                   /protein_id="CBF85199.1"
FT                   /translation="MCGQYSPFPLVPPKLILLQAACVSTALRASSCDTGDTACLCTTAT
FT                   ALESALGCYSLQCTVKEALCKMTCPDYPRFPLLTSAASTNMTRSTCGLPEESEANLTPA
FT                   LAGSLGMLALIMVGLRIGWRTGTKKTVGWDDGFILLAMPDGAVKYHGLGTNLWTIPFDS
FT                   ITAQLKNQYLLIAEVFYMPAEAFTQLSFLAFYQRIFPPKYKYPIYTLSAISVCFGISNT
FT                   LIMIFQCTPVSFFWNSWTGEVSGTCININTYSWYRAAMQICMDVSIISLPIWPLSRLAL
FT                   STRKKAMVLVMFCTGFLSNNKTRITIVSCLRLQSLIKFSKSPNTSMDNNPAIYWSMVEC
FT                   DVAIICACMPSLPPLLKPIFPRCFATTQQSDPEEERTPQPVRLNQIMKKDEFSVLSSSA
FT                   SGDRLVA"
FT   misc_feature    1265617..1654585
FT                   /note="contig 1.26 403..389371(1)"
FT   gene            1265722..1267792
FT                   /locus_tag="ANIA_01601"
FT                   /old_locus_tag="AN1601.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            join(1265722..1265972,1266030..1266162,1266214..1266405,
FT                   1266522..1266673,1266737..1266984,1267052..1267792)
FT                   /locus_tag="ANIA_01601"
FT                   /old_locus_tag="AN1601.4"
FT                   /note="transcript_id=CADANIAT00008238"
FT   CDS_pept        join(1265771..1265972,1266030..1266162,1266214..1266405,
FT                   1266522..1266673,1266737..1266984,1267052..1267699)
FT                   /locus_tag="ANIA_01601"
FT                   /old_locus_tag="AN1601.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008238"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008238"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008238"
FT                   /db_xref="GOA:C8VN98"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8VN98"
FT                   /protein_id="CBF85201.1"
FT                   /translation="MAPTAILITVPLGLLLYLLFIRPSIAKKQKAPLPPGPPPKPLIGN
FT                   LRDLPSPDQKNWVHFLQHRDLYGPISSLTVFGQTIVILNDARVAFDLLEKRSNIYSSRP
FT                   RMVFAGEMVGWEHILAMQPYSDMFRAYRKAMHRVLGTKNVIAQFNELQDVEARRFLLRV
FT                   LEKPGDLVQHIRTETGAVILKIAYGYDIEPHGKDPLVALANESLANFAVAGTPGAWIVD
FT                   TIPFMKYLPSWFPGTGFKRTAASWKQTLLTTIEKPYRLVLKQLESGKYPDSYLSNLLEE
FT                   TKGRPLSADEEQVIKWTAGSLYTGGADTTVSTLSCFFLAMALYPDVQRKAQEELDTVLG
FT                   SAKLPTFGDRARLPYIEAIVKEALRWHPVAPMGIPHMSTEDDIYEGYLIPKNSLIMPNI
FT                   WAFTHDASHYKDPATFNPSRFLGDTPEPDPSTLTFGFGRRICPGRLLADSSIFLTIAQS
FT                   LAVFEISSAGEDAAKAEFLPGVISHPVPYRLDIRPRSKGHEDLVKRIAAESPFGEGGAK
FT                   ELEEIVV"
FT   gene            complement(1267940..1269013)
FT                   /locus_tag="ANIA_01602"
FT                   /old_locus_tag="AN1602.4"
FT                   /product="Putative endo-beta-1,4-glucanasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5BCX8]"
FT   mRNA            complement(1267940..1269013)
FT                   /locus_tag="ANIA_01602"
FT                   /old_locus_tag="AN1602.4"
FT                   /note="transcript_id=CADANIAT00008239"
FT   CDS_pept        complement(1267940..1269013)
FT                   /locus_tag="ANIA_01602"
FT                   /old_locus_tag="AN1602.4"
FT                   /product="Putative endo-beta-1,4-glucanasePutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5BCX8]"
FT                   /note="transcript_id=CADANIAT00008239"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008239"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008239"
FT                   /db_xref="GOA:Q5BCX8"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR005103"
FT                   /db_xref="InterPro:IPR035971"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BCX8"
FT                   /protein_id="CBF85202.1"
FT                   /translation="MKFSSVLALAASAKLVASHATVFAVWINDEDQGLGNTADGYIRTP
FT                   PNNSPVTDVTSTDLTCNVNGDQAAAKTLEVAAGDKITFEWHHNSRDSSDDIIADSHKGP
FT                   VLVYMAPTEAGSAGKNWVKIYEDGYNDGTWAVDTLIANKGKHSVTVPDVPAGNYLFRPE
