(data stored in ACNUC16935 zone)

EMBL: BR000306

ID   BR000306; SV 1; linear; mRNA; STD; FUN; 912 BP.
XX
AC   BR000306;
XX
DT   02-FEB-2007 (Rel. 90, Created)
DT   26-NOV-2008 (Rel. 97, Last updated, Version 2)
XX
DE   TPA: Aspergillus nidulans FGSC A4 UBI4 mRNA for polyubiquitin, partial cds.
XX
KW   Third Party Data; TPA; TPA:inferential.
XX
OS   Aspergillus nidulans FGSC A4
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RP   1-912
RA   Ganley A.R., Kobayashi T.;
RT   ;
RL   Submitted (26-APR-2006) to the INSDC.
RL   Contact:Austen Rd Ganley National Institute for Basic Biology, Division of
RL   Genome Dynamics; Nishigonaka 38, Okazaki, Aichi 444-8585, Japan
XX
RN   [2]
RC   Publication_Status: Available-Online
RA   Ganley A.R.D., Kobayashi T.;
RT   "Highly efficient concerted evolution in the ribosomal Mitogenomic
RT   evaluation of the historical biogeography of cichlids Highly efficient
RT   concerted evolution in the ribosomal DNA repeats: Total rDNA repeat
RT   variation revealed by whole-genome shotgun sequence data";
RL   Genome Res. 17:184-191(2007).
XX
DR   MD5; 6fb1caa25ad103f100fa62d869f67fbe.
DR   StrainInfo; 598196; 0.
XX
AH   LOCAL_SPAN      PRIMARY_IDENTIFIER   PRIMARY_SPAN   COMP
AS   1-22            AACD01000030.1       69019-69040    c
AS   23-238          AACD01000030.1       68742-68957    c
AS   239-912         AACD01000030.1       68010-68683    c
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..912
FT                   /organism="Aspergillus nidulans FGSC A4"
FT                   /strain="FGSC A4"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:227321"
FT   repeat_region   1..912
FT                   /rpt_family="polyubiquitin"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_range=1..228
FT                   /rpt_unit_range=229..456
FT                   /rpt_unit_range=457..684
FT                   /rpt_unit_range=685..912
FT   CDS_pept        1..>912
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="UBI4"
FT                   /product="polyubiquitin"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:A2RVC1"
FT                   /protein_id="FAA00317.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLSDYNIQKESTLHLVLRLRGG"
XX
SQ   Sequence 912 BP; 243 A; 251 C; 220 G; 198 T; 0 other;
     atgcagatct tcgtcaaaac cctcaccggc aagaccatca ctcttgaggt cgagtccagc        60
     gacactatcg acaatgtgaa gaccaagatc caggacaagg agggcatccc tcctgaccag       120
     cagcgcttga tcttcgccgg caagcagctc gaggacggcc gtaccctttc cgactacaac       180
     attcagaagg aatccactct gcacctcgtg ctccgtctgc gtggtggaat gcagattttt       240
     gtcaagactc ttaccggcaa gaccatcact ctcgaagtcg agtccagcga caccatcgac       300
     aatgtgaaga ccaagatcca ggacaaggag ggcatccctc ctgaccagca gcgcttgatc       360
     ttcgccggca agcaactcga ggacggccgt acattgtctg actacaatat ccagaaggaa       420
     tctacccttc acttggtcct ccgccttcgt ggtggtatgc aaatattcgt taagaccctc       480
     accggaaaga cgatcacgtt ggaggtggaa tcttcagata caatcgacaa tgtgaagtcg       540
     aagattcagg acaaggaggg tattcctcct gaccagcagc gtctcatttt tgccggaaag       600
     cagcttgagg atggacggac gctttctgat tataacattc agaaagagtc cacacttcac       660
     ctcgtccttc gtcttcgtgg tggtatgcag atctttgtca agacacttac tgggaagact       720
     atcacattag aagttgagag ctcagacacg atcgacaatg ttaagacgaa aatccaagac       780
     aaagagggaa tcccgccaga ccagcagcgt cttatcttcg ctggtaagca gctcgaggat       840
     ggacgtacgc tctcggatta taatatccag aaggagagta ctctccacct ggtcctccgt       900
     ctccgcggcg gc                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page