FT                   IIALHEGNREGGAQLYMECVQFKVTSDGTTQLPEGVSLPGAYTATDEGILFDIYSSFDS
FT                   YPIPGPAVWDGASSGSGSSGSGSSSSAAATSSAEKTATSTTAAATTTAVATSTSSATQV
FT                   QPTSVATFTTSVRPTTSAAPTTSAPTSSAAPTGGTGTGSIQIYQQCGGMNYKGATGCAS
FT                   GLTCKQWNPYYHQCVQA"
FT   gene            1271179..1271651
FT                   /locus_tag="ANIA_01603"
FT                   /old_locus_tag="AN1603.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1271179..1271492,1271558..1271651)
FT                   /locus_tag="ANIA_01603"
FT                   /old_locus_tag="AN1603.4"
FT                   /note="transcript_id=CADANIAT00008240"
FT   CDS_pept        join(1271179..1271492,1271558..1271651)
FT                   /locus_tag="ANIA_01603"
FT                   /old_locus_tag="AN1603.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008240"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008240"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008240"
FT                   /db_xref="GOA:Q5BCX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX7"
FT                   /protein_id="CBF85204.1"
FT                   /translation="MTKELVSSSAANKALLNMFIAAELRYPVRQCAGARSVRRWEKTCG
FT                   SVGTQLPSALLLYPVAIGILVVCVTLTRIARIREIYKGKGLEIPDDFDSTLTMPPVHFM
FT                   QVSAPDDVDVNELRKVEVPGGLDIEILEFFE"
FT   gene            1273477..1275003
FT                   /locus_tag="ANIA_01604"
FT                   /old_locus_tag="AN1604.4"
FT                   /product="putative alpha 1,3 glucanase GH71 (Eurofung)"
FT   mRNA            join(1273477..1273569,1273627..1275003)
FT                   /locus_tag="ANIA_01604"
FT                   /old_locus_tag="AN1604.4"
FT                   /note="transcript_id=CADANIAT00008241"
FT   CDS_pept        join(1273477..1273569,1273627..1275003)
FT                   /locus_tag="ANIA_01604"
FT                   /old_locus_tag="AN1604.4"
FT                   /product="putative alpha 1,3 glucanase GH71 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008241"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008241"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008241"
FT                   /db_xref="GOA:Q5BCX6"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX6"
FT                   /protein_id="CBF85206.1"
FT                   /translation="MPLSWTLGLPILTLLSFPAVIQSKAVFAHFMVSNTENYTLSDWHS
FT                   DIALAKAAHIDAFALNAGYGQNENARSFRNAFTAASELDFKLFFSLDYSGDGHWPKDQV
FT                   ISLLENYTTHEAYFRHTDGRALITTFEGFEAANDWAEIKKEIAQTVGNETCCVLIPDWT
FT                   SAGPEKAAKVPAIDGLMSWEAWPYGNEKMNTTRDEQYMSLLGERPYIMPVSPWFYTNLR
FT                   QFHKNWVWQGDDLWYTRWQQVLELQPAYVEILTWNDYGESHYIGPVRRDATRVIAEGAP
FT                   FDYVSGMEHDGWRSLLPYLIAQYKNGKNREDVEIAEETLSVWYRLSPADACDSGKTSGN
FT                   SKSSHQAVMEPGDILQDRVFYSAVLEEDADVAVAVGSVNQSAQWTNTPDRARGVYHGSV
FT                   PFGGRVGEVVVTLSRAEKVLVQMKGKPIDDQCLGNHTNWNAWVGNATAVKRGGSGIGDG
FT                   DEVGDAETGSGMAIQMASLWLTGLALLSCLI"
FT   gene            1275623..1276965
FT                   /locus_tag="ANIA_01605"
FT                   /old_locus_tag="AN1605.4"
FT                   /product="hypothetical protein"
FT   mRNA            1275623..1276965
FT                   /locus_tag="ANIA_01605"
FT                   /old_locus_tag="AN1605.4"
FT                   /note="transcript_id=CADANIAT00008242"
FT   CDS_pept        1275781..1276815
FT                   /locus_tag="ANIA_01605"
FT                   /old_locus_tag="AN1605.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008242"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008242"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008242"
FT                   /db_xref="GOA:Q5BCX5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX5"
FT                   /protein_id="CBF85208.1"
FT                   /translation="MERPAFLLPTATSHPTKPNTRIPPILAAGKATSLSPNSTTAAEPP
FT                   FSRIATISRQKLSAEAARGDPDLRRCLGHHRLLARSLYEAKQGMKRYLEEVLESESEDD
FT                   EDIYGEYEFGKGEVLLQEDELVDDEDDDDDDELYDDDLEDEDDDEDIDDECPTVEEEEV
FT                   VAPPASITVSPDPAADSAPAPNPDTSVKDQFSAPVPQSVPASMVPCSNSSTAPGPVWVK
FT                   EKIVGAVRGLVRRRNSTSLSPSPGPSPSTPPPTASPPEAASKSEAQSALAHMAANNASC
FT                   SQIPVYIHIHEHLSKPARRLERSQSQSQLQSRSQGHGRFITMRGRQYAQRLGLKVAAAV
FT                   PVTT"
FT   gene            complement(1277097..1278602)
FT                   /locus_tag="ANIA_01606"
FT                   /old_locus_tag="AN1606.4"
FT                   /product="annexin, putative (Eurofung)"
FT   mRNA            complement(1277097..1278602)
FT                   /locus_tag="ANIA_01606"
FT                   /old_locus_tag="AN1606.4"
FT                   /note="transcript_id=CADANIAT00008243"
FT   CDS_pept        complement(1277097..1278602)
FT                   /locus_tag="ANIA_01606"
FT                   /old_locus_tag="AN1606.4"
FT                   /product="annexin, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008243"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008243"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008243"
FT                   /db_xref="GOA:Q5BCX4"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR009117"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="InterPro:IPR037104"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX4"
FT                   /protein_id="CBF85210.1"
FT                   /translation="MSYPPPNYGHGHPQYTQPPPPQGYPAPGPYPPSSYPAPTGAHPAH
FT                   PIPAPYGVPGGGNPGPPGSAGAYPSPSPQPPYQASPGPYPQYPAHGHPAQPPAPYQQPP
FT                   SGPGSYGQANPPYGSAPPPNPYGTPPPPHAAPYPPGQYPPAAGYPPQGYPPGPPPPGVG
FT                   PYGAPGGYPPAAPVPAPPSLGYDPDQRASGDASKEADALRKAMKGWGTDEAALINVLAK
FT                   PDPLHMALIRHTYMDRHGRNLEKDLKSELSGDFETIMLSLAAGPLGQDIRYLRDAMSGI
FT                   GTDETAINDVLIGRSNADLRAIKYGYVQRYNKALVDDIKSDLSGKTEKFFLMLLNAVRP
FT                   ESGTYFDQASVDKDVHELHLATNAKTGTDELGVSAVFLGASDQKLVAISQAFEAKYHIS
FT                   LEKTIKDEFSGHLEKALLAILARAKDPLKFDVETMLAIVPPGGVKADIKRLIYWVVRLH
FT                   WNPPYLAQIKEALQKRTGSNFGKRIRGALPGGDLTEAVLRVWS"
FT   gene            complement(1280134..1284744)
FT                   /locus_tag="ANIA_01607"
FT                   /old_locus_tag="AN1607.4"
FT                   /product="UDP-glucose,sterol transferase, putative
FT                   (AFU_orthologue; AFUA_8G06750)"
FT   mRNA            complement(join(1280134..1280339,1280395..1280533,
FT                   1280591..1281332,1281381..1282145,1282202..1282416,
FT                   1282447..1283138,1283204..1283320,1283732..1283796,
FT                   1284266..1284744))
FT                   /locus_tag="ANIA_01607"
FT                   /old_locus_tag="AN1607.4"
FT                   /note="transcript_id=CADANIAT00008244"
FT   CDS_pept        complement(join(1280134..1280339,1280395..1280533,
FT                   1280591..1281332,1281381..1282145,1282202..1282416,
FT                   1282447..1283138,1283204..1283320,1283732..1283796,
FT                   1284266..1284744))
FT                   /locus_tag="ANIA_01607"
FT                   /old_locus_tag="AN1607.4"
FT                   /product="UDP-glucose,sterol transferase, putative
FT                   (AFU_orthologue; AFUA_8G06750)"
FT                   /note="transcript_id=CADANIAT00008244"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008244"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008244"
FT                   /db_xref="GOA:Q5BCX3"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR015412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX3"
FT                   /protein_id="CBF85212.1"
FT                   /translation="MHEAGVFEDAKLKLDGQFEERKGPFWLWAKVRGFLADLFHDNVLN
FT                   IEISIRPHAYGQRLQPRKVMDGSQKGSGRFCRRRTTDQTELELIVPCLVSRQHRAERSP
FT                   DLEHTIRSQLGIVLHNLGHGPMAAAPGLIDEQTVATVAPRRSNGHLWTSMISMLPSEIV
FT                   HEQAIADANRTFSSIFQLAQNRAKTISSEDWAHASYSSGRAAHKLYEGHHDTGVRVMED
FT                   GRLNISLTPHQPWLQRIVRHTQQHPYPRDSVHRQQSSASFRPNPEDEYCPLRLNIVIHV
FT                   VGSRGDIQPFLAIGKQLKSHGHRVRLATHLSFRETVEDEDLEFFNIGGDPSELMAFMVK
FT                   NPGLMPDLRTIRSGAIRLRRREMKSIFSGCWRSCYETGDGTGIDHHIKDEPDPLSGDEA
FT                   VDLRRLPFVADVIIANPPSFAHLSCAEKLGVPLNMMFTYVFALPIVSMSRLTAFPHPLA
FT                   NVQSQSTKPSVANFASYAIVEIMMWEGLGDLINRFRKRELGLDPLDAIRAPSLAHRLQV
FT                   PYTYLWSPALLEKPLDWGDNIDVVGFSTLPTAQDYKPPQDLQSFLDAGPAPVYIGFGSI
FT                   VVDDSKALTDIVFEAVEKAGVRAVISKGWGNIGANHAASDSIMMIDKCPHDWLFQHVSC
FT                   VVHHGGAGTTAAGLALGKPTIVIPFFGDQAFWGSIVSRAGAGPDPIPWKRLTAEKLAEA
FT                   IEMALKDETKRKAEEIGEQMRSEQGARNAVCSFYRHLDAESLRCSLCPNRPAVWWVKHL
FT                   HIKLSAFAATVLVETGLVKPHDLVLYRSKEYDTSRDPKGPITAGAEVLYGVITDFVAAM
FT                   ATMPADMAEMFGADHRHGRIRMKRHPKHGRKPPSPVRKWKKEHYGHRNPDSGVGSNSSS
FT                   QSDGRIDISETETEKSSTVADDSDENSETGSGDSSSRTDIADLDSTLNPDAHNDRNNNN
FT                   NIGLTAHQTLSLEDTLRRQQTRDKSIDTHELFMDARYHLARAGKHIIDWVLLIPTDLTL
FT                   SFSKGFHNAPKLYHDPMVQETPTVRGVKGGLRAAGTEFTQELYQGITGILTQPKHGRKE
FT                   SGTKGMLKGVGKGAGGAVLKPMAGLWGLAGYPLEGLHKTLRSSLSKSKVRDILASRIQQ
FT                   GLGEMVAAMPEERAAVIERWNKMQAEKSNERA"
FT   gene            1289031..1289783
FT                   /locus_tag="ANIA_01608"
FT                   /old_locus_tag="AN1608.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1289031..1289113,1289294..1289783)
FT                   /locus_tag="ANIA_01608"
FT                   /old_locus_tag="AN1608.4"
FT                   /note="transcript_id=CADANIAT00008245"
FT   CDS_pept        join(1289044..1289113,1289294..1289754)
FT                   /locus_tag="ANIA_01608"
FT                   /old_locus_tag="AN1608.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008245"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008245"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008245"
FT                   /db_xref="GOA:Q5BCX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX2"
FT                   /protein_id="CBF85213.1"
FT                   /translation="MSQFPTPIRLAQAVGLTGAAYLAGNIFAYSFATIPALESSQNKHG
FT                   APAALLAKQWSELYARGKAQNPPIAAATAAAFAYLAWSVHSGKSAALQVLAPANAAYLY
FT                   SAAAALTVGIVPWTLFAMTKTNDALHERAKEVFVVTEKTADEVKELLAKWKVLNAIRGL
FT                   LPLVGGLVGFLAF"
FT   gene            1289866..1292738
FT                   /locus_tag="ANIA_01609"
FT                   /old_locus_tag="AN1609.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1289866..1290512,1290707..1290828,1290876..1291153,
FT                   1291379..1291523,1291859..1292208,1292356..1292576,
FT                   1292626..1292738)
FT                   /locus_tag="ANIA_01609"
FT                   /old_locus_tag="AN1609.4"
FT                   /note="transcript_id=CADANIAT00008246"
FT   CDS_pept        join(1290047..1290512,1290707..1290828,1290876..1291153,
FT                   1291379..1291523,1291859..1292208,1292356..1292576,
FT                   1292626..1292738)
FT                   /locus_tag="ANIA_01609"
FT                   /old_locus_tag="AN1609.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008246"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008246"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008246"
FT                   /db_xref="GOA:Q5BCX1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCX1"
FT                   /protein_id="CBF85215.1"
FT                   /translation="MLVPIRVHIRDPLILLRRRKRLHRVRHLARGYSHRKNQTAAIAPR
FT                   TSGMPTPNPTPRPTPRLLSELLSLPLPPVGVVVGVEVVVTVLVVVTEVEVDELLVLSGE
FT                   RLLTTNSTAGIENVWVELLQSHPPYAVQQNVSVPQAVTRFRNLKPSTSPRLTLRWVAAL
FT                   RASNARYILVAVAVVALGYHFGADRARSAGNGTIFSRDECEDGKSVDRETLWSTGDCLK
FT                   NEIKNPKKSRSEAKGRLSVGSLDEDLRPKDARKLKFWQDAVRNQSPGNRNIASWRLQAS
FT                   PNRTSDNLFSAEVTEGTPYNYTAPCQGLKATLVLHRASLNSATQGLHLVPDNAESCSGY
FT                   GKVEQWDVDAYSCQGQAYLDTSIANRTTHLKLASSDISSAMRIHHKQQYPLQLYAAGSA
FT                   SQTPTSSLLAIKSKILLNKRSKVHRSGRKSSRHWIHRSAYSNGQRCSSSHHFGLRRVCL
FT                   FATHGDPDMIMTAAEGRLPTARVVAAIYLLFSTDHVPAPGGEIVICNTFPSYSLVIFRR
FT                   MARRTGYNGLAFKDAREKKESRSKAWVMELLKGQSARGDWTKSLRSR"
FT   gene            1295296..1296442
FT                   /locus_tag="ANIA_01610"
FT                   /old_locus_tag="AN1610.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1295296..1295370,1295449..1296442)
FT                   /locus_tag="ANIA_01610"
FT                   /old_locus_tag="AN1610.4"
FT                   /note="transcript_id=CADANIAT00008247"
FT   CDS_pept        join(1295333..1295370,1295449..1296442)
FT                   /locus_tag="ANIA_01610"
FT                   /old_locus_tag="AN1610.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008247"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008247"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008247"
FT                   /db_xref="GOA:C8VNA7"
FT                   /db_xref="UniProtKB/TrEMBL:C8VNA7"
FT                   /protein_id="CBF85217.1"
FT                   /translation="MSRSKDSLDSTSSRISKSQLFPLAHPPPKSKSAPNKSPRLRLSSR
FT                   LVLQIQQSSQSRAIPILELYQPSTFGKSIALPDGSRKVHGRDMYVTQSEMYTHLKRPRK
FT                   RDAVDGYGTGYGHGYGNAYGHTTKPRSGSGGSRSVSGSAYSSAASSRPKSRSSGASSGD
FT                   EGQGECKAKFRARRKSGNDADGEQDDVVAMIHTSPKSTAADAQLFFPQNNQTWETTSSR
FT                   PGYYRFQSDGSSVVFEWEKRPPSRSHPSSAAENDDGERFVLSVSVSEPTSSHTKRPWLA
FT                   QLSKRGVHVGGLEPWRDEPGLRALIDGVGDGAGAGGSGAGAGLYTLILTMGVWVAKGEG
FT                   WVN"
FT   gene            complement(1296544..1298433)
FT                   /locus_tag="ANIA_01611"
FT                   /old_locus_tag="AN1611.4"
FT                   /product="flavin-binding monooxygenase-like protein
FT                   (AFU_orthologue; AFUA_4G09220)"
FT   mRNA            complement(1296544..1298433)
FT                   /locus_tag="ANIA_01611"
FT                   /old_locus_tag="AN1611.4"
FT                   /note="transcript_id=CADANIAT00008248"
FT   CDS_pept        complement(1296544..1298433)
FT                   /locus_tag="ANIA_01611"
FT                   /old_locus_tag="AN1611.4"
FT                   /product="flavin-binding monooxygenase-like protein
FT                   (AFU_orthologue; AFUA_4G09220)"
FT                   /note="transcript_id=CADANIAT00008248"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008248"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008248"
FT                   /db_xref="GOA:Q5BCW9"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW9"
FT                   /protein_id="CBF85220.1"
FT                   /translation="MSAAKIEPGSFNIPVGTFPATCKTPQESINAHALATSILSRLNTA
FT                   LSTSKISDIAALFLEQGSFWRDHLCLSWNFHTAKGREGIASLLSQVEKEKLNHLKLEID
FT                   ISTPFRSPQISAIDAFGEVIGVQFFITVSTAIGSGRGVVRLAEGDEGEWYIYTLYTVLQ
FT                   ELTGHEEQVSSRRPFGAVHGEISGRPRLNWQDRRKAETNLDENKEPAVLIVGAGQAGLS
FT                   VAARLRMLGVDALIIDQEDRVGDNWRRRYHQLVLHDPVWFDHMPYLPFPSNWPVFTPKD
FT                   KLAEFFECYVKLLELNVWTRTTVKEAKWHADGKEWSVEVIRRTDSGEVKRVLHPRHIIQ
FT                   ATGHSGEKNLPEFKGIESFKGSRICHSSEFEGATDADPRKGQQKAVVVGSCNSAHDIAQ
FT                   DYYEKGYDVTMVQRSSTCVISSDAIVNIGLKGLYEENGPPVHDSDVFLYSIPSEQFKAQ
FT                   QVRITAVQNEHDKVLLEGLEKAGFKVDKGPDDAGLLMKYWQRGGGYTIEVGAGRLIADG
FT                   KIKVKQGEEIAEILPQGLRFADGSELEADEIVFATGYKNMREQTRLIFGDMVANSVNSV
FT                   WGLDSEGEMRTIWRKTGHPGFWFMGGNLAMCRYYSLLLALQILGIERGLNEVQ"
FT   gene            complement(1299726..1301930)
FT                   /locus_tag="ANIA_01612"
FT                   /old_locus_tag="AN1612.4"
FT                   /product="phosphate transporter (AFU_orthologue;
FT                   AFUA_4G09210)"
FT   mRNA            complement(join(1299726..1301217,1301293..1301624,
FT                   1301686..1301793,1301868..1301930))
FT                   /locus_tag="ANIA_01612"
FT                   /old_locus_tag="AN1612.4"
FT                   /note="transcript_id=CADANIAT00008249"
FT   CDS_pept        complement(join(1299726..1301217,1301293..1301624,
FT                   1301686..1301793,1301868..1301930))
FT                   /locus_tag="ANIA_01612"
FT                   /old_locus_tag="AN1612.4"
FT                   /product="phosphate transporter (AFU_orthologue;
FT                   AFUA_4G09210)"
FT                   /note="transcript_id=CADANIAT00008249"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008249"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008249"
FT                   /db_xref="GOA:Q5BCW8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW8"
FT                   /protein_id="CBF85221.1"
FT                   /translation="MSKFRARLYKTDRARDFEHEQDRHVRTRQIYETIDRQSFQWIVVL
FT                   VAGVGFFLDGYTLFASNIALPMISYVYWREDTSSFRLTCINIATLSGTLLGQVLFGYLA
FT                   DRNGRKKMYGVELALLIASTLGVAMSSEGTHGSMSVFAWLIWWRIIVGIGVGADYPLSA
FT                   VITSEFAPTRHRARMIASVFFMQPLGQIAGNIVSLIVAVLSKKQGHDDVTRAVDIMWRW
FT                   VVGIGVVPGVIATFFRFFIPESPRFLLEIEDDPVQAEFDATTLFSDPAPLSSLGSPEIA
FT                   VEEGYRYPGSASTALTSMTTATANQFNDINLIAPWNEIILPAPALPATATTMGTGKGTS
FT                   TAAGPDTAGTGAGALTIRSMSIDDFTDRTPSQYHDSLPEGTFLTPATLNSHWRLTKVDI
FT                   TQYFWHEGNWRTLLATSLSWLLLDFGFYGIGLSSPQFLAKTWDSLKLSGPAPPWMTDDT
FT                   GATDIYDMFRDTSIHCLIILNIGSFVGGVLMLLTIHKLERVSLQKYGFLALAAHFIALG
FT                   TMFITVHKEGPVAVTLYIIGQILFNFGPNTTTYMIPAEIFPTRYRATCHGISAGAGKLG
FT                   SILIQLLSAYYKFGTGPGNEQTVRHGYMLIVFSACMVIGAAVTHFWIPPTQRKSSDGRA
FT                   KLWGGKAETLETLGLGRRGWKSRFAGVRR"
FT   gene            complement(1303118..1304391)
FT                   /locus_tag="ANIA_01613"
FT                   /old_locus_tag="AN1613.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1303118..1303161,1303237..1303413,
FT                   1303444..1303812,1303908..1304041,1304105..1304391))
FT                   /locus_tag="ANIA_01613"
FT                   /old_locus_tag="AN1613.4"
FT                   /note="transcript_id=CADANIAT00008250"
FT   CDS_pept        complement(join(1303118..1303161,1303237..1303413,
FT                   1303444..1303812,1303908..1304041,1304105..1304391))
FT                   /locus_tag="ANIA_01613"
FT                   /old_locus_tag="AN1613.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008250"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008250"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW7"
FT                   /protein_id="CBF85223.1"
FT                   /translation="MIPYSHEHLQDRPFPASARRESTATVSSTPSTATSSRSSVSGSLC
FT                   FVSEPPFSPSLSPSLFPSPSTSASVSLASRPREGSLNDEVARLPLNPAVTVSFVRSSRL
FT                   FKLRYTFINIRKDFAGALKCLELGGAVGQQTAFLHSFNTTRLPVPHLEHPITSSEPYTP
FT                   SSLRISFLDEQTVQTGATVFATQLSYTFESWLDCLQFQELILASRIVFIAGIAEAKSKG
FT                   RGEECISQNLRILRQDHTGKLVMLFFANSQRKERKRYVSIPLNHIHYGLRADYSRWHLV
FT                   SCIESVMPGKNSRRPVVLQLQPNFDHLAQMRTLQISFLDSDDKKAFCEFLAANNR"
FT   gene            complement(1305092..1306494)
FT                   /locus_tag="ANIA_01614"
FT                   /old_locus_tag="AN1614.4"
FT                   /product="S-adenosyl-methionine-sterol-C-methyltransferas
FT                   (AFU_orthologue; AFUA_4G09190)"
FT   mRNA            complement(1305092..1306494)
FT                   /locus_tag="ANIA_01614"
FT                   /old_locus_tag="AN1614.4"
FT                   /note="transcript_id=CADANIAT00008251"
FT   CDS_pept        complement(1305331..1306494)
FT                   /locus_tag="ANIA_01614"
FT                   /old_locus_tag="AN1614.4"
FT                   /product="S-adenosyl-methionine-sterol-C-methyltransferas
FT                   (AFU_orthologue; AFUA_4G09190)"
FT                   /note="transcript_id=CADANIAT00008251"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008251"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008251"
FT                   /db_xref="GOA:Q5BCW6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW6"
FT                   /protein_id="CBF85225.1"
FT                   /translation="MTTLASHRSGRSSESSVDVVAAEKEKLSTVQLSQANLDALPDLRN
FT                   SASPKRWKTFWKSFRYLQHLTSKQVDDFMASYIIYNLDWSDEKQMVETLGEDYQRKVGD
FT                   CLQAYYGVLNHLCALGDVEKMYIPPFMSSKATVRENQLLYEESIAHDIGLKPGDRVLDL
FT                   GCGRGRVAAHMSQYSGAQVTGLNIDPNQVAQARSFNTRLGFESNSFIVQDFNSLPLPFA
FT                   DDSFDAFYQIQALSLCKDLPALFREIYRVVKPGARISLLDWVSLPDYDPSNAEHAELMR
FT                   RVKPLIGAVGTPTPEILENALMEAGFTVLRSDNASVGGLQAPLIDKVDLYFRSMRQLIL
FT                   GLVKAHMLPRHFKTLINRLCLDGQAFVKMDKMRLVTTSYRIIAQKQA"
FT   gene            complement(1309778..1312769)
FT                   /locus_tag="ANIA_01615"
FT                   /old_locus_tag="AN1615.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1309778..1309830,1309891..1310009,
FT                   1310177..1310197,1310253..1310481,1310876..1310923,
FT                   1311189..1311285,1311367..1311421,1311481..1312769))
FT                   /locus_tag="ANIA_01615"
FT                   /old_locus_tag="AN1615.4"
FT                   /note="transcript_id=CADANIAT00008252"
FT   CDS_pept        complement(join(1309778..1309830,1309891..1310009,
FT                   1310177..1310197,1310253..1310481,1310876..1310923,
FT                   1311189..1311285,1311367..1311421,1311481..1312769))
FT                   /locus_tag="ANIA_01615"
FT                   /old_locus_tag="AN1615.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008252"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008252"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008252"
FT                   /db_xref="GOA:Q5BCW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW5"
FT                   /protein_id="CBF85226.1"
FT                   /translation="MSSTLSTPSLSQFPTPNQTPRLPTPPNSPEETHPHIMSAEENEIL
FT                   AQESTRLTESGDDFAPTITSLLNEYTDRMKQIQRRRLAEQKGEHEILYAKLRRQKDSAL
FT                   SGLKQAQDLTTRYKQELDAKVIEEEQLTEKMKTLEKLLAETATQLSDTTKAYAEKEEIW
FT                   NSVMGPLARLENDNNEIREQLGEIKQQLEGTNASIAEERAISDRNLSELASVRDKLAEE
FT                   KVQRAAVERRLNEQDDRVRLLSNRIIYLKASKLQLRSELNQARREAEQVNRLRSANEEL
FT                   GARCETLTRDVSDLRDVRHHHEDEIRRMKQQQDTMTGAIHHLTSEVQVEQKRSEQLQSS
FT                   VSDLEQKRDGLNNQLQHLQGEYNDLTGALANAHEAARRAEICMQWVVIAHRARCRSLKA
FT                   EVAELKSSRLPKVEAKRSLANIRRGNSPARLGVVERPPVTIRKPRWKNQTVNSITTSAA
FT                   AYLFWLCKTTGLRSALYALTTSCNHEEIKARCQPGMIQIYQLYPNSKIGATQLKKRLAN
FT                   VGLPKDHDYSRPTSEVTDTKVLVEVHEDRAQEQAQQPAAIPSQFQPEHNNICKATGRIL
FT                   TVRHPRRIQERVAQKDDLGIPSAVLPAHGPSQSCSLGIRVGRRPSYYLRTFGQKPDRGV
FT                   L"
FT   gene            1315670..1317251
FT                   /locus_tag="ANIA_01616"
FT                   /old_locus_tag="AN1616.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1315670..1315835,1315913..1315999,1316056..1316136,
FT                   1316202..1317251)
FT                   /locus_tag="ANIA_01616"
FT                   /old_locus_tag="AN1616.4"
FT                   /note="transcript_id=CADANIAT00008253"
FT   CDS_pept        join(1315711..1315835,1315913..1315999,1316056..1316136,
FT                   1316202..1317123)
FT                   /locus_tag="ANIA_01616"
FT                   /old_locus_tag="AN1616.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008253"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008253"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008253"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW4"
FT                   /protein_id="CBF85228.1"
FT                   /translation="MSMFPPAPKPPTLLGYHRVLSPSAGVKVSPLCLGAMNFGDAWKEY
FT                   MGECNKEQTFALLDAFYEAGGNFIDTANNYQQEESEKWIGEWLKKRGNRDQMVIATKYT
FT                   TGFRTSHRATEPLQSNFVGNSFKSMRVSVDNSLRKLQTDYIDILYLHWWDFTTSVEEVM
FT                   HGLNSLVTAGKVLYLGVSDTPAWVVVKANDYARAHGLKPFSVYQGKWNAAYRDMEREIV
FT                   PMCRDQGMGIAPWAPLGGGKFKSAEARKAASSGGSNRGAEMSESDIRISDALEKIAERK
FT                   KTTLHAIVSHPCQYPYLYSITDQCPCQALAYVMHKTPNVFPIVGQRKIEHLKANIEALS
FT                   ISLSDADMDEIDGATEFDVGFPMSFIFREFTGRNTAADVWLTKASALIDAPPQPGPVRH
FT                   REAER"
FT   gene            1317958..1318621
FT                   /locus_tag="ANIA_01617"
FT                   /old_locus_tag="AN1617.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1317958..1318071,1318373..1318621)
FT                   /locus_tag="ANIA_01617"
FT                   /old_locus_tag="AN1617.4"
FT                   /note="transcript_id=CADANIAT00008254"
FT   CDS_pept        join(1317958..1318071,1318373..1318621)
FT                   /locus_tag="ANIA_01617"
FT                   /old_locus_tag="AN1617.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008254"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008254"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008254"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW3"
FT                   /protein_id="CBF85230.1"
FT                   /translation="MTFGTANSGTYGHCKKDDAFGMLDAFYSKGGNFIDTAIGISDTPA
FT                   WVVSKANEYARQKGPRQFVVYQGMWNATMRDFERDIIPMCREEGMGLCPYGVLNQGRFQ
FT                   TEEGFRSVKNTTRGGI"
FT   gene            complement(1320046..1320576)
FT                   /locus_tag="ANIA_01618"
FT                   /old_locus_tag="AN1618.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1320046..1320222,1320296..1320454,
FT                   1320520..1320576))
FT                   /locus_tag="ANIA_01618"
FT                   /old_locus_tag="AN1618.4"
FT                   /note="transcript_id=CADANIAT00008255"
FT   CDS_pept        complement(join(1320046..1320222,1320296..1320454,
FT                   1320520..1320576))
FT                   /locus_tag="ANIA_01618"
FT                   /old_locus_tag="AN1618.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008255"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008255"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008255"
FT                   /db_xref="GOA:Q5BCW2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW2"
FT                   /protein_id="CBF85232.1"
FT                   /translation="MFSPLTLAILAICIAVSSSLTVGCYPEDYQIVQNDLFDGLYSLKN
FT                   DQISNLQPGTCERVVCNSNAAVYWCNDNEDRHAEVKSKQVGDAAWKIIHDCGISAHTLI
FT                   YAAGVVVYPTKIRVVVIKDDECLDQH"
FT   gene            1322401..1324119
FT                   /locus_tag="ANIA_01619"
FT                   /old_locus_tag="AN1619.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1322401..1322900,1322957..1323094,1323152..1323930,
FT                   1323984..1324119)
FT                   /locus_tag="ANIA_01619"
FT                   /old_locus_tag="AN1619.4"
FT                   /note="transcript_id=CADANIAT00008256"
FT   CDS_pept        join(1322448..1322900,1322957..1323094,1323152..1323930,
FT                   1323984..1324119)
FT                   /locus_tag="ANIA_01619"
FT                   /old_locus_tag="AN1619.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008256"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008256"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008256"
FT                   /db_xref="GOA:Q5BCW1"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BCW1"
FT                   /protein_id="CBF85234.1"
FT                   /translation="MLAAQFARTPGRRVMTKLSSQNPILRPASFLINQHNSTRKRAMSS
FT                   QPSATRTRALVDWASALQFTDLPPAVIARTKDFFVDTLACAVAGREHIAVKSMLEYSKI
FT                   MGPADGKCELIGFPDVKTTPAFAALVNGGAAHVVEQDDLHNSSMMHPATIIYPTALAVA
FT                   QDVGATGRDFITACVVGYEFACRAGEYLGKAHYEKFHTTATTGVLGAAATTAYLLRLDS
FT                   DQFLSSIGTAGTQAAGLWQFLLDATHSKQVHTAQACAAGVFSAYTSASGLLGTSDILEG
FT                   E